[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for hlac0:ACM57204.1

[Show Plain Result]


## Summary of Sequence Search
    1::377
    1::251     6e-17  29%  341 aa  YRBE_BACSU RecName: Full=Uncharacterized oxidoreductase yrbE;      
   88::288     3e-15  29%  403 aa  Y4HM_RHISN RecName: Full=Uncharacterized oxidoreductase y4hM;      
   55::346     5e-15  24%  350 aa  NTDC_BACSU RecName: Full=NTD biosynthesis operon putative
   85::287     4e-14  31%  393 aa  YFII_BACSU RecName: Full=Uncharacterized oxidoreductase yfiI;      
  150::424     2e-13  24%  433 aa  GFO_ZYMMO RecName: Full=Glucose--fructose oxidoreductase;       
   68::362     7e-13  26%  371 aa  Y816_SYNY3 RecName: Full=Uncharacterized oxidoreductase sll0816;   
   63::250     2e-12  31%  333 aa  AFR_ENSAD RecName: Full=1,5-anhydro-D-fructose reductase;       
    5::199     1e-11  29%  351 aa  YCJS_ECOLI RecName: Full=Uncharacterized oxidoreductase ycjS;      
   49::334     5e-11  27%  334 aa  YMO1_RHIME RecName: Full=Uncharacterized oxidoreductase ORF334;    
   71::307     2e-10  29%  330 aa  MI2D_RHIME RecName: Full=Inositol 2-dehydrogenase;       
   68::253     4e-10  38%  342 aa  YISS_BACSU RecName: Full=Uncharacterized oxidoreductase yisS;      
   77::190     1e-09  35%  360 aa  IOLG_BEUC1 RecName: Full=Inositol 2-dehydrogenase;       
   77::194     5e-09  34%  369 aa  YEG9_SCHPO RecName: Full=Uncharacterized oxidoreductase C26H5.09c; 
   66::245     2e-08  37%  335 aa  DHDH_BOVIN RecName: Full=Trans-1,2-dihydrobenzene-1,2-diol
   62::238     2e-08  27%  397 aa  CBAC_COMTE RecName: Full=1-carboxy-3-chloro-3,4-dihydroxycyclo
   52::244     3e-08  36%  345 aa  YHHX_ECOLI RecName: Full=Uncharacterized oxidoreductase yhhX;      
  123::230     3e-08  34%  390 aa  GFOD1_MOUSE RecName: Full=Glucose-fructose oxidoreductase
   57::250     5e-08  26%  367 aa  Y1686_STRPN RecName: Full=Uncharacterized oxidoreductase SP_1686;  
   61::250     9e-08  25%  372 aa  YJHC_ECOLI RecName: Full=Uncharacterized oxidoreductase yjhC;      
   12::235     9e-08  30%  410 aa  PHT4_PSEPU RecName: Full=Putative 4,5-dihydroxyphthalate
   58::195     1e-07  40%  368 aa  YBQ3_SCHPO RecName: Full=Uncharacterized oxidoreductase C115.03;   
    5::187     1e-07  29%  317 aa  MOCA_RHIME RecName: Full=Rhizopine catabolism protein mocA;        
  123::230     1e-07  32%  390 aa  GFOD1_XENTR RecName: Full=Glucose-fructose oxidoreductase
  123::230     1e-07  39%  390 aa  GFOD1_HUMAN RecName: Full=Glucose-fructose oxidoreductase
   47::250     1e-07  27%  333 aa  AFR_RHIME RecName: Full=1,5-anhydro-D-fructose reductase;       
   67::233     2e-07  37%  335 aa  DHDH_CANFA RecName: Full=Trans-1,2-dihydrobenzene-1,2-diol
   76::154     5e-07  35%  337 aa  IOLG_CORGL RecName: Full=Inositol 2-dehydrogenase;       
   76::154     5e-07  35%  337 aa  IOLG_CORGB RecName: Full=Inositol 2-dehydrogenase;       
   66::210     6e-07  26%  330 aa  DHDH_XENTR RecName: Full=Trans-1,2-dihydrobenzene-1,2-diol
   80::282     8e-07  28%  368 aa  YKJ6_SCHPO RecName: Full=Uncharacterized oxidoreductase C513.06c;  
   66::210     1e-06  26%  330 aa  DHDH_XENLA RecName: Full=Trans-1,2-dihydrobenzene-1,2-diol
   65::190     1e-06  30%  346 aa  YDGJ_ECOLI RecName: Full=Uncharacterized oxidoreductase ydgJ;      
   53::206     2e-06  26%  428 aa  YTET_BACSU RecName: Full=Putative oxidoreductase yteT;       
   82::199     2e-06  30%  358 aa  YVAA_BACSU RecName: Full=Uncharacterized oxidoreductase yvaA;      
   60::239     2e-06  37%  329 aa  DHDH_RABIT RecName: Full=Trans-1,2-dihydrobenzene-1,2-diol
   67::245     3e-06  28%  334 aa  DHDH_PONAB RecName: Full=Trans-1,2-dihydrobenzene-1,2-diol
   67::226     3e-06  27%  333 aa  DHDH_MOUSE RecName: Full=Trans-1,2-dihydrobenzene-1,2-diol
   67::245     3e-06  28%  334 aa  DHDH_MACFU RecName: Full=Trans-1,2-dihydrobenzene-1,2-diol
   67::245     3e-06  28%  334 aa  DHDH_MACFA RecName: Full=Trans-1,2-dihydrobenzene-1,2-diol
   67::248     5e-06  35%  334 aa  DHDH_HUMAN RecName: Full=Trans-1,2-dihydrobenzene-1,2-diol
   67::245     7e-06  33%  335 aa  DHDH_PIG RecName: Full=Trans-1,2-dihydrobenzene-1,2-diol
   66::213     3e-05  30%  334 aa  DHDH_DANRE RecName: Full=Trans-1,2-dihydrobenzene-1,2-diol
    1::103     4e-05  38%  338 aa  IOLG4_SACEN RecName: Full=Inositol 2-dehydrogenase 4;       
   78::188     4e-05  29%  339 aa  IOLG2_SACEN RecName: Full=Inositol 2-dehydrogenase 2;       
   59::198     6e-05  29%  349 aa  YM94_YEAST RecName: Full=Uncharacterized protein YMR315W;
   75::102     6e-05  61%  337 aa  IOLG1_SACEN RecName: Full=Inositol 2-dehydrogenase 1;       
    8::204     7e-05  27%  350 aa  IOLG_LACPL RecName: Full=Inositol 2-dehydrogenase/D-chiro-inositol
   16::193     4e-04  26%  328 aa  YULF_BACSU RecName: Full=Uncharacterized oxidoreductase yulF;      
   46::247     4e-04  26%  328 aa  YGJR_ECOLI RecName: Full=Uncharacterized oxidoreductase ygjR;      
   78::239     4e-04  28%  346 aa  IOLG_RHOE4 RecName: Full=Inositol 2-dehydrogenase;       
   58::256     5e-04  28%  337 aa  IOLG_ARTCA RecName: Full=Inositol 2-dehydrogenase;       
   76::266     8e-04  27%  337 aa  IOLG1_ARTAT RecName: Full=Inositol 2-dehydrogenase 1;       
    1::377

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTQQPLRIGVLGYRFMGKAHANALARLPMFFPDAPDIERHTLVGRXXXXXXXXXXRFGFSHTATDWEDSL
YRBE_BACSU      MTKQ-IVTGIIGAGRIGKLHVQNISRIPMKIKAISDIQASRIKS--------WADSHQIEYITSDYRDLL
Y4HM_RHISN      ------------------------------------------------------------------DDGI
NTDC_BACSU      ------------------------------------------------------------------DELI
YFII_BACSU      ----------------------------------------------------------------------
GFO_ZYMMO       ----------------------------------------------------------------------
Y816_SYNY3      ----------------------------------------------------------------------
AFR_ENSAD       ----------------------------------------------------------------------
YCJS_ECOLI      MTSSPLRVAIIGAQVADKVHAS-------YYCTRNDLELVAVCDSRLSQAQALAEKYG---NASVWDDPQ
YMO1_RHIME      --------------------------------------------------------FGIGRSYGSYDEIL
MI2D_RHIME      ----------------------------------------------------------------------
YISS_BACSU      ----------------------------------------------------------------------
IOLG_BEUC1      ----------------------------------------------------------------------
YEG9_SCHPO      ----------------------------------------------------------------------
DHDH_BOVIN      ----------------------------------------------------------------------
CBAC_COMTE      ----------------------------------------------------------------------
YHHX_ECOLI      ------------------------------------------------------------HFTSDLDEVL
GFOD1_MOUSE     ----------------------------------------------------------------------
Y1686_STRPN     --------------------------------------------------------------------SS
YJHC_ECOLI      ----------------------------------------------------------------------
PHT4_PSEPU      -----LRLGVVG---LGRAFT---LMLPTFLAD----RRVQLVGACDPREQARR-QFERDFDAPAYETIE
YBQ3_SCHPO      ---------------------------------------------------------------TNLDELL
MOCA_RHIME      ------RLGLVGAGRMGQVHVRAAAESSLVVADPIAASRLNLAGNGIKTY----------ETAGDMIEA-
GFOD1_XENTR     ----------------------------------------------------------------------
GFOD1_HUMAN     ----------------------------------------------------------------------
AFR_RHIME       ---------------------------------------------------------GIAKAVTSVDDLV
DHDH_CANFA      ----------------------------------------------------------------------
IOLG_CORGL      ----------------------------------------------------------------------
IOLG_CORGB      ----------------------------------------------------------------------
DHDH_XENTR      ----------------------------------------------------------------------
YKJ6_SCHPO      ----------------------------------------------------------------------
DHDH_XENLA      ----------------------------------------------------------------------
YDGJ_ECOLI      ----------------------------------------------------------------------
YTET_BACSU      -----------------------------------------------------------AHVPEFSEDAF
YVAA_BACSU      ----------------------------------------------------------------------
DHDH_RABIT      ----------------------------------------------------------------------
DHDH_PONAB      ----------------------------------------------------------------------
DHDH_MOUSE      ----------------------------------------------------------------------
DHDH_MACFU      ----------------------------------------------------------------------
DHDH_MACFA      ----------------------------------------------------------------------
DHDH_HUMAN      ----------------------------------------------------------------------
DHDH_PIG        ----------------------------------------------------------------------
DHDH_DANRE      ----------------------------------------------------------------------
IOLG4_SACEN     MSNRELRVGLVGAGLMGSDHATRIHRR---------ISGASLVAVGDPDLXXXXXXXXGIEGCQVETDPL
IOLG2_SACEN     ----------------------------------------------------------------------
YM94_YEAST      -------------------------------------------------------------------DNL
IOLG1_SACEN     ----------------------------------------------------------------------
IOLG_LACPL      ------KVGIVGIGFIGSDHLHRLTKT------VANVDVTAVCDIVPGKAQKALDQQGL--TATTYEDYH
YULF_BACSU      -----------------------------FLESAADIEDFQLTARSAERAGEFAAKHNAAHAFSDLQEAS
YGJR_ECOLI      --------------------------------------------------------FSVEHLFTSLEAMA
IOLG_RHOE4      ----------------------------------------------------------------------
IOLG_ARTCA      ----------------------------------------------------------------DAEEAL
IOLG1_ARTAT     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DEVDVFYNLGPNHVHAEPSIAALEAGVPVLCEKPLAPTLXXXXXXXXXXXXXXXXXXXXFNYRFIPAIRY
YRBE_BACSU      HDIDAIFICSPTAVHAQMIKEAAEAKKHIFCEKPVSFSLDETSEALAAVRKHGVTLQVGFNRRFDPHFKK
Y4HM_RHISN      EAVSI---VTPNWTHHRIATAFLKAGIDVILDKPMTTTVSDARELVELQRATDRLVIMTYPYAHHAMVRQ
NTDC_BACSU      DASEGLIVASPNFCHKEHALQALGKHKHVLCEKPMAISLEEASIMKDTAERLSVRASMGFNYRYLSYVNI
YFII_BACSU      DGIEVVSIATPNGTHYEICKAALEAGVHVICEKPLFFTSAEGQEIKALAEKKGKIVGVTYGFSGNQMLLQ
GFO_ZYMMO       -KIDAVYIILPNSLHAEFAIRAFKAGKHVMCEKPMATSVADCQRMIDAAKAANKKLMIGYRCHYDPMNRA
Y816_SYNY3      -EVQAVTIASPPFLHYEMAKQAILAGKHVLLEKPMTLRVEETIELYHLARQREVQVIPDFEFRFVPAWQY
AFR_ENSAD       -DVDAVYVSTTNELHREQTLAAIRAGKHVLCEKPLAMTLEDAREMVVAAREAGVVLGTXXXXXXXXXXXX
YCJS_ECOLI      AMLDVVSVCSPNRFHYEHTLMALEAGCHVMCEKPPAMTPEQAREMCDTARKLGKVLAYDFHHRFALDTQQ
YMO1_RHIME      PEIEAVYIPLPNHLHVHWAIRAAEAGKHVLCEKPLALDVEELSRLIDCRDRTGRRIQEAVMIRAHPQWDE
MI2D_RHIME      ----------PTDTHADLIERFARAGKAIFCEKPIDLDAERVRACLKVVSDTKAKLMVGFNRRFDPHFMA
YISS_BACSU      --IDAVIIVTPTSTHGDMIIKAAENGKQIFVEKPXXXXXXXXXXXXXXXXXXGVICQVGFMRRFDPAYAD
IOLG_BEUC1      --------------HLEPVLAAVAAGKPVLCEKPLAPTAECEQVMAAEVAAGRRLVTIGFMRRFDASYLA
YEG9_SCHPO      ----------PPNVHYEVVSQALNAGKHVLCEKPFTPTYGEAKELFDLAKSKNLMLTVYQNRRFDGDFLT
DHDH_BOVIN      -DVEVAY-IGTQHPHKAAVLLCLTAGKAVLCEKPMGXXXXXXXXXXXXXXXXGLFFMEAIWTRFFPAVEA
CBAC_COMTE      -DVEVVYIGTPHQFHAVHAEIALNAGKHVLVEKPMAVTLEDCCRMNACAQRAGKYLIVGHSHSFDHPISR
YHHX_ECOLI      NDPDVKLVVVCTHAHFEYAKRALEAGKNVLVEKPFTPTLAQAKELFALAKSKGLTVTPYQNRRFDSCFLT
GFOD1_MOUSE     --------------------------------------------------------------RFLPAFVR
Y1686_STRPN     DEVDCVIVATPNNLHKEPVIKAAQHGKNVFCEKPIALSYQDCREMVDACKENNVTFMAGHIMNFFNGVHH
YJHC_ECOLI      --VDCVIVATPNYLHKEPVIKAAKNKKHVFCEKPIALSYEDCVDMVKACKEAGVTFMAGHIMNFFNGVQY
PHT4_PSEPU      DNVDALYIASPHQFHAEHTRIAAANRKHVLVEKPMALSLDECDRMIADCAEAGVKLIVGHCHSFDTPYLR
YBQ3_SCHPO      ADVNVVVSLPPN-VHSEIVKKALNAGKHVVCEKPFTPTXXXXXXXXXXXXXXSLLLAIYQNRRWDGDFLT
MOCA_RHIME      GEVDGVLIATPSNTHVDTVADIAARGLPILCEKPCGVTAEEARKAADVAERYKVHLQIGYWRRFVPELKQ
GFOD1_XENTR     --------------------------------------------------------------RFLPAFVK
GFOD1_HUMAN     --------------------------------------------------------------RFLPAFVR
AFR_RHIME       GDVDAVYISTTNELHHGQALAAIRAGKHVLCEKPLAMNLNDGCEMVLKACEAGVVLGT--NHHLRNAATH
DHDH_CANFA      --VEVAY-IGTQHPHKAAVLLCLAAGKAVLCEKPMGXXXXXXXXXXXXXXXXGLFLMEAIWTRFFPAIEA
IOLG_CORGL      ----------PGQFHEPVLVPALEAGLPILCEKPLTPSESSLRIVELEQKLDKPHIQVGFMRRFDPEYNN
IOLG_CORGB      ----------PGQFHEPVLVPALEAGLPILCEKPLTPSESSLRIVELEQKLDKPHIQVGFMRRFDPEYNN
DHDH_XENTR      -DIDVIYVGAIHPVHRDVVLMCLQNGKNILCEKPLAMNAAQVQELIATARKFNVFLMEAFWSRFFPVYEE
YKJ6_SCHPO      DKVDIVYISSTHPQHYEVVKLALLNDKAVLCEKPLTINYPEALELVELARARNLFFAEGFWIRFYPIVKA
DHDH_XENLA      -DIDVIYVGAIHPVHRDVVLMCLQNGKNVLCEKPLAMNSAQVRELIAAARKFNVFLMEAFWSRFFPVYEE
YDGJ_ECOLI      --IDLIVIPTPNDTHFPLAKAALEAGKHVVVDKPFTVTLSQARELDALAKSLGRVLSVFHNRRWDSDFLT
YTET_BACSU      DEMDIVIVAGRDDTHVAYIVKSLQWNTDVITEKPMVTTVQDANRVLEAEAKSEGKVTVAFNYRYSPFHRK
YVAA_BACSU      ----------PSGLHYEHTMACIQAGKHVVMEKPMTATAEEGETLKRAADEKGVLLSVYHNRRWDNDFLT
DHDH_RABIT      -DVEVAY-IGTQHPHKAAVLLFLAAGKAVLCEKPLGXXXXXXXXXXXXXXXXGLFLMEAIWTRCFPAVDA
DHDH_PONAB      --VEVAY-IGTQHPHKAAVMLCLAAGEAVLCEKPMGVNVAEVREMVAEARSRDLFLMEAIWTRFFPASEA
DHDH_MOUSE      --VEVAYIATQHPQHKPAVLLCLAAGKAVLCEKPMGVNAAEVREMVAKARSQGVFLMEAIWSRFFPAMEA
DHDH_MACFU      --VEVAY-VGTQHPHKAAVMLCLAAGKAVLCEKPMGVNAAEVREMVTEARSRGLFLMEAIWTRFFPASEA
DHDH_MACFA      --VEVAY-VGTQHPHKAAVMLCLAAGKAVLCEKPMGVNAAEVREMVTEARSRGLFLMEAIWTRFFPASEA
DHDH_HUMAN      --VEVAY-IGTQHPHKAAVMLCLAAGKAVLCEKPTGXXXXXXXXXXXXXXXXXLFLMEAIWTRFFPASEA
DHDH_PIG        --VEVAY-IGTQHPHKATVLLCLAAGKAVLCEKPMGXXXXXXXXXXXXXXXXGLFLMEAIWTRFFPAVEA
DHDH_DANRE      -EIDVVYTIHPHHLRV--GLLFMNAKKNVLCEKPLAMNLKEVQQMISAARRSDVFLMEAVWTRFFPASLE
IOLG4_SACEN     SDVDAVVLATPGRTHEPLLLAAIERGIPVLCEKPLTP---------------------------------
IOLG2_SACEN     --------------HEEFALACVRAGKPVLCEKPLATTSACLRVVEAEMRGGRPLVQVGFMRRFDPSYLE
YM94_YEAST      DEVDYIDALLPAQFNADIVEKAVKAGKPVILEKPIAANLDQAKEIVKIAESTPLPVGVAENWLYLPCIKI
IOLG1_SACEN     ----------PDHTHEALATACVEAGKPVLCEKPLAAT--------------------------------
IOLG_LACPL      DNVEVVVCTANNEAHYEIVMAALKAGKFTFCEKPLADAKQCMDIIDSEKKLGRRMLQVGFMRHYAPEYVQ
YULF_BACSU      DCFDAVYIASPNALHKEQAVLFMNHGKHVLCEKPFASNTKETEEMISAAKANGVVLMEAMKTTFLPNFKE
YGJR_ECOLI      DAIDAVYIASPNSLHFSQTQLFLSHKINVICEKPLASNLAEVDAAIACARENQVVLFEAFKTACLPNFHL
IOLG_RHOE4      ----------PGPTHEKQVLACLEAGKPVLCEKPLTTDASSLAIVKAEAALGKKLIQVGFMRRFDHEYTQ
IOLG_ARTCA      NNGDVNAVLTPGFLHEDILLKAIAKDIPILCEKPLTPDASSLKIVEAEVALGRKRIQVGFMRRFDAEYAA
IOLG1_ARTAT     ----------PGFLHEEILYKALEKDFPILCEKPLTPDASAWKVVQAEQALGHKRIQVGFMRRFDAEYSA


                         +         .         .         .         .         *         .:210
query           AKGLIEDGELGEIRQVRGRYLQDWLVDPEAPWAWRMDADTAGSGALGDLGAHTLDLADFLVGDEVGEIDR
YRBE_BACSU      IKTIVENGEIGHLLKITSR-------DPEPP---NIDYVRTSGGLFMDMSIHDFDMARYIMGSEVTEVYA
Y4HM_RHISN      AKHMIRNGAVGTVRQAHVEYVQEWATAPFSSDAWRQDPEKVGASATGDIGTHAYHLLHTLTGQDIARL--
NTDC_BACSU      LKSLIINNELGNILSIKVHFKKNSAL-RRKKFTWRDDANSKTSGSLGDLGIHLIDMVWYLFESDF-ITES
YFII_BACSU      MRAMIEQGMIGDIRVVDLQYTHGFCATDEAAQKWRVDPAIAGSFVLGDLSTHTYYMSQLIMPKM--KIKE
GFO_ZYMMO       AVKLIRENQLGKLGMVTTDN-SDVMDQNDPAQQWRLRRELAGGGSLMDIGIYGLNGTRYLLGEEPIEVRA
Y816_SYNY3      ----VAEXXXXXXXXXXXXXXVDWLVNPNRAWNWYAQREKGG-GALGALASHTFDYLHWL----FGPAQS
AFR_ENSAD       XXXXXXEGRIG--RPIAARVFHAVYLPPHLQ-GWRLERPEAGGGVILDITVHDADTLRFVLNDDPAEAVA
YCJS_ECOLI      LREQVTNGVLGEIYVTTARALRRCGV---PGWGVFTNKELQGGGPLIDIGIHMLDAAMYVLG--------
YMO1_RHIME      IFDIVASGEIGEVRAIQGVFTEVNL-DPKS----IVNDASIGGGALYDLGVYPIAAARMVFAAEPERVFA
MI2D_RHIME      VRKAIDDGRIGEVEMVTITSR-----DPSAP---PVDYIKRSGGIFRDMTIHDFDMARFLLGEEPVSVTA
YISS_BACSU      AKRRIDAGEIG-----KPIYYKGFTRDQGAPPA---EFIKHSGGIFIDCSIHDYDIARYLLG---AEITS
IOLG_BEUC1      MKAVLDGGELGEALLVHCRHR-----NPSAREAYR------ATMAITDTAIHEIDAMRWLLGEEIARV--
YEG9_SCHPO      AKECIENGRLGEVVQFES-HIDRFRLFRKGNW---KDVPNPGCGLVYDLGSHLIDQAITLFG--------
DHDH_BOVIN      LRSVLAQGTLGDLRVVRAEFGKNLTVHRATDWA------QAGGGLL-DLGIYCLQFISMVFGGQKPE---
CBAC_COMTE      AKELIDSGRYGRVRFIHSMNYTDFLYRPRR--AEELNTD-LGGGVVFNQASHQLDVIRLLAQGRVVDVSS
YHHX_ECOLI      AKKAIESGKLGEIVEVESHF------DYYRPVA-ETKPGLPQDGAFYGLGVHTMDQIISLFG--------
GFOD1_MOUSE     MKQLIEEGYVGELLVCEVQVHSGSLLGKKYNWSC---DDLMGGGGLHSVGTYIIDLLTFLTGQKA---VK
Y1686_STRPN     AKELINQGVIGDV--LYCHTARNGWEEQQPSVSWKKIREKSGGHLYHHI--HELDCVQFLMGGMPETVTM
YJHC_ECOLI      ARKLIKEGVIGEILSCHTK--RNGWENKQERLSWKKMKEQSGGHLYHHI--HELDCVQHLLGEIPETVTM
PHT4_PSEPU      TRELIGSGEFGAVKMIQALNYTDYLQRPRRP----EELSTAGGGAVFSQAAHQVDVVRLLAGSRATRVRA
YBQ3_SCHPO      AKKIIESGRLGQVVEFESHFDRYRLGRKSGSW---KDEPRPGNGMVYGIGSHLIDQAVSLFG--------
MOCA_RHIME      LRDDIRAGLLGNL------YLVSCFQWDEAPPANSFRA--TGGGAFIDMGVHEFDQMRWLTGQE------
GFOD1_XENTR     MKQLIQEGYVGELQVCEVQVHSGSLLGKKYNWSC---DDLMGGGGLHSVGSYIIDLLTFLTSQKA---VK
GFOD1_HUMAN     MKQLIEEGYVGEPLQVHGGSLLG------KKYNWSCD-DLMGGGGLHSVGTYIIDLLTFLTGQKA---VK
AFR_RHIME       XXXXXXXXXXXXXXXXXXXVFHAVYLPPHLQ-GWRLDKPEAGGGVILDITVHDADTLRFVLNDDPIEAVA
DHDH_CANFA      LRAALSQGTLGELRVARAEFGKNFTHIPRS-----VDWAQAGGGLL-DLGIYCIQFISMVFGGQKPE---
IOLG_CORGL      LRKLVESGEAGELLMLRG----------------------------------------------------
IOLG_CORGB      LRKLVESGEAGELLMLRG----------------------------------------------------
DHDH_XENTR      IRALLSQKAIGDVKFIRAEFGVEIYKVPRAV------EKELGGGALLDIGCYCVQFVTMVFNGERPESVT
YKJ6_SCHPO      AKTLLEDRVCGDHFRLFVDFSQDFRF-RELPSESRLRTVSLGAGVLLDMGVYPLTWSRLLLYDDEKQEPT
DHDH_XENLA      IRTLLSQKAIGDVKFIRAEFGTPIYTVPRAV------EKELGGGALLDIGCYCVQFVTMVFNGEKPESVT
YDGJ_ECOLI      LKGLLAEGVLGEVAYFESHFDR---FRPQVRDRWR-EQGGPGSGIWYDLAPHLLDQAITLFG--------
YTET_BACSU      IKEMILDGKIGRVTSVD----LNWYIDTGASYFKRWNRSRQFSGGLSHKSTHHFDLVNWWLGQNPEEV--
YVAA_BACSU      IKKLISEGSLEDINTYQVSYNR---YRPEVQARWREKEGTA-TGTLYDLGSHIIDQTLHLFG--------
DHDH_RABIT      LKSLLAQGALGDLRVARAEFGENLTVLRSVDWA------QAGGGLL-DLGIYCVQFISMVFGGQKPE---
DHDH_PONAB      LRSVLAQGTLGDLRVARAEFGKNLTHIPRADWA-------QAGGALLDIGIYCVQFISMVFGGQKPEKIS
DHDH_MOUSE      LREVLVQGTIGDLRVARAEFGFDLSHIPRA-----TDWNQAGGGLL-DLGIYCVQFLSMIFGAQKPE---
DHDH_MACFU      LRSVLAQGTLGDLRVARAEFGKNLTHVPRADWA-------QAGGALLDLGIYCVQFISMVFGGQKPEKIS
DHDH_MACFA      LRSVLAQGTLGDLRVARAEFGKNLTHVPRADWA-------QAGGALLDLGIYCVQFISMVFGGQKPEKIS
DHDH_HUMAN      LRSVLAQGTLGDLRVARAEFGKNLIHVPRA-----VDRAQAG-GALLDIGIYCVQFTSMVFGGQKPEKIS
DHDH_PIG        LRSVLAQETLGDLRVVQANFGKSIANVPRSDWA-------QAGGSLLDLGIYCLQFISMVYGGQKPE---
DHDH_DANRE      ISRLLSQNAVGQVKLVRADFGAALLGVPRAV------QKHLGGGALLDIGIYCIQFVLMVFNGEKPEQIQ
IOLG4_SACEN     ----------------------------------------------------------------------
IOLG2_SACEN     MKRVLDSGRIGRALMLHSVH-RNAGYPPALP----------DSALITGTGVHDIDIARWLLGQEI-----
YM94_YEAST      AKEQIE--KIGPVVAFTHNSTGPFVTQNKLTTTWRQKPEHIG-GFLSDGGVHQLALVISLLGE-------
IOLG1_SACEN     ----------------------------------------------------------------------
IOLG_LACPL      MKKMIDDGVIGKPLMMDQRHYNQ--TQPEEYDSSRSIIETA---------IHEIDIDHWLVNDDYANI-R
YULF_BACSU      LKKHLH--KIGTVRRFTASYCQ---------YSSRYDAFRSGNGSLMDIGVYCIYPAVVLFG--------
YGJR_ECOLI      LRQALP--KVGKLRKVFFNYCQQRYLDGENPNTFN---PAFSNGSIMDIGFYCLASAVALFG-EPKSVQA
IOLG_RHOE4      LKYLIDSGDLGRPLVVHCAHR-----NPAVPNGF----DSA--MIVKDSLVHEVDVTRFLLDEEITSVQI
IOLG_ARTCA      LGSIIRNQELGELLMLHHQHR-----NPTTP------AGFTNEMLINDSVVHEFDAIRFFTGEEIGKVTK
IOLG1_ARTAT     LGAIIRNSELGELLMLHHQHR-----NPSTPEGFTNEM------LINDSVVHEFDAIRFFTGEEIGKPTR


                         .         .         .         +         .         .         .:280
query           VSGHLQTFVDERPVYDEAGDVEEYRDVTVDDAYTAQVAYESGAMGSFEATRFAEGHKNDHAIEIHGSKGS
YRBE_BACSU      KGAAL-----VNPSFAELGDI---------DTAVITLTFENGAMAVIDNSRQAV-YGYDQRVEVFGTKGS
Y4HM_RHISN      -----------RAEFHTCGAVKAMED-------TAYVTFENGAPGILWVTQAAPGQYCGLRIRVWGDRGG
NTDC_BACSU      VRAKMNTNV----------KTKEDKQVLVDDYAEIYGQLKNKVFVNIITSKCSVPEDCGFSIEVVGHKKE
YFII_BACSU      LLCDRQSFVGSR--------------APLEDNAHVLMHYENGAVGTMWTSSINAGCMDGHRIRIVGSKAS
GFO_ZYMMO       YT---------------YSDPNDERFVEVEDRIIWQMRFRSGALSH---GAXXXXXXXXXRFSVQGDKAV
Y816_SYNY3      LAANLSVAIAERP---DPLDNNRLKPVTAEDTALISLTLANDVPCQINITSVAHGGRG-HWLEIYGEKGS
AFR_ENSAD       IS-------------HSAGMGKE----GVEDGVMGGVRFQSGVIAQFHTTKFAE-----TGFEVHGTEGS
YCJS_ECOLI      ----------------------------------------------------------------------
YMO1_RHIME      VS-------DLDPVFG------------IDRLTSAVLLFPGGRQATLVSTQLALRHN----VEIFGTRKS
MI2D_RHIME      TAAVL--------IDKAIGDAGDYDSVSV----ILQTA--SGKQAIISNSRRAT-YGYDQRIEVHGSKGA
YISS_BACSU      VSGHGR--ILNNPFMEQYGD--------VDQALT-YIEFDSGAAGDVEASR-TSPYGHDIRAEVIGTEGS
IOLG_BEUC1      ----------------------------------------------------------------------
YEG9_SCHPO      ----------------------------------------------------------------------
DHDH_BOVIN      ----------------KISAVGRRHETGVDDTVTVILQYPGGVHGSFTCSISAQ---LSNTVSVSGTKG-
CBAC_COMTE      YLGR----------WDAARRTE--------GAYSALIKFDNGVAANVTYSGYAHYNSDE-----------
YHHX_ECOLI      -----------RPDH-VAYDIRSLRNANPDDTFEAQLFY-----GDLKAI-----VKTSHLVKIHGKKGS
GFOD1_MOUSE     VHGLLKTFV------KQTDHIKGIRQITSDDFCTFQMVLEGG----------------------------
Y1686_STRPN     TGGNV------------AHEGEHFGD--EDDMIFVNMEFSNKRFALLEAYRWGE-----HYVLIQGSKGA
YJHC_ECOLI      IGGNL--------AHSGPGFGNE------DDMLFMTLEFPSGKLATLEGSAF---NWPEHYVIINGTKGS
PHT4_PSEPU      AVGN----------WDPARPTE--------GAYTATLWFENGAFAS------------------------
YBQ3_SCHPO      ----------------------------------------------------------------------
MOCA_RHIME      ----------------------------------------------------------------------
GFOD1_XENTR     VHGLLKTFV------KQTDHIKGIRQITSDDFCTFQMVLEGG----------------------------
GFOD1_HUMAN     VHGLLKTFV------KQTDHIKGIRQITSDDFCTFQMVLEGG----------------------------
AFR_RHIME       IS-------------HSAGMGKE----GLEDGVMGVLRFRSGVIAQFHTTKFAE-----TGLEVHGTAGS
DHDH_CANFA      ----------------KISAVGRRYETGVDDTVTVLLQYPGGIHGSFTCSISAQ----------------
IOLG_CORGL      ----------------------------------------------------------------------
IOLG_CORGB      ----------------------------------------------------------------------
DHDH_XENTR      AKGFLETGVDE-----------------------------------------------------------
YKJ6_SCHPO      VSSNALTFEDHN------GDIGDYTTVTLVFPKTESIA--------MLCTSMDRGKMSDDFLKLDGENGN
DHDH_XENLA      ARGFLETGVDE-----------------------------------------------------------
YDGJ_ECOLI      ----------------------------------------------------------------------
YTET_BACSU      ----------------------------------------------------------------------
YVAA_BACSU      ----------------------------------------------------------------------
DHDH_RABIT      ----------------KISAVGRRYETGVDDTVTVLLQYPGGVHGSFTC---SISSKLSNTCSVSGTKG-
DHDH_PONAB      VVG-------------------RRHETGVDDTVTVLLQYPGEVHGSFTCSITAQ---LSNTASVSGTKG-
DHDH_MOUSE      ----------------KISAVGRIHETGVDDTVSVLLQYPGGVHGSF-----------------------
DHDH_MACFU      VMG-------------------RRHETGVDDTVTVLLQYPGEVHGSFTCSITAQ---LSNTASVSGTKG-
DHDH_MACFA      VMG-------------------RRHETGVDDTVTVLLQYPGEVHGSFTCSITAQ---LSNTASVSGTKG-
DHDH_HUMAN      VVG-------------------RRHETGVDDTVTVLLQYPGEVHGSFTCSITVQ---LSNTASVSGTKGM
DHDH_PIG        ----------------KISAVGRRYETGVDDTVSVLLQYPGGVQGSFTCSITSQ---LSNTVSVSGTKG-
DHDH_DANRE      ASGCLDTGVDEAMV--------------------------------------------------------
IOLG4_SACEN     ----------------------------------------------------------------------
IOLG2_SACEN     ----------------------------------------------------------------------
YM94_YEAST      ----------------------------------------------------------------------
IOLG1_SACEN     ----------------------------------------------------------------------
IOLG_LACPL      VFSPKQT---------------------------------------------------------------
YULF_BACSU      ----------------------------------------------------------------------
YGJR_ECOLI      TASLLASGVDAQGVV-----VMDYGDFSVDSVLASEIQGEAGSL--------------------------
IOLG_RHOE4      IRPSANSLAPEGIQDPQIAETESGRHVDAEVFVTTGVAYE------------------------------
IOLG_ARTCA      NAPAGQHDPQHVLIETESGDVEIY--------VNAKFGYEVATQASFE----------DGIVSIGGDKG-
IOLG1_ARTAT     SAPSGQHDPQHVLLETESGDVEIY--------VNAKFGYQVATQASFEEGIVSIGSDNGPYVQTAGKWG-


                         .         *         .         .         .         .         +:350
query           LKFSXXXXXXXXXXXXXXXGYQTVLVTDETDPYVDHWWPPGHVIGWEHTFVHENYEFLSAVAEGGEFEPS
YRBE_BACSU      ----------------------------------------------------------------------
Y4HM_RHISN      LEW-------------------------------------------------------------------
NTDC_BACSU      FKYHTGNPHVYKL-------IDGLNVVDCPVPQSLLNDPPNEFYGWADSFRSELINWIASTQNDWVEIPS
YFII_BACSU      IEW-------------------------------------------------------------------
GFO_ZYMMO       LLMD------------PATGYYQNLISVQTPGHANQSMMPQFIMPANNQFSAQLDHLAEAVINNKPVRSP
Y816_SYNY3      LNLKDYVHGFRIFHHPVGQPMQELTVPTRLD------FPKVFADGRLAPVVRVVDEWVQSINQKRTPTPS
AFR_ENSAD       L---------------------------------------------------------------------
YCJS_ECOLI      ----------------------------------------------------------------------
YMO1_RHIME      LKNPFNPTPDDHCRIVLDNGSKLXXXXXET-----------RRVAPADQYRLQAERFSAAIRSGSPLPIE
MI2D_RHIME      VAAENQRP-----------------VSIEIATGDGYTRPPLHMTRYTEAYANEIESFIAAIEKGAEIAPS
YISS_BACSU      I---------------------------------------------------------------------
IOLG_BEUC1      ----------------------------------------------------------------------
YEG9_SCHPO      ----------------------------------------------------------------------
DHDH_BOVIN      ----------------------------------------------------------------------
CBAC_COMTE      ----------------------------------------------------------------------
YHHX_ECOLI      ----------------------------------------------------------------------
GFOD1_MOUSE     ----------------------------------------------------------------------
Y1686_STRPN     IR--------------------------------------------------------------------
YJHC_ECOLI      IK--------------------------------------------------------------------
PHT4_PSEPU      ----------------------------------------------------------------------
YBQ3_SCHPO      ----------------------------------------------------------------------
MOCA_RHIME      ----------------------------------------------------------------------
GFOD1_XENTR     ----------------------------------------------------------------------
GFOD1_HUMAN     ----------------------------------------------------------------------
AFR_RHIME       L---------------------------------------------------------------------
DHDH_CANFA      ----------------------------------------------------------------------
IOLG_CORGL      ----------------------------------------------------------------------
IOLG_CORGB      ----------------------------------------------------------------------
DHDH_XENTR      ----------------------------------------------------------------------
YKJ6_SCHPO      QLF-------------------------------------------------------------------
DHDH_XENLA      ----------------------------------------------------------------------
YDGJ_ECOLI      ----------------------------------------------------------------------
YTET_BACSU      ----------------------------------------------------------------------
YVAA_BACSU      ----------------------------------------------------------------------
DHDH_RABIT      ----------------------------------------------------------------------
DHDH_PONAB      ----------------------------------------------------------------------
DHDH_MOUSE      ----------------------------------------------------------------------
DHDH_MACFU      ----------------------------------------------------------------------
DHDH_MACFA      ----------------------------------------------------------------------
DHDH_HUMAN      VQ--------------------------------------------------------------------
DHDH_PIG        ----------------------------------------------------------------------
DHDH_DANRE      ----------------------------------------------------------------------
IOLG4_SACEN     ----------------------------------------------------------------------
IOLG2_SACEN     ----------------------------------------------------------------------
YM94_YEAST      ----------------------------------------------------------------------
IOLG1_SACEN     ----------------------------------------------------------------------
IOLG_LACPL      ----------------------------------------------------------------------
YULF_BACSU      ----------------------------------------------------------------------
YGJR_ECOLI      ----------------------------------------------------------------------
IOLG_RHOE4      ----------------------------------------------------------------------
IOLG_ARTCA      ----------------------------------------------------------------------
IOLG1_ARTAT     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           FEQGYKVQKLLDAVERADERGEWVSVE
YRBE_BACSU      ---------------------------
Y4HM_RHISN      ---------------------------
NTDC_BACSU      FSDGFRSQEVLEMFFEKDSNSQPMSV-
YFII_BACSU      ---------------------------
GFO_ZYMMO       GEEGMQDVRLIQAIYEAARTGRPVNTD
Y816_SYNY3      LRHGVYSQLLMDLTKQAHQEKHWVAV-
AFR_ENSAD       ---------------------------
YCJS_ECOLI      ---------------------------
YMO1_RHIME      LEWSLGTMKVLNAIQRSAERGNWETV-
MI2D_RHIME      GNDG-----------------------
YISS_BACSU      ---------------------------
IOLG_BEUC1      ---------------------------
YEG9_SCHPO      ---------------------------
DHDH_BOVIN      ---------------------------
CBAC_COMTE      ---------------------------
YHHX_ECOLI      ---------------------------
GFOD1_MOUSE     ---------------------------
Y1686_STRPN     ---------------------------
YJHC_ECOLI      ---------------------------
PHT4_PSEPU      ---------------------------
YBQ3_SCHPO      ---------------------------
MOCA_RHIME      ---------------------------
GFOD1_XENTR     ---------------------------
GFOD1_HUMAN     ---------------------------
AFR_RHIME       ---------------------------
DHDH_CANFA      ---------------------------
IOLG_CORGL      ---------------------------
IOLG_CORGB      ---------------------------
DHDH_XENTR      ---------------------------
YKJ6_SCHPO      ---------------------------
DHDH_XENLA      ---------------------------
YDGJ_ECOLI      ---------------------------
YTET_BACSU      ---------------------------
YVAA_BACSU      ---------------------------
DHDH_RABIT      ---------------------------
DHDH_PONAB      ---------------------------
DHDH_MOUSE      ---------------------------
DHDH_MACFU      ---------------------------
DHDH_MACFA      ---------------------------
DHDH_HUMAN      ---------------------------
DHDH_PIG        ---------------------------
DHDH_DANRE      ---------------------------
IOLG4_SACEN     ---------------------------
IOLG2_SACEN     ---------------------------
YM94_YEAST      ---------------------------
IOLG1_SACEN     ---------------------------
IOLG_LACPL      ---------------------------
YULF_BACSU      ---------------------------
YGJR_ECOLI      ---------------------------
IOLG_RHOE4      ---------------------------
IOLG_ARTCA      ---------------------------
IOLG1_ARTAT     ---------------------------