[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for hlac0:ACM57205.1

[Show Plain Result]


## Summary of Sequence Search
    1::323
    1::311     1e-55  36%  313 aa  YFIH_BACSU RecName: Full=Uncharacterized protein yfiH;
  143::289     2e-06  27%  293 aa  Y1311_METJA RecName: Full=Uncharacterized protein MJ1311;
  150::316     2e-06  29%  325 aa  MOCC_RHIME RecName: Full=Rhizopine catabolism protein mocC;
   83::266     1e-04  27%  282 aa  IOLI_BACHD RecName: Full=Inosose isomerase;       
    1::323

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDIGVLTVPLGGESIDDAVAYLDDIGVDAVELGVGGWPSEDHVDREAILDDDAAQAELRELLDEHGLRIS
YFIH_BACSU      MKLSYVTDSLGHLPFEDMLNFAAKLGIDTLEMTTGGWSPAPHLNLDELLQSSEKRKEFSQALEKRNMTLC
Y1311_METJA     ----------------------------------------------------------------------
MOCC_RHIME      ----------------------------------------------------------------------
IOLI_BACHD      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ALATHNNPLHPXXXXXXXXXXXXXXXXXXXDQLDVGTVTCFSGLPAGAPGDSTPNWITAPWPSEHADAHE
YFIH_BACSU      ALNCSGNPLDPGELGKSHRDITDKTMELAG-LLGVKKVIMMSGLPAGGPDDKVPNWITVSWPPVLKDILN
Y1311_METJA     ----------------------------------------------------------------------
MOCC_RHIME      ----------------------------------------------------------------------
IOLI_BACHD      -------------------------------------ITEFKGMMETAKALNIPYVVAVPLVTEEKILKS


                         +         .         .         .         .         *         .:210
query           YQWDEVAIPYWTDLAKHADHHGVDVAIEMHPNMLVYEPTGMLALREATNERIGANFDPSHLYWQGIDVIE
YFIH_BACSU      YQWEDVAIPYWKKLVKKAEACGVGIALENFSSQLVYNPETLFRLRNAVGPMVGLNLDPSHLLWMGADPII
Y1311_METJA     -----------SEIVEIAEDYGIKIGLENMPNVLGITPESLLEIKDIDSKNLGITFDIGHANTAGAEFVE
MOCC_RHIME      -----------TDLAERMAEFGVGLAFHHHMGTIVETDEEVDRLMSVTGERVGLLFDSGHSAFSGGDPVA
IOLI_BACHD      -EIKRSCVNVLTELSEIAKPYGVKVALEFHPQCTVNTFGQAYEIVEAVGDNIGLVLDCFHFHAMGSNISD


                         .         .         .         +         .         .         .:280
query           AIRFLGDHDAIHHFHAKDTKVYDANARVKGVLDTTSYTDESDRSWLFRSIGYGHDESHWKDVVSTLRMVG
YFIH_BACSU      AARELGS--AIHHVHGKDVRIERYLSAVNGLLETKEVTDPANRAWNYVAVGCGQDLQWWKEFFSVVKMMG
Y1311_METJA     KLQNIGI--GIIHVHAHDNNGYD---------------DEH--------LKIGEGNINFIEVLEKLKEIG
MOCC_RHIME      LC--VRHAKRIVHVHCKDVRGDVLRAAREGDLSFMDAVLEG----IFTVPGDGGVD--FPSILENLAKTG
IOLI_BACHD      LEK--ADISKIFILHMDDTEDFPVG-----------FLTDEDRVWP------GHGAINLDQMLSILKEKG


                         .         *         .         .         .         .         +:350
query           YEGALSIEHEDSLTSSREGLEKAVDVLDRAVFETQPGDAYxxx
YFIH_BACSU      YEGEVSLEMEDLTMSPEAGIRTSVEALKQTI------------
Y1311_METJA     YDGVISIENKNDAVKSKEILKEYLEIVNEKVAEKE--------
MOCC_RHIME      YRGWLVVEAEQDLTYAKMGHENLARMAAAAGFRLSSADAF---
IOLI_BACHD      YSGAVSVEPEYYQLSAEEAIKTAKD------------------