[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for hlac0:ACM57250.1

[Show Plain Result]


## Summary of Sequence Search
    1::293
    2::243     4e-65  59%  275 aa  TRUA_HALMA RecName: Full=tRNA pseudouridine synthase A;       
    4::235     5e-63  62%  266 aa  TRUA_HALSA RecName: Full=tRNA pseudouridine synthase A;       
    4::235     5e-63  62%  266 aa  TRUA_HALS3 RecName: Full=tRNA pseudouridine synthase A;       
    2::246     2e-60  58%  267 aa  TRUA_NATPD RecName: Full=tRNA pseudouridine synthase A;       
    4::247     1e-28  36%  266 aa  TRUA_THESM RecName: Full=tRNA pseudouridine synthase A;       
    4::240     3e-28  37%  266 aa  TRUA_UNCMA RecName: Full=tRNA pseudouridine synthase A;       
    4::243     3e-28  38%  267 aa  TRUA_PYRKO RecName: Full=tRNA pseudouridine synthase A;       
    4::231     2e-26  39%  267 aa  TRUA_METTP RecName: Full=tRNA pseudouridine synthase A;       
    4::228     2e-26  38%  269 aa  TRUA_METBF RecName: Full=tRNA pseudouridine synthase A;       
    4::228     3e-26  39%  269 aa  TRUA_METAC RecName: Full=tRNA pseudouridine synthase A;       
    4::243     5e-26  37%  267 aa  TRUA_THEON RecName: Full=tRNA pseudouridine synthase A;       
    4::228     5e-26  39%  269 aa  TRUA_METMA RecName: Full=tRNA pseudouridine synthase A;       
    4::228     3e-25  37%  275 aa  TRUA_METBU RecName: Full=tRNA pseudouridine synthase A;       
    5::234     2e-23  34%  265 aa  TRUA_ARCFU RecName: Full=tRNA pseudouridine synthase A;       
    4::243     6e-23  33%  267 aa  TRUA_THEGJ RecName: Full=tRNA pseudouridine synthase A;       
    4::234     6e-23  35%  263 aa  TRUA_PYRAB RecName: Full=tRNA pseudouridine synthase A;       
    4::231     2e-22  34%  266 aa  TRUA_PYRFU RecName: Full=tRNA pseudouridine synthase A;       
    4::240     9e-22  38%  280 aa  TRUA_METPE RecName: Full=tRNA pseudouridine synthase A;       
    4::239     1e-20  33%  262 aa  TRUA_PYRHO RecName: Full=tRNA pseudouridine synthase A;       
    8::245     1e-20  34%  246 aa  TRUA_EXISA RecName: Full=tRNA pseudouridine synthase A;       
    9::258     2e-20  34%  262 aa  TRUA_LACPL RecName: Full=tRNA pseudouridine synthase A;       
   13::207     4e-20  38%  293 aa  TRUA_SYNSC RecName: Full=tRNA pseudouridine synthase A;       
    9::251     4e-20  32%  253 aa  TRUA_GEOTN RecName: Full=tRNA pseudouridine synthase A;       
   22::207     5e-20  41%  295 aa  TRUA_PROMM RecName: Full=tRNA pseudouridine synthase A;       
    8::242     8e-20  33%  249 aa  TRUA_EXIS2 RecName: Full=tRNA pseudouridine synthase A;       
    8::245     8e-20  34%  246 aa  TRUA_ANOFW RecName: Full=tRNA pseudouridine synthase A;       
    5::225     1e-19  34%  275 aa  TRUA_METTH RecName: Full=tRNA pseudouridine synthase A;       
    9::247     1e-19  33%  258 aa  TRUA_GEOKA RecName: Full=tRNA pseudouridine synthase A;       
   14::276     2e-19  32%  276 aa  TRUA_RHOBA RecName: Full=tRNA pseudouridine synthase A;       
    5::250     2e-19  28%  274 aa  TRUA_METST RecName: Full=tRNA pseudouridine synthase A;       
    4::159     2e-19  43%  270 aa  TRUA_BURM1 RecName: Full=tRNA pseudouridine synthase A;       
    7::223     3e-19  34%  263 aa  TRUA_BACHD RecName: Full=tRNA pseudouridine synthase A;       
   22::207     5e-19  41%  295 aa  TRUA_PROM3 RecName: Full=tRNA pseudouridine synthase A;       
    4::159     5e-19  42%  270 aa  TRUA_BURCM RecName: Full=tRNA pseudouridine synthase A;       
    8::244     7e-19  32%  244 aa  TRUA_GEOUR RecName: Full=tRNA pseudouridine synthase A;       
   19::207     9e-19  40%  300 aa  TRUA_SYNS9 RecName: Full=tRNA pseudouridine synthase A;       
    4::243     9e-19  32%  271 aa  TRUA_METCA RecName: Full=tRNA pseudouridine synthase A;       
    4::159     9e-19  42%  270 aa  TRUA_BURA4 RecName: Full=tRNA pseudouridine synthase A;       
    9::253     1e-18  34%  258 aa  TRUA_LACF3 RecName: Full=tRNA pseudouridine synthase A;       
    7::246     1e-18  33%  247 aa  TRUA_BACA2 RecName: Full=tRNA pseudouridine synthase A;       
    4::223     2e-18  36%  281 aa  TRUA_METLZ RecName: Full=tRNA pseudouridine synthase A;       
    4::255     3e-18  34%  261 aa  TRUA_SHEB8 RecName: Full=tRNA pseudouridine synthase A;       
    8::247     3e-18  33%  247 aa  TRUA_DESRM RecName: Full=tRNA pseudouridine synthase A;       
    4::159     3e-18  42%  270 aa  TRUA_BURS3 RecName: Full=tRNA pseudouridine synthase A;       
    7::246     3e-18  33%  247 aa  TRUA_BACP2 RecName: Full=tRNA pseudouridine synthase A;       
    4::159     3e-18  42%  270 aa  TRUA_BURCH RecName: Full=tRNA pseudouridine synthase A;       
    4::159     3e-18  42%  270 aa  TRUA_BURCC RecName: Full=tRNA pseudouridine synthase A;       
    4::159     3e-18  42%  270 aa  TRUA_BURCA RecName: Full=tRNA pseudouridine synthase A;       
    4::227     5e-18  37%  256 aa  TRUA_METKA RecName: Full=tRNA pseudouridine synthase A;       
    4::255     6e-18  34%  261 aa  TRUA_SHESR RecName: Full=tRNA pseudouridine synthase A;       
    4::255     6e-18  34%  261 aa  TRUA_SHESM RecName: Full=tRNA pseudouridine synthase A;       
    4::159     6e-18  41%  270 aa  TRUA_BURVG RecName: Full=tRNA pseudouridine synthase A;       
    8::236     8e-18  34%  240 aa  TRUA_SOLUE RecName: Full=tRNA pseudouridine synthase A;       
    4::255     8e-18  34%  261 aa  TRUA_SHESA RecName: Full=tRNA pseudouridine synthase A;       
    4::190     8e-18  37%  264 aa  TRUA_PHOLL RecName: Full=tRNA pseudouridine synthase A;       
    4::255     1e-17  33%  261 aa  TRUA_SHEB5 RecName: Full=tRNA pseudouridine synthase A;       
    4::239     1e-17  34%  270 aa  TRUA_METMJ RecName: Full=tRNA pseudouridine synthase A;       
    4::255     1e-17  33%  261 aa  TRUA_SHEB9 RecName: Full=tRNA pseudouridine synthase A;       
    4::255     1e-17  33%  261 aa  TRUA_SHEB2 RecName: Full=tRNA pseudouridine synthase A;       
    5::252     1e-17  35%  271 aa  TRUA_BURPS RecName: Full=tRNA pseudouridine synthase A;       
    5::244     1e-17  36%  267 aa  TRUA_BURP8 RecName: Full=tRNA pseudouridine synthase A;       
    4::251     1e-17  35%  270 aa  TRUA_BURP6 RecName: Full=tRNA pseudouridine synthase A;       
    4::251     1e-17  35%  270 aa  TRUA_BURP1 RecName: Full=tRNA pseudouridine synthase A;       
    4::251     1e-17  35%  270 aa  TRUA_BURP0 RecName: Full=tRNA pseudouridine synthase A;       
    4::251     1e-17  35%  270 aa  TRUA_BURMS RecName: Full=tRNA pseudouridine synthase A;       
    4::251     1e-17  35%  270 aa  TRUA_BURMA RecName: Full=tRNA pseudouridine synthase A;       
    5::252     1e-17  35%  271 aa  TRUA_BURM9 RecName: Full=tRNA pseudouridine synthase A;       
    5::252     1e-17  35%  271 aa  TRUA_BURM7 RecName: Full=tRNA pseudouridine synthase A;       
    7::246     1e-17  32%  247 aa  TRUA_BACSU RecName: Full=tRNA pseudouridine synthase A;       
    4::255     2e-17  33%  261 aa  TRUA_SHESW RecName: Full=tRNA pseudouridine synthase A;       
   19::207     2e-17  35%  289 aa  TRUA_PROMA RecName: Full=tRNA pseudouridine synthase A;       
   22::194     2e-17  43%  280 aa  TRUA_DEIRA RecName: Full=tRNA pseudouridine synthase A;       
    4::221     2e-17  35%  270 aa  TRUA_BURTA RecName: Full=tRNA pseudouridine synthase A;       
    5::218     2e-17  39%  255 aa  TRUA_THENV RecName: Full=tRNA pseudouridine synthase A;       
   12::249     2e-17  34%  255 aa  TRUA_METI4 RecName: Full=tRNA pseudouridine synthase A;       
    4::255     3e-17  33%  261 aa  TRUA_SHEPC RecName: Full=tRNA pseudouridine synthase A;       
    7::246     5e-17  33%  247 aa  TRUA_BACLD RecName: Full=tRNA pseudouridine synthase A;       
    8::244     7e-17  34%  252 aa  TRUA_PELCD RecName: Full=tRNA pseudouridine synthase A;       
    8::248     7e-17  31%  248 aa  TRUA_LISIN RecName: Full=tRNA pseudouridine synthase A;       
   16::251     7e-17  33%  258 aa  TRUA_CHLPD RecName: Full=tRNA pseudouridine synthase A;       
    8::247     9e-17  30%  247 aa  TRUA_LACC3 RecName: Full=tRNA pseudouridine synthase A;       
   13::199     9e-17  37%  270 aa  TRUA_ENTS8 RecName: Full=tRNA pseudouridine synthase A;       
    9::249     1e-16  33%  249 aa  TRUA_LACSS RecName: Full=tRNA pseudouridine synthase A;       
    8::247     1e-16  30%  247 aa  TRUA_LACCB RecName: Full=tRNA pseudouridine synthase A;       
    8::244     1e-16  31%  244 aa  TRUA_GEOSF RecName: Full=tRNA pseudouridine synthase A;       
    4::243     1e-16  33%  259 aa  TRUA_COLP3 RecName: Full=tRNA pseudouridine synthase A;       
    4::243     1e-16  33%  264 aa  TRUA_VIBVY RecName: Full=tRNA pseudouridine synthase A;       
    4::243     1e-16  33%  264 aa  TRUA_VIBVU RecName: Full=tRNA pseudouridine synthase A;       
    4::243     1e-16  33%  264 aa  TRUA_VIBPA RecName: Full=tRNA pseudouridine synthase A;       
    4::243     1e-16  33%  264 aa  TRUA_VIBCM RecName: Full=tRNA pseudouridine synthase A;       
    4::243     1e-16  33%  264 aa  TRUA_VIBCH RecName: Full=tRNA pseudouridine synthase A;       
    4::243     1e-16  33%  264 aa  TRUA_VIBC3 RecName: Full=tRNA pseudouridine synthase A;       
   19::207     1e-16  36%  299 aa  TRUA_SYNPX RecName: Full=tRNA pseudouridine synthase A;       
   18::259     2e-16  36%  275 aa  TRUA_HERAR RecName: Full=tRNA pseudouridine synthase A;       
    8::243     2e-16  37%  243 aa  TRUA_PELPB RecName: Full=tRNA pseudouridine synthase A;       
    5::192     3e-16  35%  268 aa  TRUA_PROM9 RecName: Full=tRNA pseudouridine synthase A;       
    4::261     3e-16  32%  261 aa  TRUA_PHOPR RecName: Full=tRNA pseudouridine synthase A;       
    8::248     3e-16  31%  248 aa  TRUA_LISMH RecName: Full=tRNA pseudouridine synthase A;       
   13::199     3e-16  36%  270 aa  TRUA_KLEP7 RecName: Full=tRNA pseudouridine synthase A;       
   13::199     3e-16  36%  270 aa  TRUA_ENT38 RecName: Full=tRNA pseudouridine synthase A;       
    4::243     4e-16  33%  264 aa  TRUA_VIBHB RecName: Full=tRNA pseudouridine synthase A;       
    4::219     4e-16  37%  261 aa  TRUA_IDILO RecName: Full=tRNA pseudouridine synthase A;       
    5::244     4e-16  32%  270 aa  TRUA_BURPP RecName: Full=tRNA pseudouridine synthase A;       
    5::193     4e-16  40%  268 aa  TRUA_BORPD RecName: Full=tRNA pseudouridine synthase A;       
    4::243     6e-16  31%  261 aa  TRUA_SHEDO RecName: Full=tRNA pseudouridine synthase A;       
    8::248     6e-16  31%  248 aa  TRUA_LISMO RecName: Full=tRNA pseudouridine synthase A;       
    8::248     6e-16  31%  248 aa  TRUA_LISMF RecName: Full=tRNA pseudouridine synthase A;       
    8::248     6e-16  31%  248 aa  TRUA_LISMC RecName: Full=tRNA pseudouridine synthase A;       
   13::199     6e-16  36%  270 aa  TRUA_KLEP3 RecName: Full=tRNA pseudouridine synthase A;       
   11::205     6e-16  38%  304 aa  TRUA_GLOVI RecName: Full=tRNA pseudouridine synthase A;       
    8::245     6e-16  32%  247 aa  TRUA_GEOSM RecName: Full=tRNA pseudouridine synthase A;       
    6::243     6e-16  35%  243 aa  TRUA_CHLL2 RecName: Full=tRNA pseudouridine synthase A;       
    5::245     6e-16  33%  261 aa  TRUA_BACSK RecName: Full=tRNA pseudouridine synthase A;       
    4::255     7e-16  33%  261 aa  TRUA_SHESH RecName: Full=tRNA pseudouridine synthase A;       
   13::199     7e-16  36%  270 aa  TRUA_SALTY RecName: Full=tRNA pseudouridine synthase A;       
   13::199     7e-16  36%  270 aa  TRUA_SALTI RecName: Full=tRNA pseudouridine synthase A;       
   13::199     7e-16  36%  270 aa  TRUA_SALSV RecName: Full=tRNA pseudouridine synthase A;       
   13::199     7e-16  36%  270 aa  TRUA_SALPK RecName: Full=tRNA pseudouridine synthase A;       
   13::199     7e-16  36%  270 aa  TRUA_SALPC RecName: Full=tRNA pseudouridine synthase A;       
   13::199     7e-16  36%  270 aa  TRUA_SALPB RecName: Full=tRNA pseudouridine synthase A;       
   13::199     7e-16  36%  270 aa  TRUA_SALPA RecName: Full=tRNA pseudouridine synthase A;       
   13::199     7e-16  36%  270 aa  TRUA_SALNS RecName: Full=tRNA pseudouridine synthase A;       
   13::199     7e-16  36%  270 aa  TRUA_SALHS RecName: Full=tRNA pseudouridine synthase A;       
   13::199     7e-16  36%  270 aa  TRUA_SALG2 RecName: Full=tRNA pseudouridine synthase A;       
   13::199     7e-16  36%  270 aa  TRUA_SALEP RecName: Full=tRNA pseudouridine synthase A;       
   13::199     7e-16  36%  270 aa  TRUA_SALDC RecName: Full=tRNA pseudouridine synthase A;       
   13::199     7e-16  36%  270 aa  TRUA_SALCH RecName: Full=tRNA pseudouridine synthase A;       
   13::199     7e-16  36%  270 aa  TRUA_SALA4 RecName: Full=tRNA pseudouridine synthase A;       
    4::243     1e-15  32%  261 aa  TRUA_SHEAM RecName: Full=tRNA pseudouridine synthase A;       
    5::248     1e-15  34%  274 aa  TRUA_RALPJ RecName: Full=tRNA pseudouridine synthase A;       
    1::159     1e-15  44%  265 aa  TRUA_NEIG1 RecName: Full=tRNA pseudouridine synthase A;       
    9::196     1e-15  37%  256 aa  TRUA_LACRJ RecName: Full=tRNA pseudouridine synthase A;       
    9::196     1e-15  37%  256 aa  TRUA_LACRD RecName: Full=tRNA pseudouridine synthase A;       
    7::246     1e-15  33%  258 aa  TRUA_FRATN RecName: Full=tRNA pseudouridine synthase A;       
   13::252     1e-15  33%  270 aa  TRUA_CITK8 RecName: Full=tRNA pseudouridine synthase A;       
    5::193     1e-15  40%  267 aa  TRUA_BORA1 RecName: Full=tRNA pseudouridine synthase A;       
    6::114     1e-15  49%  265 aa  TRUA_AKKM8 RecName: Full=tRNA pseudouridine synthase A;       
    5::262     2e-15  32%  274 aa  TRUA_RALSO RecName: Full=tRNA pseudouridine synthase A;       
    8::248     2e-15  30%  249 aa  TRUA_STRSV RecName: Full=tRNA pseudouridine synthase A;       
   21::208     2e-15  36%  285 aa  TRUA_PSEAE RecName: Full=tRNA pseudouridine synthase A;       
    1::166     2e-15  40%  265 aa  TRUA_NEIMB RecName: Full=tRNA pseudouridine synthase A;       
   13::199     2e-15  36%  270 aa  TRUA_ECOLI RecName: Full=tRNA pseudouridine synthase A;       
   13::199     2e-15  36%  270 aa  TRUA_ECODH RecName: Full=tRNA pseudouridine synthase A;       
   13::199     2e-15  36%  270 aa  TRUA_ECOBW RecName: Full=tRNA pseudouridine synthase A;       
   10::244     3e-15  31%  249 aa  TRUA_SYNWW RecName: Full=tRNA pseudouridine synthase A;       
   13::199     3e-15  36%  270 aa  TRUA_SHISS RecName: Full=tRNA pseudouridine synthase A;       
   13::199     3e-15  36%  270 aa  TRUA_SHIFL RecName: Full=tRNA pseudouridine synthase A;       
   13::199     3e-15  36%  270 aa  TRUA_SHIF8 RecName: Full=tRNA pseudouridine synthase A;       
   13::199     3e-15  36%  270 aa  TRUA_SHIDS RecName: Full=tRNA pseudouridine synthase A;       
   13::199     3e-15  36%  270 aa  TRUA_SHIB3 RecName: Full=tRNA pseudouridine synthase A;       
   20::255     3e-15  35%  272 aa  TRUA_NITEU RecName: Full=tRNA pseudouridine synthase A;       
    4::243     3e-15  31%  263 aa  TRUA_MANSM RecName: Full=tRNA pseudouridine synthase A;       
   10::196     3e-15  37%  265 aa  TRUA_LACBA RecName: Full=tRNA pseudouridine synthase A;       
   13::199     3e-15  36%  270 aa  TRUA_ECOSM RecName: Full=tRNA pseudouridine synthase A;       
   13::199     3e-15  36%  270 aa  TRUA_ECOSE RecName: Full=tRNA pseudouridine synthase A;       
   13::199     3e-15  36%  270 aa  TRUA_ECOLU RecName: Full=tRNA pseudouridine synthase A;       
   13::199     3e-15  36%  270 aa  TRUA_ECOLC RecName: Full=tRNA pseudouridine synthase A;       
   13::199     3e-15  36%  270 aa  TRUA_ECOL6 RecName: Full=tRNA pseudouridine synthase A;       
   13::199     3e-15  36%  270 aa  TRUA_ECOHS RecName: Full=tRNA pseudouridine synthase A;       
   13::199     3e-15  36%  270 aa  TRUA_ECO8A RecName: Full=tRNA pseudouridine synthase A;       
   13::199     3e-15  36%  270 aa  TRUA_ECO7I RecName: Full=tRNA pseudouridine synthase A;       
   13::199     3e-15  36%  270 aa  TRUA_ECO5E RecName: Full=tRNA pseudouridine synthase A;       
   13::199     3e-15  36%  270 aa  TRUA_ECO57 RecName: Full=tRNA pseudouridine synthase A;       
   13::199     3e-15  36%  270 aa  TRUA_ECO55 RecName: Full=tRNA pseudouridine synthase A;       
    9::219     4e-15  36%  277 aa  TRUA_NITEC RecName: Full=tRNA pseudouridine synthase A;       
    8::246     4e-15  32%  250 aa  TRUA_GEOBB RecName: Full=tRNA pseudouridine synthase A;       
    7::246     4e-15  32%  258 aa  TRUA_FRATW RecName: Full=tRNA pseudouridine synthase A;       
   13::199     4e-15  36%  270 aa  TRUA_ESCF3 RecName: Full=tRNA pseudouridine synthase A;       
   13::199     4e-15  36%  270 aa  TRUA_ECOUT RecName: Full=tRNA pseudouridine synthase A;       
   13::199     4e-15  36%  270 aa  TRUA_ECOL5 RecName: Full=tRNA pseudouridine synthase A;       
   13::199     4e-15  36%  270 aa  TRUA_ECOK1 RecName: Full=tRNA pseudouridine synthase A;       
   13::199     4e-15  36%  270 aa  TRUA_ECO81 RecName: Full=tRNA pseudouridine synthase A;       
   13::199     4e-15  36%  270 aa  TRUA_ECO45 RecName: Full=tRNA pseudouridine synthase A;       
   13::199     4e-15  36%  270 aa  TRUA_ECO27 RecName: Full=tRNA pseudouridine synthase A;       
   13::199     4e-15  36%  270 aa  TRUA_ECO24 RecName: Full=tRNA pseudouridine synthase A;       
    8::236     4e-15  30%  271 aa  TRUA_DESAD RecName: Full=tRNA pseudouridine synthase A;       
    8::244     4e-15  30%  244 aa  TRUA_BREBN RecName: Full=tRNA pseudouridine synthase A;       
    5::191     5e-15  36%  262 aa  TRUA_THICR RecName: Full=tRNA pseudouridine synthase A;       
    4::255     5e-15  32%  261 aa  TRUA_SHEWM RecName: Full=tRNA pseudouridine synthase A;       
    1::166     5e-15  40%  265 aa  TRUA_NEIM0 RecName: Full=tRNA pseudouridine synthase A;       
    8::252     5e-15  30%  253 aa  TRUA_NATTJ RecName: Full=tRNA pseudouridine synthase A;       
    8::244     5e-15  30%  244 aa  TRUA_ANATD RecName: Full=tRNA pseudouridine synthase A;       
   10::124     6e-15  43%  280 aa  TRUA_TREPS RecName: Full=tRNA pseudouridine synthase A;       
   10::124     6e-15  43%  280 aa  TRUA_TREPA RecName: Full=tRNA pseudouridine synthase A;       
    8::248     6e-15  29%  249 aa  TRUA_STRZT RecName: Full=tRNA pseudouridine synthase A;       
    7::246     6e-15  32%  258 aa  TRUA_FRATT RecName: Full=tRNA pseudouridine synthase A;       
    7::246     6e-15  32%  258 aa  TRUA_FRATM RecName: Full=tRNA pseudouridine synthase A;       
    7::246     6e-15  32%  258 aa  TRUA_FRAT1 RecName: Full=tRNA pseudouridine synthase A;       
    4::255     8e-15  31%  261 aa  TRUA_SHEPW RecName: Full=tRNA pseudouridine synthase A;       
   13::199     8e-15  35%  270 aa  TRUA_SALAR RecName: Full=tRNA pseudouridine synthase A;       
    5::229     8e-15  35%  255 aa  TRUA_PYRIL RecName: Full=tRNA pseudouridine synthase A;       
    4::243     8e-15  31%  259 aa  TRUA_NITOC RecName: Full=tRNA pseudouridine synthase A;       
    1::166     8e-15  40%  265 aa  TRUA_NEIMF RecName: Full=tRNA pseudouridine synthase A;       
    1::159     8e-15  42%  265 aa  TRUA_NEIG2 RecName: Full=tRNA pseudouridine synthase A;       
    8::248     8e-15  32%  248 aa  TRUA_LISW6 RecName: Full=tRNA pseudouridine synthase A;       
    8::118     8e-15  46%  250 aa  TRUA_DESAP RecName: Full=tRNA pseudouridine synthase A;       
    4::190     1e-14  36%  264 aa  TRUA_YERPS RecName: Full=tRNA pseudouridine synthase A;       
    4::190     1e-14  36%  264 aa  TRUA_YERPE RecName: Full=tRNA pseudouridine synthase A;       
    4::190     1e-14  36%  264 aa  TRUA_YERP3 RecName: Full=tRNA pseudouridine synthase A;       
    4::190     1e-14  34%  264 aa  TRUA_PSEHT RecName: Full=tRNA pseudouridine synthase A;       
    4::190     1e-14  35%  263 aa  TRUA_PSEA6 RecName: Full=tRNA pseudouridine synthase A;       
    7::246     1e-14  32%  258 aa  TRUA_FRATO RecName: Full=tRNA pseudouridine synthase A;       
    7::246     1e-14  32%  258 aa  TRUA_FRATH RecName: Full=tRNA pseudouridine synthase A;       
    4::222     1e-14  32%  269 aa  TRUA_AERS4 RecName: Full=tRNA pseudouridine synthase A;       
    8::248     1e-14  29%  249 aa  TRUA_STRPN RecName: Full=tRNA pseudouridine synthase A;       
    8::248     1e-14  29%  249 aa  TRUA_STRP7 RecName: Full=tRNA pseudouridine synthase A;       
   13::199     1e-14  36%  270 aa  TRUA_SHIBS RecName: Full=tRNA pseudouridine synthase A;       
    5::192     1e-14  34%  268 aa  TRUA_PROM2 RecName: Full=tRNA pseudouridine synthase A;       
    5::192     1e-14  37%  268 aa  TRUA_PROM0 RecName: Full=tRNA pseudouridine synthase A;       
    7::246     1e-14  32%  258 aa  TRUA_FRATF RecName: Full=tRNA pseudouridine synthase A;       
    4::247     1e-14  32%  247 aa  TRUA_CHLTE RecName: Full=tRNA pseudouridine synthase A;       
    8::167     1e-14  34%  251 aa  TRUA1_DESPS RecName: Full=tRNA pseudouridine synthase A 1;       
    8::160     2e-14  42%  250 aa  TRUA_KOSOT RecName: Full=tRNA pseudouridine synthase A;       
    9::247     2e-14  32%  248 aa  TRUA_GEOSW RecName: Full=tRNA pseudouridine synthase A;       
    8::245     2e-14  28%  247 aa  TRUA1_BACHK RecName: Full=tRNA pseudouridine synthase A 1;       
    8::245     2e-14  28%  247 aa  TRUA1_BACCZ RecName: Full=tRNA pseudouridine synthase A 1;       
    8::245     2e-14  28%  247 aa  TRUA1_BACAN RecName: Full=tRNA pseudouridine synthase A 1;       
    8::235     2e-14  32%  245 aa  TRUA_THENN RecName: Full=tRNA pseudouridine synthase A;       
   16::183     2e-14  38%  284 aa  TRUA_STRGG RecName: Full=tRNA pseudouridine synthase A;       
    4::221     2e-14  32%  269 aa  TRUA_AERHH RecName: Full=tRNA pseudouridine synthase A;       
    4::243     3e-14  32%  264 aa  TRUA_VIBSL RecName: Full=tRNA pseudouridine synthase A;       
    5::244     3e-14  33%  244 aa  TRUA_THEAB RecName: Full=tRNA pseudouridine synthase A;       
    4::245     3e-14  33%  261 aa  TRUA_METFK RecName: Full=tRNA pseudouridine synthase A;       
    5::245     3e-14  33%  267 aa  TRUA_ALCBS RecName: Full=tRNA pseudouridine synthase A;       
    8::245     3e-14  28%  247 aa  TRUA1_BACCR RecName: Full=tRNA pseudouridine synthase A 1;       
    8::245     3e-14  28%  247 aa  TRUA1_BACC1 RecName: Full=tRNA pseudouridine synthase A 1;       
    8::244     4e-14  33%  244 aa  TRUA_THEPX RecName: Full=tRNA pseudouridine synthase A;       
    8::244     4e-14  33%  244 aa  TRUA_THEP3 RecName: Full=tRNA pseudouridine synthase A;       
    8::235     4e-14  33%  245 aa  TRUA_THEMA RecName: Full=tRNA pseudouridine synthase A;       
   16::237     4e-14  32%  285 aa  TRUA_STRAW RecName: Full=tRNA pseudouridine synthase A;       
    8::246     4e-14  35%  246 aa  TRUA_MOOTA RecName: Full=tRNA pseudouridine synthase A;       
    4::243     4e-14  33%  269 aa  TRUA_HAEIG RecName: Full=tRNA pseudouridine synthase A;       
    8::248     5e-14  29%  249 aa  TRUA_STRGC RecName: Full=tRNA pseudouridine synthase A;       
    8::247     5e-14  33%  253 aa  TRUA_OCEIH RecName: Full=tRNA pseudouridine synthase A;       
   10::219     5e-14  30%  244 aa  TRUA_GEOSL RecName: Full=tRNA pseudouridine synthase A;       
    8::235     7e-14  32%  245 aa  TRUA_THEP1 RecName: Full=tRNA pseudouridine synthase A;       
    8::225     7e-14  34%  249 aa  TRUA_STRMU RecName: Full=tRNA pseudouridine synthase A;       
    5::266     7e-14  32%  273 aa  TRUA_RALEJ RecName: Full=tRNA pseudouridine synthase A;       
    1::166     7e-14  39%  265 aa  TRUA_NEIMA RecName: Full=tRNA pseudouridine synthase A;       
    5::115     7e-14  43%  270 aa  TRUA_BURXL RecName: Full=tRNA pseudouridine synthase A;       
    5::192     9e-14  33%  268 aa  TRUA_PROMS RecName: Full=tRNA pseudouridine synthase A;       
    4::168     9e-14  38%  275 aa  TRUA_POLSQ RecName: Full=tRNA pseudouridine synthase A;       
    4::243     9e-14  31%  264 aa  TRUA_PASMU RecName: Full=tRNA pseudouridine synthase A;       
    8::244     9e-14  30%  244 aa  TRUA_CALS8 RecName: Full=tRNA pseudouridine synthase A;       
    8::248     1e-13  29%  249 aa  TRUA_STRP4 RecName: Full=tRNA pseudouridine synthase A;       
    5::257     1e-13  32%  260 aa  TRUA_ROSDO RecName: Full=tRNA pseudouridine synthase A;       
   19::207     1e-13  32%  289 aa  TRUA_PROM4 RecName: Full=tRNA pseudouridine synthase A;       
    2::228     1e-13  38%  257 aa  TRUA_NOCFA RecName: Full=tRNA pseudouridine synthase A;       
    4::243     1e-13  32%  269 aa  TRUA_HAEIN RecName: Full=tRNA pseudouridine synthase A;       
    4::243     1e-13  32%  269 aa  TRUA_HAEI8 RecName: Full=tRNA pseudouridine synthase A;       
    4::152     2e-13  41%  270 aa  TRUA_VARPS RecName: Full=tRNA pseudouridine synthase A;       
    5::192     2e-13  33%  268 aa  TRUA_PROM5 RecName: Full=tRNA pseudouridine synthase A;       
    9::172     2e-13  35%  263 aa  TRUA_LACH4 RecName: Full=tRNA pseudouridine synthase A;       
    8::245     2e-13  31%  245 aa  TRUA_THELT RecName: Full=tRNA pseudouridine synthase A;       
    5::225     2e-13  33%  272 aa  TRUA_RALEH RecName: Full=tRNA pseudouridine synthase A;       
    5::236     2e-13  30%  246 aa  TRUA_FERNB RecName: Full=tRNA pseudouridine synthase A;       
    8::248     3e-13  28%  249 aa  TRUA_STRZJ RecName: Full=tRNA pseudouridine synthase A;       
    8::248     3e-13  28%  249 aa  TRUA_STRR6 RecName: Full=tRNA pseudouridine synthase A;       
    8::248     3e-13  28%  249 aa  TRUA_STRPS RecName: Full=tRNA pseudouridine synthase A;       
    8::248     3e-13  28%  249 aa  TRUA_STRPJ RecName: Full=tRNA pseudouridine synthase A;       
    8::248     3e-13  28%  249 aa  TRUA_STRPI RecName: Full=tRNA pseudouridine synthase A;       
    8::248     3e-13  28%  249 aa  TRUA_STRP2 RecName: Full=tRNA pseudouridine synthase A;       
    5::180     3e-13  39%  261 aa  TRUA_JANSC RecName: Full=tRNA pseudouridine synthase A;       
    8::248     3e-13  32%  267 aa  TRUA_CHLTA RecName: Full=tRNA pseudouridine synthase A;       
    5::246     3e-13  32%  270 aa  TRUA_BORPE RecName: Full=tRNA pseudouridine synthase A;       
    8::235     4e-13  33%  245 aa  TRUA_THESQ RecName: Full=tRNA pseudouridine synthase A;       
    5::244     4e-13  31%  244 aa  TRUA_THEM4 RecName: Full=tRNA pseudouridine synthase A;       
    5::230     4e-13  35%  257 aa  TRUA_PYRAR RecName: Full=tRNA pseudouridine synthase A;       
    7::191     4e-13  33%  258 aa  TRUA_FRAP2 RecName: Full=tRNA pseudouridine synthase A;       
    8::248     4e-13  32%  267 aa  TRUA_CHLTB RecName: Full=tRNA pseudouridine synthase A;       
    8::248     4e-13  32%  267 aa  TRUA_CHLT2 RecName: Full=tRNA pseudouridine synthase A;       
    8::194     6e-13  31%  249 aa  TRUA_STRZP RecName: Full=tRNA pseudouridine synthase A;       
    5::225     6e-13  33%  272 aa  TRUA_CUPTR RecName: Full=tRNA pseudouridine synthase A;       
    4::222     6e-13  34%  262 aa  TRUA_CHRVO RecName: Full=tRNA pseudouridine synthase A;       
    8::248     6e-13  32%  267 aa  TRUA_CHLTR RecName: Full=tRNA pseudouridine synthase A;       
    8::160     6e-13  31%  256 aa  TRUA1_PARUW RecName: Full=tRNA pseudouridine synthase A 1;       
   10::114     7e-13  48%  253 aa  TRUA_THET8 RecName: Full=tRNA pseudouridine synthase A;       
   10::114     7e-13  48%  253 aa  TRUA_THET2 RecName: Full=tRNA pseudouridine synthase A;       
    5::192     7e-13  33%  268 aa  TRUA_PROMP RecName: Full=tRNA pseudouridine synthase A;       
    5::114     7e-13  36%  290 aa  TRUA_METS3 RecName: Full=tRNA pseudouridine synthase A;       
    4::190     7e-13  34%  261 aa  TRUA_HAEDU RecName: Full=tRNA pseudouridine synthase A;       
    7::251     7e-13  32%  262 aa  TRUA_BDEBA RecName: Full=tRNA pseudouridine synthase A;       
   15::202     1e-12  35%  284 aa  TRUA_THEEB RecName: Full=tRNA pseudouridine synthase A;       
    4::243     1e-12  31%  261 aa  TRUA_SHELP RecName: Full=tRNA pseudouridine synthase A;       
    8::247     1e-12  35%  278 aa  TRUA_RHORT RecName: Full=tRNA pseudouridine synthase A;       
    8::243     1e-12  32%  243 aa  TRUA_PROVI RecName: Full=tRNA pseudouridine synthase A;       
    7::115     1e-12  46%  253 aa  TRUA_PELLD RecName: Full=tRNA pseudouridine synthase A;       
    8::176     1e-12  31%  252 aa  TRUA_OENOB RecName: Full=tRNA pseudouridine synthase A;       
    8::247     1e-12  33%  247 aa  TRUA_SINMW RecName: Full=tRNA pseudouridine synthase A;       
   28::278     1e-12  34%  297 aa  TRUA_MYCTU RecName: Full=tRNA pseudouridine synthase A;       
   28::278     1e-12  34%  297 aa  TRUA_MYCBO RecName: Full=tRNA pseudouridine synthase A;       
    8::180     1e-12  38%  260 aa  TRUA_LEUCK RecName: Full=tRNA pseudouridine synthase A;       
   33::300     1e-12  34%  402 aa  TG124_CAEEL RecName: Full=Probable tRNA pseudouridine synthase
   14::266     2e-12  31%  268 aa  TRUA_TREDE RecName: Full=tRNA pseudouridine synthase A;       
   13::124     2e-12  39%  275 aa  TRUA_SYNY3 RecName: Full=tRNA pseudouridine synthase A;       
    5::261     2e-12  34%  262 aa  TRUA_SILPO RecName: Full=tRNA pseudouridine synthase A;       
    5::154     2e-12  41%  255 aa  TRUA_RHOS1 RecName: Full=tRNA pseudouridine synthase A;       
    8::250     2e-12  28%  253 aa  TRUA_LACLM RecName: Full=tRNA pseudouridine synthase A;       
    8::251     2e-12  35%  274 aa  TRUA_DESMR RecName: Full=tRNA pseudouridine synthase A;       
    4::243     2e-12  32%  264 aa  TRUA_ACTSZ RecName: Full=tRNA pseudouridine synthase A;       
    4::243     2e-12  30%  262 aa  TRUA_ACTPJ RecName: Full=tRNA pseudouridine synthase A;       
    4::243     2e-12  30%  262 aa  TRUA_ACTP7 RecName: Full=tRNA pseudouridine synthase A;       
    4::243     2e-12  31%  262 aa  TRUA_ACTP2 RecName: Full=tRNA pseudouridine synthase A;       
    4::243     2e-12  30%  261 aa  TRUA_TOLAT RecName: Full=tRNA pseudouridine synthase A;       
    5::230     2e-12  36%  256 aa  TRUA_PYRAE RecName: Full=tRNA pseudouridine synthase A;       
    4::152     2e-12  38%  264 aa  TRUA_POLSJ RecName: Full=tRNA pseudouridine synthase A;       
   86::337     2e-12  31%  423 aa  TRUA_MOUSE RecName: Full=tRNA pseudouridine synthase A;       
    2::196     2e-12  32%  256 aa  TRUA_LACS1 RecName: Full=tRNA pseudouridine synthase A;       
    2::124     2e-12  45%  277 aa  TRUA_DESVM RecName: Full=tRNA pseudouridine synthase A;       
    3::263     2e-12  33%  278 aa  TRUA_CHLSY RecName: Full=tRNA pseudouridine synthase A;       
    3::263     2e-12  33%  278 aa  TRUA_CHLAA RecName: Full=tRNA pseudouridine synthase A;       
    5::162     2e-12  38%  270 aa  TRUA_BORPA RecName: Full=tRNA pseudouridine synthase A;       
    5::162     2e-12  38%  270 aa  TRUA_BORBR RecName: Full=tRNA pseudouridine synthase A;       
    8::250     2e-12  32%  266 aa  TRUA_AGRT5 RecName: Full=tRNA pseudouridine synthase A;       
    5::192     3e-12  32%  246 aa  TRUA_SPHAL RecName: Full=tRNA pseudouridine synthase A;       
    5::154     3e-12  41%  255 aa  TRUA_RHOS4 RecName: Full=tRNA pseudouridine synthase A;       
    4::181     3e-12  36%  282 aa  TRUA_DELAS RecName: Full=tRNA pseudouridine synthase A;       
    8::192     3e-12  33%  245 aa  TRUA_CLOCE RecName: Full=tRNA pseudouridine synthase A;       
    8::226     4e-12  29%  249 aa  TRUA_STRSY RecName: Full=tRNA pseudouridine synthase A;       
    8::226     4e-12  29%  249 aa  TRUA_STRS2 RecName: Full=tRNA pseudouridine synthase A;       
    5::226     4e-12  35%  270 aa  TRUA_ROSS1 RecName: Full=tRNA pseudouridine synthase A;       
    1::269     4e-12  34%  288 aa  TRUA_LEIXX RecName: Full=tRNA pseudouridine synthase A;       
    8::250     4e-12  28%  253 aa  TRUA_LACLS RecName: Full=tRNA pseudouridine synthase A;       
    8::247     4e-12  27%  253 aa  TRUA_LACLA RecName: Full=tRNA pseudouridine synthase A;       
    4::243     4e-12  30%  262 aa  TRUA_HAEPS RecName: Full=tRNA pseudouridine synthase A;       
    8::252     5e-12  36%  254 aa  TRUA_METNO RecName: Full=tRNA pseudouridine synthase A;       
    4::243     5e-12  30%  269 aa  TRUA_HAES1 RecName: Full=tRNA pseudouridine synthase A;       
    3::225     5e-12  33%  278 aa  TRUA_CHLAD RecName: Full=tRNA pseudouridine synthase A;       
    8::236     5e-12  27%  249 aa  TRUA_BRAHW RecName: Full=tRNA pseudouridine synthase A;       
   66::342     5e-12  32%  481 aa  PUS3_HUMAN RecName: Full=tRNA pseudouridine synthase 3;       
    5::154     6e-12  41%  255 aa  TRUA_RHOSK RecName: Full=tRNA pseudouridine synthase A;       
   86::337     6e-12  31%  423 aa  TRUA_RAT RecName: Full=tRNA pseudouridine synthase A;       
    9::196     6e-12  33%  262 aa  TRUA_LACAC RecName: Full=tRNA pseudouridine synthase A;       
   90::341     6e-12  31%  427 aa  TRUA_HUMAN RecName: Full=tRNA pseudouridine synthase A;       
    8::194     6e-12  35%  251 aa  TRUA_BRUSU RecName: Full=tRNA pseudouridine synthase A;       
    8::194     6e-12  35%  251 aa  TRUA_BRUSI RecName: Full=tRNA pseudouridine synthase A;       
    8::194     6e-12  35%  251 aa  TRUA_BRUO2 RecName: Full=tRNA pseudouridine synthase A;       
    8::194     6e-12  35%  251 aa  TRUA_BRUME RecName: Full=tRNA pseudouridine synthase A;       
    8::194     6e-12  35%  251 aa  TRUA_BRUMB RecName: Full=tRNA pseudouridine synthase A;       
    8::194     6e-12  35%  251 aa  TRUA_BRUC2 RecName: Full=tRNA pseudouridine synthase A;       
    8::194     6e-12  35%  251 aa  TRUA_BRUAB RecName: Full=tRNA pseudouridine synthase A;       
    8::194     6e-12  35%  251 aa  TRUA_BRUA2 RecName: Full=tRNA pseudouridine synthase A;       
   16::259     8e-12  32%  284 aa  TRUA_STRCO RecName: Full=tRNA pseudouridine synthase A;       
    8::154     8e-12  41%  249 aa  TRUA_MARMM RecName: Full=tRNA pseudouridine synthase A;       
   12::255     8e-12  32%  271 aa  TRUA_JANMA RecName: Full=tRNA pseudouridine synthase A;       
    8::247     8e-12  31%  259 aa  TRUA_AGRVS RecName: Full=tRNA pseudouridine synthase A;       
    5::194     1e-11  37%  270 aa  TRUA_ROSCS RecName: Full=tRNA pseudouridine synthase A;       
    8::192     1e-11  34%  246 aa  TRUA_RHOP5 RecName: Full=tRNA pseudouridine synthase A;       
    8::247     1e-11  31%  247 aa  TRUA_RHISN RecName: Full=tRNA pseudouridine synthase A;       
    8::246     1e-11  32%  246 aa  TRUA_PARL1 RecName: Full=tRNA pseudouridine synthase A;       
   10::159     1e-11  34%  243 aa  TRUA_ONYPE RecName: Full=tRNA pseudouridine synthase A;       
    4::159     1e-11  39%  260 aa  TRUA_METPP RecName: Full=tRNA pseudouridine synthase A;       
    8::193     1e-11  33%  246 aa  TRUA_LYSSC RecName: Full=tRNA pseudouridine synthase A;       
    1::136     1e-11  39%  274 aa  TRUA_FRASC RecName: Full=tRNA pseudouridine synthase A;       
   13::200     1e-11  35%  293 aa  TRUA_CYAP8 RecName: Full=tRNA pseudouridine synthase A;       
    7::119     1e-11  44%  264 aa  TRUA_AZOSE RecName: Full=tRNA pseudouridine synthase A;       
    5::159     1e-11  38%  257 aa  TRUA_DINSH RecName: Full=tRNA pseudouridine synthase A;       
    8::244     1e-11  29%  252 aa  TRUA_BLOFL RecName: Full=tRNA pseudouridine synthase A;       
    7::247     1e-11  32%  247 aa  TRUA_ANAMF RecName: Full=tRNA pseudouridine synthase A;       
    4::152     2e-11  39%  278 aa  TRUA_ACIAC RecName: Full=tRNA pseudouridine synthase A;       
    5::247     2e-11  32%  257 aa  TRUA_XYLFT RecName: Full=tRNA pseudouridine synthase A;       
    5::247     2e-11  32%  257 aa  TRUA_XYLF2 RecName: Full=tRNA pseudouridine synthase A;       
    4::255     2e-11  30%  261 aa  TRUA_SHEPA RecName: Full=tRNA pseudouridine synthase A;       
    4::255     2e-11  28%  261 aa  TRUA_SHEHH RecName: Full=tRNA pseudouridine synthase A;       
    5::232     2e-11  34%  257 aa  TRUA_PYRCJ RecName: Full=tRNA pseudouridine synthase A;       
    8::116     2e-11  41%  252 aa  TRUA_PORG3 RecName: Full=tRNA pseudouridine synthase A;       
   26::244     2e-11  32%  283 aa  TRUA_ERWCT RecName: Full=tRNA pseudouridine synthase A;       
   66::342     2e-11  30%  481 aa  PUS3_BOVIN RecName: Full=tRNA pseudouridine synthase 3;       
    4::99      3e-11  44%  272 aa  TRUA_VEREI RecName: Full=tRNA pseudouridine synthase A;       
    8::244     3e-11  30%  244 aa  TRUA_PELPD RecName: Full=tRNA pseudouridine synthase A;       
    8::181     3e-11  36%  255 aa  TRUA_LEUMM RecName: Full=tRNA pseudouridine synthase A;       
    8::247     4e-11  30%  247 aa  TRUA_RHIME RecName: Full=tRNA pseudouridine synthase A;       
    6::120     4e-11  42%  257 aa  TRUA_LAWIP RecName: Full=tRNA pseudouridine synthase A;       
    8::124     4e-11  44%  278 aa  TRUA_DESDG RecName: Full=tRNA pseudouridine synthase A;       
    8::194     4e-11  36%  303 aa  TRUA_BIFLO RecName: Full=tRNA pseudouridine synthase A;       
    8::194     4e-11  36%  303 aa  TRUA_BIFLD RecName: Full=tRNA pseudouridine synthase A;       
    8::114     5e-11  38%  254 aa  TRUA_THEYD RecName: Full=tRNA pseudouridine synthase A;       
    8::225     5e-11  27%  248 aa  TRUA_STRT2 RecName: Full=tRNA pseudouridine synthase A;       
    8::225     5e-11  27%  248 aa  TRUA_STRT1 RecName: Full=tRNA pseudouridine synthase A;       
    8::194     5e-11  32%  249 aa  TRUA_STRP3 RecName: Full=tRNA pseudouridine synthase A;       
    8::191     5e-11  33%  244 aa  TRUA_CLOTH RecName: Full=tRNA pseudouridine synthase A;       
    8::248     5e-11  31%  267 aa  TRUA_CHLMU RecName: Full=tRNA pseudouridine synthase A;       
    4::243     5e-11  30%  262 aa  TRUA_ALISL RecName: Full=tRNA pseudouridine synthase A;       
   95::352     7e-11  27%  450 aa  YL85_SCHPO RecName: Full=Putative tRNA pseudouridine synthase
   17::117     7e-11  41%  294 aa  TRUA_SYNP6 RecName: Full=tRNA pseudouridine synthase A;       
    8::190     7e-11  36%  252 aa  TRUA_PARD8 RecName: Full=tRNA pseudouridine synthase A;       
    8::245     7e-11  32%  245 aa  TRUA_NITHX RecName: Full=tRNA pseudouridine synthase A;       
    8::194     7e-11  34%  247 aa  TRUA_MESSB RecName: Full=tRNA pseudouridine synthase A;       
    5::250     7e-11  29%  264 aa  TRUA_LEPBP RecName: Full=tRNA pseudouridine synthase A;       
    5::250     7e-11  29%  264 aa  TRUA_LEPBA RecName: Full=tRNA pseudouridine synthase A;       
    4::222     7e-11  30%  262 aa  TRUA_DECAR RecName: Full=tRNA pseudouridine synthase A;       
    8::192     9e-11  32%  245 aa  TRUA_ZYMMO RecName: Full=tRNA pseudouridine synthase A;       
    5::222     9e-11  32%  257 aa  TRUA_XYLFA RecName: Full=tRNA pseudouridine synthase A;       
    4::243     9e-11  32%  262 aa  TRUA_VIBFM RecName: Full=tRNA pseudouridine synthase A;       
    4::243     9e-11  32%  262 aa  TRUA_VIBF1 RecName: Full=tRNA pseudouridine synthase A;       
    8::194     9e-11  32%  249 aa  TRUA_STRS7 RecName: Full=tRNA pseudouridine synthase A;       
    4::243     9e-11  30%  261 aa  TRUA_PSYIN RecName: Full=tRNA pseudouridine synthase A;       
    8::245     9e-11  34%  245 aa  TRUA_OLICO RecName: Full=tRNA pseudouridine synthase A;       
    8::245     9e-11  33%  256 aa  TRUA_MAGSA RecName: Full=tRNA pseudouridine synthase A;       
    9::196     9e-11  29%  262 aa  TRUA_LACDB RecName: Full=tRNA pseudouridine synthase A;       
    4::152     9e-11  35%  274 aa  TRUA_ACISJ RecName: Full=tRNA pseudouridine synthase A;       
    3::200     1e-10  32%  274 aa  TRUA_SYNP2 RecName: Full=tRNA pseudouridine synthase A;       
    8::194     1e-10  32%  249 aa  TRUA_STRE4 RecName: Full=tRNA pseudouridine synthase A;       
    8::194     1e-10  36%  248 aa  TRUA_RHILO RecName: Full=tRNA pseudouridine synthase A;       
   24::267     1e-10  31%  275 aa  TRUA_GLUOX RecName: Full=tRNA pseudouridine synthase A;       
    5::244     1e-10  29%  261 aa  TRUA_BLOPB RecName: Full=tRNA pseudouridine synthase A;       
    7::247     1e-10  32%  247 aa  TRUA_ANAMM RecName: Full=tRNA pseudouridine synthase A;       
    5::247     2e-10  32%  257 aa  TRUA_XYLFM RecName: Full=tRNA pseudouridine synthase A;       
    8::194     2e-10  31%  249 aa  TRUA_STRPZ RecName: Full=tRNA pseudouridine synthase A;       
    8::194     2e-10  31%  249 aa  TRUA_STRPM RecName: Full=tRNA pseudouridine synthase A;       
    8::194     2e-10  31%  249 aa  TRUA_STRPG RecName: Full=tRNA pseudouridine synthase A;       
    8::194     2e-10  31%  249 aa  TRUA_STRPF RecName: Full=tRNA pseudouridine synthase A;       
    8::194     2e-10  31%  249 aa  TRUA_STRPD RecName: Full=tRNA pseudouridine synthase A;       
    8::194     2e-10  31%  249 aa  TRUA_STRPC RecName: Full=tRNA pseudouridine synthase A;       
    8::194     2e-10  31%  249 aa  TRUA_STRPB RecName: Full=tRNA pseudouridine synthase A;       
    8::194     2e-10  31%  249 aa  TRUA_STRP8 RecName: Full=tRNA pseudouridine synthase A;       
    8::194     2e-10  31%  249 aa  TRUA_STRP6 RecName: Full=tRNA pseudouridine synthase A;       
    8::194     2e-10  31%  249 aa  TRUA_STRP1 RecName: Full=tRNA pseudouridine synthase A;       
    3::222     2e-10  31%  251 aa  TRUA_MYCPA RecName: Full=tRNA pseudouridine synthase A;       
    8::247     2e-10  29%  268 aa  TRUA_CHLFF RecName: Full=tRNA pseudouridine synthase A;       
    4::152     2e-10  40%  260 aa  TRUA_RHOFD RecName: Full=tRNA pseudouridine synthase A;       
    8::247     2e-10  33%  255 aa  TRUA_NITWN RecName: Full=tRNA pseudouridine synthase A;       
    8::154     2e-10  37%  253 aa  TRUA_METRJ RecName: Full=tRNA pseudouridine synthase A;       
    5::214     2e-10  30%  259 aa  TRUA_METJA RecName: Full=tRNA pseudouridine synthase A;       
    8::192     3e-10  34%  245 aa  TRUA_XANP2 RecName: Full=tRNA pseudouridine synthase A;       
    7::194     3e-10  28%  258 aa  TRUA_STRA1 RecName: Full=tRNA pseudouridine synthase A;       
    4::169     3e-10  34%  276 aa  TRUA_POLNS RecName: Full=tRNA pseudouridine synthase A;       
    5::192     3e-10  31%  245 aa  TRUA_PETMO RecName: Full=tRNA pseudouridine synthase A;       
    8::114     3e-10  38%  249 aa  TRUA_AZOPC RecName: Full=tRNA pseudouridine synthase A;       
   10::248     3e-10  30%  253 aa  TRUA_WOLSU RecName: Full=tRNA pseudouridine synthase A;       
    8::194     3e-10  28%  248 aa  TRUA_STRTD RecName: Full=tRNA pseudouridine synthase A;       
    7::194     3e-10  28%  258 aa  TRUA_STRA3 RecName: Full=tRNA pseudouridine synthase A;       
    5::159     3e-10  36%  259 aa  TRUA_SILST RecName: Full=tRNA pseudouridine synthase A;       
   10::154     3e-10  39%  245 aa  TRUA_RHOCS RecName: Full=tRNA pseudouridine synthase A;       
    1::120     3e-10  37%  266 aa  TRUA_BUCAT RecName: Full=tRNA pseudouridine synthase A;       
    1::120     3e-10  37%  266 aa  TRUA_BUCA5 RecName: Full=tRNA pseudouridine synthase A;       
    8::114     3e-10  38%  269 aa  TRUA_BACTN RecName: Full=tRNA pseudouridine synthase A;       
    5::256     5e-10  32%  257 aa  TRUA_RHOS5 RecName: Full=tRNA pseudouridine synthase A;       
    8::250     5e-10  31%  268 aa  TRUA_RHILW RecName: Full=tRNA pseudouridine synthase A;       
    9::196     5e-10  30%  263 aa  TRUA_LACJO RecName: Full=tRNA pseudouridine synthase A;       
    8::117     5e-10  38%  245 aa  TRUA_DICT6 RecName: Full=tRNA pseudouridine synthase A;       
   12::253     5e-10  32%  288 aa  TRUA_CORDI RecName: Full=tRNA pseudouridine synthase A;       
    8::243     5e-10  30%  243 aa  TRUA_CHLCH RecName: Full=tRNA pseudouridine synthase A;       
    8::247     5e-10  34%  249 aa  TRUA_CAUSK RecName: Full=tRNA pseudouridine synthase A;       
    1::120     5e-10  37%  266 aa  TRUA_BUCAI RecName: Full=tRNA pseudouridine synthase A;       
    8::187     5e-10  36%  298 aa  TRUA_BIFA0 RecName: Full=tRNA pseudouridine synthase A;       
   21::168     5e-10  35%  262 aa  TRUA2_PARUW RecName: Full=tRNA pseudouridine synthase A 2;       
   67::343     5e-10  30%  481 aa  PUS3_MOUSE RecName: Full=tRNA pseudouridine synthase 3;       
    4::152     6e-10  35%  274 aa  TRUA_DIAST RecName: Full=tRNA pseudouridine synthase A;       
    5::169     6e-10  33%  258 aa  TRUA_CAMFF RecName: Full=tRNA pseudouridine synthase A;       
    7::174     6e-10  33%  261 aa  TRUA2_DESPS RecName: Full=tRNA pseudouridine synthase A 2;       
    8::222     6e-10  28%  244 aa  TRUA2_CLOPE RecName: Full=tRNA pseudouridine synthase A 2;       
    9::188     8e-10  29%  241 aa  TRUA_UREPA RecName: Full=tRNA pseudouridine synthase A;       
    9::188     8e-10  29%  241 aa  TRUA_UREP2 RecName: Full=tRNA pseudouridine synthase A;       
    6::160     8e-10  31%  267 aa  TRUA_STACT RecName: Full=tRNA pseudouridine synthase A;       
    4::255     8e-10  27%  261 aa  TRUA_SHEFN RecName: Full=tRNA pseudouridine synthase A;       
   10::162     8e-10  30%  244 aa  TRUA_PHYMT RecName: Full=tRNA pseudouridine synthase A;       
    8::194     8e-10  34%  251 aa  TRUA_OCHA4 RecName: Full=tRNA pseudouridine synthase A;       
    5::244     8e-10  29%  261 aa  TRUA_COXBR RecName: Full=tRNA pseudouridine synthase A;       
    5::244     8e-10  29%  261 aa  TRUA_COXBN RecName: Full=tRNA pseudouridine synthase A;       
    5::244     8e-10  29%  261 aa  TRUA_COXB2 RecName: Full=tRNA pseudouridine synthase A;       
    5::244     8e-10  29%  261 aa  TRUA_COXB1 RecName: Full=tRNA pseudouridine synthase A;       
    8::161     8e-10  36%  245 aa  TRUA_BRAJA RecName: Full=tRNA pseudouridine synthase A;       
    5::238     8e-10  30%  265 aa  TRUA_ACIBY RecName: Full=tRNA pseudouridine synthase A;       
    5::238     8e-10  31%  265 aa  TRUA_ACIBT RecName: Full=tRNA pseudouridine synthase A;       
    5::238     8e-10  31%  265 aa  TRUA_ACIBS RecName: Full=tRNA pseudouridine synthase A;       
    5::238     8e-10  30%  265 aa  TRUA_ACIB5 RecName: Full=tRNA pseudouridine synthase A;       
    5::238     8e-10  30%  265 aa  TRUA_ACIB3 RecName: Full=tRNA pseudouridine synthase A;       
    7::194     1e-09  28%  258 aa  TRUA_STRA5 RecName: Full=tRNA pseudouridine synthase A;       
    8::169     1e-09  36%  247 aa  TRUA_HYPNA RecName: Full=tRNA pseudouridine synthase A;       
   70::186     1e-09  33%  528 aa  PUS1_ASHGO RecName: Full=tRNA pseudouridine synthase 1;       
    5::247     1e-09  29%  267 aa  TRUA_CHLPN RecName: Full=tRNA pseudouridine synthase A;       
   68::234     1e-09  37%  510 aa  PUSH_ARATH RecName: Full=Putative tRNA pseudouridine synthase;     
    4::243     2e-09  28%  269 aa  TRUA_HAES2 RecName: Full=tRNA pseudouridine synthase A;       
    9::254     2e-09  31%  282 aa  TRUA_COREF RecName: Full=tRNA pseudouridine synthase A;       
   10::158     2e-09  35%  267 aa  TRUA_TROWT RecName: Full=tRNA pseudouridine synthase A;       
    8::172     2e-09  36%  279 aa  TRUA_PROAC RecName: Full=tRNA pseudouridine synthase A;       
   10::245     2e-09  31%  265 aa  TRUA_MYXXA RecName: Full=tRNA pseudouridine synthase A;       
    8::111     2e-09  39%  242 aa  TRUA_HELPJ RecName: Full=tRNA pseudouridine synthase A;       
   10::158     3e-09  35%  267 aa  TRUA_TROW8 RecName: Full=tRNA pseudouridine synthase A;       
    8::159     3e-09  33%  245 aa  TRUA_RICPR RecName: Full=tRNA pseudouridine synthase A;       
    8::129     3e-09  40%  247 aa  TRUA_CAUCR RecName: Full=tRNA pseudouridine synthase A;       
    8::129     3e-09  40%  247 aa  TRUA_CAUCN RecName: Full=tRNA pseudouridine synthase A;       
   10::120     3e-09  34%  263 aa  TRUA_BUCAP RecName: Full=tRNA pseudouridine synthase A;       
    8::192     3e-09  35%  245 aa  TRUA_BRASO RecName: Full=tRNA pseudouridine synthase A;       
    8::194     3e-09  30%  248 aa  TRUA2_CLOTE RecName: Full=tRNA pseudouridine synthase A 2;       
    7::222     4e-09  28%  267 aa  TRUA_STAAT RecName: Full=tRNA pseudouridine synthase A;       
    7::222     4e-09  28%  267 aa  TRUA_STAAE RecName: Full=tRNA pseudouridine synthase A;       
    7::222     4e-09  28%  267 aa  TRUA_STAAC RecName: Full=tRNA pseudouridine synthase A;       
    7::222     4e-09  28%  267 aa  TRUA_STAA8 RecName: Full=tRNA pseudouridine synthase A;       
    7::222     4e-09  28%  267 aa  TRUA_STAA3 RecName: Full=tRNA pseudouridine synthase A;       
    8::246     4e-09  30%  248 aa  TRUA_METSB RecName: Full=tRNA pseudouridine synthase A;       
    8::247     4e-09  28%  268 aa  TRUA_CHLAB RecName: Full=tRNA pseudouridine synthase A;       
    5::75      4e-09  48%  255 aa  TRUA_ACICJ RecName: Full=tRNA pseudouridine synthase A;       
    8::192     5e-09  37%  245 aa  TRUA_RHOPB RecName: Full=tRNA pseudouridine synthase A;       
    8::245     5e-09  36%  250 aa  TRUA_METS4 RecName: Full=tRNA pseudouridine synthase A;       
   14::157     5e-09  36%  247 aa  TRUA_FUSNN RecName: Full=tRNA pseudouridine synthase A;       
    5::238     5e-09  30%  265 aa  TRUA_ACIBC RecName: Full=tRNA pseudouridine synthase A;       
    4::99      7e-09  41%  264 aa  TRUA_POLNA RecName: Full=tRNA pseudouridine synthase A;       
   10::117     7e-09  36%  252 aa  TRUA_BACFR RecName: Full=tRNA pseudouridine synthase A;       
   10::117     7e-09  36%  252 aa  TRUA_BACFN RecName: Full=tRNA pseudouridine synthase A;       
   14::201     7e-09  34%  282 aa  TRUA_ANASP RecName: Full=tRNA pseudouridine synthase A;       
   88::202     7e-09  31%  528 aa  PUS1_YARLI RecName: Full=tRNA pseudouridine synthase 1;       
    8::196     9e-09  34%  250 aa  TRUA_METC4 RecName: Full=tRNA pseudouridine synthase A;       
    6::225     9e-09  28%  271 aa  TRUA_ACIAD RecName: Full=tRNA pseudouridine synthase A;       
    8::245     1e-08  28%  245 aa  TRUA_DICTD RecName: Full=tRNA pseudouridine synthase A;       
    7::245     1e-08  30%  245 aa  TRUA_WOLWR RecName: Full=tRNA pseudouridine synthase A;       
    5::221     1e-08  31%  260 aa  TRUA_THIDA RecName: Full=tRNA pseudouridine synthase A;       
   17::213     1e-08  35%  286 aa  TRUA_MYCLE RecName: Full=tRNA pseudouridine synthase A;       
    4::221     1e-08  31%  262 aa  TRUA_METM6 RecName: Full=tRNA pseudouridine synthase A;       
    8::111     1e-08  38%  242 aa  TRUA_HELPG RecName: Full=tRNA pseudouridine synthase A;       
    8::157     1e-08  33%  248 aa  TRUA_HELHP RecName: Full=tRNA pseudouridine synthase A;       
    8::224     1e-08  24%  245 aa  TRUA2_BACC1 RecName: Full=tRNA pseudouridine synthase A 2;       
    5::218     2e-08  31%  252 aa  TRUA_THEAC RecName: Full=tRNA pseudouridine synthase A;       
    4::238     2e-08  32%  256 aa  TRUA_STRM5 RecName: Full=tRNA pseudouridine synthase A;       
    4::261     2e-08  30%  262 aa  TRUA_LEGPL RecName: Full=tRNA pseudouridine synthase A;       
    8::192     2e-08  36%  245 aa  TRUA_BRASB RecName: Full=tRNA pseudouridine synthase A;       
    8::192     2e-08  31%  260 aa  TRUA_BEII9 RecName: Full=tRNA pseudouridine synthase A;       
    8::194     2e-08  29%  249 aa  TRUA_STREM RecName: Full=tRNA pseudouridine synthase A;       
    7::222     2e-08  27%  264 aa  TRUA_STAAR RecName: Full=tRNA pseudouridine synthase A;       
    8::186     2e-08  28%  243 aa  TRUA_MYCPN RecName: Full=tRNA pseudouridine synthase A;       
    8::111     2e-08  37%  242 aa  TRUA_HELP2 RecName: Full=tRNA pseudouridine synthase A;       
   10::117     2e-08  42%  247 aa  TRUA_BARHE RecName: Full=tRNA pseudouridine synthase A;       
   10::117     2e-08  42%  247 aa  TRUA_BARBK RecName: Full=tRNA pseudouridine synthase A;       
   78::194     2e-08  33%  544 aa  PUS1_YEAST RecName: Full=tRNA pseudouridine synthase 1;       
    7::245     3e-08  29%  245 aa  TRUA_WOLPM RecName: Full=tRNA pseudouridine synthase A;       
    7::222     3e-08  27%  267 aa  TRUA_STAAW RecName: Full=tRNA pseudouridine synthase A;       
    7::222     3e-08  27%  267 aa  TRUA_STAAS RecName: Full=tRNA pseudouridine synthase A;       
    7::222     3e-08  27%  267 aa  TRUA_STAAN RecName: Full=tRNA pseudouridine synthase A;       
    7::222     3e-08  27%  267 aa  TRUA_STAAM RecName: Full=tRNA pseudouridine synthase A;       
    7::222     3e-08  27%  267 aa  TRUA_STAA9 RecName: Full=tRNA pseudouridine synthase A;       
    7::222     3e-08  27%  267 aa  TRUA_STAA2 RecName: Full=tRNA pseudouridine synthase A;       
    7::222     3e-08  27%  267 aa  TRUA_STAA1 RecName: Full=tRNA pseudouridine synthase A;       
    8::192     3e-08  31%  254 aa  TRUA_SPHWW RecName: Full=tRNA pseudouridine synthase A;       
    8::154     3e-08  33%  245 aa  TRUA_RICPU RecName: Full=tRNA pseudouridine synthase A;       
    8::196     3e-08  34%  252 aa  TRUA_METPB RecName: Full=tRNA pseudouridine synthase A;       
    4::261     3e-08  30%  262 aa  TRUA_LEGPH RecName: Full=tRNA pseudouridine synthase A;       
    4::261     3e-08  30%  262 aa  TRUA_LEGPC RecName: Full=tRNA pseudouridine synthase A;       
    4::261     3e-08  30%  262 aa  TRUA_LEGPA RecName: Full=tRNA pseudouridine synthase A;       
    7::114     3e-08  35%  245 aa  TRUA_BORT9 RecName: Full=tRNA pseudouridine synthase A;       
  102::218     3e-08  30%  553 aa  PUS1_KLULA RecName: Full=tRNA pseudouridine synthase 1;       
    4::239     4e-08  33%  257 aa  TRUA_XANCP RecName: Full=tRNA pseudouridine synthase A;       
    4::239     4e-08  33%  257 aa  TRUA_XANCB RecName: Full=tRNA pseudouridine synthase A;       
    4::239     4e-08  33%  257 aa  TRUA_XANC8 RecName: Full=tRNA pseudouridine synthase A;       
    8::194     4e-08  27%  250 aa  TRUA_STRU0 RecName: Full=tRNA pseudouridine synthase A;       
    8::111     4e-08  37%  242 aa  TRUA_HELPH RecName: Full=tRNA pseudouridine synthase A;       
    8::114     4e-08  35%  245 aa  TRUA_BORRA RecName: Full=tRNA pseudouridine synthase A;       
    8::114     4e-08  35%  245 aa  TRUA_BORDL RecName: Full=tRNA pseudouridine synthase A;       
    7::245     6e-08  29%  245 aa  TRUA_WOLPP RecName: Full=tRNA pseudouridine synthase A;       
    7::222     6e-08  28%  267 aa  TRUA_STAAB RecName: Full=tRNA pseudouridine synthase A;       
    8::159     6e-08  36%  245 aa  TRUA_RICTY RecName: Full=tRNA pseudouridine synthase A;       
    8::196     6e-08  34%  250 aa  TRUA_METEP RecName: Full=tRNA pseudouridine synthase A;       
    8::244     6e-08  28%  244 aa  TRUA_CLOBB RecName: Full=tRNA pseudouridine synthase A;       
   10::224     6e-08  30%  248 aa  TRUA1_CLOPE RecName: Full=tRNA pseudouridine synthase A 1;       
   50::161     6e-08  33%  534 aa  PUS1_SCHPO RecName: Full=tRNA pseudouridine synthase 1;       
   11::110     7e-08  47%  248 aa  TRUA_RHOPA RecName: Full=tRNA pseudouridine synthase A;       
    6::196     7e-08  25%  247 aa  TRUA_HYDS0 RecName: Full=tRNA pseudouridine synthase A;       
    7::125     7e-08  35%  246 aa  TRUA_EHRRG RecName: Full=tRNA pseudouridine synthase A;       
    7::154     7e-08  35%  245 aa  TRUA_EHRCJ RecName: Full=tRNA pseudouridine synthase A;       
    8::224     7e-08  23%  245 aa  TRUA2_BACCZ RecName: Full=tRNA pseudouridine synthase A 2;       
    4::240     9e-08  29%  240 aa  TRUA_THETN RecName: Full=tRNA pseudouridine synthase A;       
    8::111     9e-08  37%  242 aa  TRUA_HELPY RecName: Full=tRNA pseudouridine synthase A;       
    5::211     9e-08  30%  247 aa  TRUA_ERYLH RecName: Full=tRNA pseudouridine synthase A;       
    8::191     9e-08  30%  244 aa  TRUA_CLOB8 RecName: Full=tRNA pseudouridine synthase A;       
    8::114     9e-08  36%  245 aa  TRUA_BORHD RecName: Full=tRNA pseudouridine synthase A;       
   10::159     1e-07  30%  243 aa  TRUA_AYWBP RecName: Full=tRNA pseudouridine synthase A;       
    7::190     1e-07  30%  241 aa  TRUA_AQUAE RecName: Full=tRNA pseudouridine synthase A;       
    8::221     1e-07  24%  245 aa  TRUA2_BACCR RecName: Full=tRNA pseudouridine synthase A 2;       
   56::285     1e-07  29%  291 aa  PUSL1_MOUSE RecName: Full=tRNA pseudouridine synthase-like 1;      
    4::238     2e-07  31%  256 aa  TRUA_STRMK RecName: Full=tRNA pseudouridine synthase A;       
    8::180     2e-07  31%  245 aa  TRUA_RICAH RecName: Full=tRNA pseudouridine synthase A;       
   10::158     2e-07  28%  244 aa  TRUA_CLOAB RecName: Full=tRNA pseudouridine synthase A;       
    7::188     2e-07  26%  241 aa  TRUA_UREU1 RecName: Full=tRNA pseudouridine synthase A;       
    7::125     2e-07  35%  246 aa  TRUA_EHRRW RecName: Full=tRNA pseudouridine synthase A;       
    7::125     2e-07  33%  245 aa  TRUA_EHRCR RecName: Full=tRNA pseudouridine synthase A;       
    8::244     2e-07  28%  244 aa  TRUA_CLOBA RecName: Full=tRNA pseudouridine synthase A;       
    8::192     2e-07  25%  245 aa  TRUA2_BACAN RecName: Full=tRNA pseudouridine synthase A 2;       
    8::192     4e-07  25%  245 aa  TRUA2_BACHK RecName: Full=tRNA pseudouridine synthase A 2;       
   10::117     5e-07  37%  247 aa  TRUA_BART1 RecName: Full=tRNA pseudouridine synthase A;       
   10::194     5e-07  34%  247 aa  TRUA_BARQU RecName: Full=tRNA pseudouridine synthase A;       
    8::244     6e-07  24%  264 aa  TRUA_WIGBR RecName: Full=tRNA pseudouridine synthase A;       
    7::238     6e-07  29%  267 aa  TRUA_STAES RecName: Full=tRNA pseudouridine synthase A;       
    7::238     6e-07  29%  267 aa  TRUA_STAEQ RecName: Full=tRNA pseudouridine synthase A;       
    8::161     6e-07  33%  265 aa  TRUA_SALRD RecName: Full=tRNA pseudouridine synthase A;       
   12::218     6e-07  25%  251 aa  TRUA_PICTO RecName: Full=tRNA pseudouridine synthase A;       
    8::111     6e-07  37%  242 aa  TRUA_HELPS RecName: Full=tRNA pseudouridine synthase A;       
   10::245     6e-07  27%  245 aa  TRUA1_CLOTE RecName: Full=tRNA pseudouridine synthase A 1;       
    8::111     1e-06  36%  242 aa  TRUA_HELAH RecName: Full=tRNA pseudouridine synthase A;       
    8::115     1e-06  35%  245 aa  TRUA_RICCK RecName: Full=tRNA pseudouridine synthase A;       
    4::221     1e-06  29%  262 aa  TRUA_METMP RecName: Full=tRNA pseudouridine synthase A;       
   95::251     1e-06  35%  442 aa  PUS3_YEAST RecName: Full=tRNA pseudouridine synthase 3;       
    3::113     1e-06  31%  370 aa  PUS2_YEAST RecName: Full=tRNA pseudouridine synthase 2;       
   90::206     1e-06  28%  549 aa  PUS1_CANGA RecName: Full=tRNA pseudouridine synthase 1;       
   47::219     2e-06  27%  267 aa  TRUA_STAS1 RecName: Full=tRNA pseudouridine synthase A;       
    8::154     2e-06  33%  245 aa  TRUA_RICRS RecName: Full=tRNA pseudouridine synthase A;       
    8::154     2e-06  33%  245 aa  TRUA_RICRO RecName: Full=tRNA pseudouridine synthase A;       
    8::191     2e-06  27%  244 aa  TRUA_CLOK5 RecName: Full=tRNA pseudouridine synthase A;       
    6::134     2e-06  33%  303 aa  PUSL1_HUMAN RecName: Full=tRNA pseudouridine synthase-like 1;      
    7::186     2e-06  33%  289 aa  TRUA_CORGL RecName: Full=tRNA pseudouridine synthase A;       
    8::116     2e-06  31%  244 aa  TRUA_BACSV RecName: Full=tRNA pseudouridine synthase A;       
    8::154     3e-06  32%  245 aa  TRUA_RICFE RecName: Full=tRNA pseudouridine synthase A;       
   10::196     3e-06  27%  251 aa  TRUA_MESFL RecName: Full=tRNA pseudouridine synthase A;       
    9::104     4e-06  38%  264 aa  TRUA_BUCBP RecName: Full=tRNA pseudouridine synthase A;       
    8::65      4e-06  45%  246 aa  TRUA_BORBZ RecName: Full=tRNA pseudouridine synthase A;       
    8::65      4e-06  45%  246 aa  TRUA_BORBU RecName: Full=tRNA pseudouridine synthase A;       
    8::115     5e-06  38%  245 aa  TRUA_RICBR RecName: Full=tRNA pseudouridine synthase A;       
    8::115     5e-06  38%  245 aa  TRUA_RICB8 RecName: Full=tRNA pseudouridine synthase A;       
    8::173     5e-06  32%  297 aa  TRUA_DESVV RecName: Full=tRNA pseudouridine synthase A;       
    8::173     5e-06  32%  297 aa  TRUA_DESVH RecName: Full=tRNA pseudouridine synthase A;       
    2::159     7e-06  26%  241 aa  TRUA_MYCPE RecName: Full=tRNA pseudouridine synthase A;       
   43::158     9e-06  31%  413 aa  YCG6_SCHPO RecName: Full=Putative tRNA pseudouridine synthase
    9::189     9e-06  28%  241 aa  TRUA_CAMJE RecName: Full=tRNA pseudouridine synthase A;       
    8::188     9e-06  28%  240 aa  TRUA_CAMJ8 RecName: Full=tRNA pseudouridine synthase A;       
    7::171     9e-06  29%  246 aa  TRUA_ANAPZ RecName: Full=tRNA pseudouridine synthase A;       
    8::106     1e-05  34%  245 aa  TRUA_RICCN RecName: Full=tRNA pseudouridine synthase A;       
    8::106     1e-05  34%  245 aa  TRUA_RICAE RecName: Full=tRNA pseudouridine synthase A;       
    8::106     1e-05  42%  245 aa  TRUA_RHOPS RecName: Full=tRNA pseudouridine synthase A;       
   28::262     1e-05  27%  262 aa  TRUA_MYCGA RecName: Full=tRNA pseudouridine synthase A;       
    8::192     1e-05  31%  258 aa  TRUA_AZOC5 RecName: Full=tRNA pseudouridine synthase A;       
    8::65      2e-05  41%  246 aa  TRUA_BORGA RecName: Full=tRNA pseudouridine synthase A;       
    8::106     2e-05  42%  245 aa  TRUA_RHOP2 RecName: Full=tRNA pseudouridine synthase A;       
   10::112     3e-05  36%  259 aa  TRUA_COPPD RecName: Full=tRNA pseudouridine synthase A;       
   56::279     3e-05  28%  298 aa  PUSL1_XENLA RecName: Full=tRNA pseudouridine synthase-like 1;      
    7::192     4e-05  31%  243 aa  TRUA_NEOSM RecName: Full=tRNA pseudouridine synthase A;       
    8::159     4e-05  28%  244 aa  TRUA_FINM2 RecName: Full=tRNA pseudouridine synthase A;       
    8::188     6e-05  27%  240 aa  TRUA_CAMJR RecName: Full=tRNA pseudouridine synthase A;       
    8::65      6e-05  40%  246 aa  TRUA_BORAP RecName: Full=tRNA pseudouridine synthase A;       
   47::160     8e-05  28%  267 aa  TRUA_STAHJ RecName: Full=tRNA pseudouridine synthase A;       
    9::189     1e-04  27%  241 aa  TRUA_CAMJD RecName: Full=tRNA pseudouridine synthase A;       
   45::159     1e-04  29%  451 aa  PUS2_SCHPO RecName: Full=tRNA pseudouridine synthase 2;       
    8::65      4e-04  41%  283 aa  TRUA_ORITI RecName: Full=tRNA pseudouridine synthase A;       
    8::65      4e-04  41%  284 aa  TRUA_ORITB RecName: Full=tRNA pseudouridine synthase A;       
    9::115     4e-04  31%  251 aa  TRUA_MYCMS RecName: Full=tRNA pseudouridine synthase A;       
    1::293

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTDASAATRAFRVAYDGREYAGFQRQPHATTVEGTLLRALAKHGILDRGDGPTHATPPGYAAAGRTDAGV
TRUA_HALMA      --------RAYRVAYDGQPYHGFQRQPDVDTVEGRLRSALVRLGVCERGEG----LPDRYAAAGRTDAGV
TRUA_HALSA      --------RAFRVAYDGRPYHGFQRQPDVSTVAGELFGALRR---LDVFDG---AKPPGYAAAGRTDAGV
TRUA_HALS3      --------RAFRVAYDGRPYHGFQRQPDVSTVAGELFGALRR---LDVFDG---AKPPGYAAAGRTDAGV
TRUA_NATPD      --------RAFRIAYDGTGFRGFQRQPHGETVENALFEALSSLGVAFE-DG----RPPGYAAAGRTDAGV
TRUA_THESM      ---------ALKIAYDGTKFYGFQRQPDLRTVEGELIKVLKKLGIIE------DVKEANFKGASRTDRGV
TRUA_UNCMA      ---------ALKIAYVGTNFYGSQAQPGLPTVESELRKALEEAGAIKLGTK--------IAMAGRTDAGV
TRUA_PYRKO      ---------ALRVAYDGSAFYGFQRQPGVRTVEGEIIKVLQKLGIIESPE------KNDFKGASRTDRGV
TRUA_METTP      ---------ALKIAYLGDRYYGFQRQPGLRTVESVMRDALLRIGVAN-GD---------FCYAGRTDRGV
TRUA_METBF      ---------ALKLAYIGTEFHGSQIQPNVETVEGELFKALRNLGIIE---SPKSAN---YTCAGRTDAGV
TRUA_METAC      ---------ALKLAYIGTEFHGSQIQPNVETVEKELFKALRNLSIIE---SPKSAD---YTCAGRTDAGV
TRUA_THEON      ---------ALRIAYDGTAFYGFQRQPGLRTVEGEIIRALTKLGIIE------DVESSNFKGASRTDRGV
TRUA_METMA      ---------ALKLAYIGTEFHGSQIQPSVETVEKELFKALRNLRIIE---SPKSAN---YICAGRTDAGV
TRUA_METBU      ---------ALKIAYIGSNFHGSQVQLNDPTVEGELFKVLKELGIME---DPRTAN---FISSGRTDSGV
TRUA_ARCFU      ---------AFKIAYFGDNFHGSQFQPDQRTVEGEVINALRRLGVEN----------PRLRSAGRTDAGV
TRUA_THEGJ      ---------ALRIAYDGTAFYGFQRQPGIRTVEGELINVLTKLKIIESPE------KNDFKGASRTDRGV
TRUA_PYRAB      ---------AFKIAYDGTRFHGFQRQPNLRTVEGEIIKALNNSGIM----------YSDFKSASRTDRGV
TRUA_PYRFU      ---------ALKIAYDGTKFHGFQRQPNVRTIEGEILRALKDAGI----------EFENFKSASRTDRGV
TRUA_METPE      ---------AFQLSYDGNQFRGSQLQPAYRTVEGELITACQRVQLF---DDPCKA---GFALAGRTDRGV
TRUA_PYRHO      ---------ALKIAYDGTKFHGFQRQPNVRTVEGEIIKALNNSGIMFN----------ELKSASRTDKGV
TRUA_EXISA      ------------VAYDGTHYAGYQVQPNGNTIQAEIESVLAR----------MHRHPVKIIASGRTDARV
TRUA_LACPL      ------------LAYDGTNFAGFQRQPHQRTVEQVVTKAVNKM-------AKDPVEPIVIYGAGRTDAGV
TRUA_SYNSC      ---ASLQRIALSLQYDGSSFCGWQRQRNGRSVQAVLEDAIAQ---LDPH------RPVQTFAAGRTDAGV
TRUA_GEOTN      ------------VAYDGTYFSGYQVQPGKRTVQGEFEGVLKR---MHKGDDVR------ITASGRTDAGV
TRUA_PROMM      ------------VQYEGSNFCGWQRQPQAVSVQQVLEDAISQ---LDP------QRPIQAVAAGRTDAGV
TRUA_EXIS2      ------------IQYDGTDYSGYQVQPNGLTIQEVLEKTL----------GRMHKHPVKVIGSGRTDARV
TRUA_ANOFW      ------------IAYDGTNFAGYQIQQQKRTVQGELERALS---IIHKGQFVR------VYASGRTDATV
TRUA_METTH      ---------ALKVAYIGTNYHGFQRQPDVPTVEGKLLEALEGAGII---EDPKRAR---FQIAGRTDRGV
TRUA_GEOKA      ------------IAYDGTHFSGYQIQPGKRTVQGEFEEVLRR---MHKG------TKVRVAASGRTDAGV
TRUA_RHOBA      ------------VAYDGTEYCGWQVQPEQRSIQSELERVIR----------PLAGRPVRVLGSGRTDAGV
TRUA_METST      ---------ALKIAYIGSNFHGYQRQPNYRTVEGELLRVFKETNIIE------DTWTAHYSVAGRTDKGV
TRUA_BURM1      ---------ALGIQYDGAAFCGWQAQPHGNTVQDALERALAEFARV-----PLHTT-----VAGRTDTGV
TRUA_BACHD      -----------KVAYDGTDFAGYQIQPNERTVQGELESVLKN---IHKGMSIR------VTASGRTDTGV
TRUA_PROM3      ------------VQYEGSNFCGWQRQPQAVSVQQVLEEAISQ---LDP------QRPIQAVAAGRTDAGV
TRUA_BURCM      ---------ALGVQYDGAAFCGWQAQPHGKTVQDALERALGEFACV-----PLHTT-----VAGRTDTGV
TRUA_GEOUR      ------------IEYDGTNYSGWQVQPNGITIQQLIEASLAT----------MLGEPVKLHSSGRTDAGV
TRUA_SYNS9      ---------ALSLQYEGSDFCGWQRQNNARSVQAVLETAIAQLDPL---------RPIQSFAAGRTDAGV
TRUA_METCA      ---------ALGIEYDGSGFAGWQWQNGKRTIQAEVERALSRVA-----DAPVRVT-----CAGRTDAGV
TRUA_BURA4      ---------ALGIQYDGAAFCGWQAQPHGKTVQDALERALGEFACV-----PLHTT-----VAGRTDTGV
TRUA_LACF3      -------------AYDGSNFAGFQIQPGERTVQQVLERAVNK---IAKKPQP----PLMVFGSGRTDAGV
TRUA_BACA2      ------------IAYDGHLFNGYQVQPGKRTVQSELEKALA---VIHKTDGRV----PVYSS-GRTDSDV
TRUA_METLZ      ---------AFLAGYRGQNFAGSQYQPHKRTVEGEFVAGGIELGLF------SDAKEAHFRTAGRTDKGV
TRUA_SHEB8      ---------ALGIEYDGNGYFGWQRQAEVDSVQGQLERALS----------IVANEPIGVFCAGRTDAGV
TRUA_DESRM      ------------LAYDGTNYHGFQEQ------RGTGLATIQE--ALEKALSTIAQTPIQVIGAGRTDAGV
TRUA_BURS3      ---------ALGIQYDGAAFCGWQAQPHGKTVQDRLEHALAEFARV-----PLHTT-----VAGRTDTGV
TRUA_BACP2      ------------VSYDGTHFKGYQVQPGQRTVQTEIESALAKMHKQDE------LVP--IVASGRTDSGV
TRUA_BURCH      ---------ALGIQYDGAAFCGWQAQPHGKTVQDRLEHALAEFARV-----PLHTT-----VAGRTDTGV
TRUA_BURCC      ---------ALGIQYDGAAFCGWQAQPHGKTVQDRLEHALAEFARV-----PLHTT-----VAGRTDTGV
TRUA_BURCA      ---------ALGIQYDGAAFCGWQAQPHGKTVQDRLEHALAEFARV-----PLHTT-----VAGRTDTGV
TRUA_METKA      ---------ALRVAYDGSRYHGFQYQPDVPTIEGALRKALSELGL----------ELVGYAS--RTDAGA
TRUA_SHESR      ---------ALGIEYDGSGYFGWQRQAEVDSVQGQLEQALSK----------VANEPISLFCAGRTDAGV
TRUA_SHESM      ---------ALGIEYDGSGYFGWQRQAEVDSVQGQLEQALSK----------VANEPISLFCAGRTDAGV
TRUA_BURVG      ---------ALGVQYDGAAFCGWQAQPHGKTVQDALERALGEFACV-----PLHTT-----VAGRTDTGV
TRUA_SOLUE      ------------LAYDGGPFHGWQVQPGLATIQG----------ILEEIVGGMEGKPVHVAGSGRTDAGV
TRUA_SHESA      ---------ALGIEYDGSGYFGWQRQAEVDSVQGQLEQALSK----------VANEPISLFCAGRTDAGV
TRUA_PHOLL      ---------ALGIEYDGSRYYGWQRQQEVKSVQGCLEEALSK--VADE--------PISVFCAGRTDAGV
TRUA_SHEB5      ---------ALGIEYDGNGYFGWQRQAEVDSVQAQLERALSI----------VANEPIGVFCAGRTDAGV
TRUA_METMJ      ---------AFRFSYFGDRFFGSQMQPDLCTVEGEFIGACRLLRLFDDW------REANFATAGRTDRGV
TRUA_SHEB9      ---------ALGIEYDGNGYFGWQRQAEVDSVQAQLERALSI----------VANEPIGVFCAGRTDAGV
TRUA_SHEB2      ---------ALGIEYDGNGYFGWQRQAEVDSVQAQLERALSI----------VANEPIGVFCAGRTDAGV
TRUA_BURPS      ---------ALGIQYDGAAFCGWQSQPHGKTVQDALERSLAEF-----AQTSLHTT-----VAGRTDTGV
TRUA_BURP8      ---------ALGIQYDGAAFCGWQSQPHGKTVQDELERALREFAL----------TPLQTVVAGRTDTGV
TRUA_BURP6      ---------ALGIQYDGAAFCGWQSQPHGKTVQDALERSLAEF-----AQTSLHTT-----VAGRTDTGV
TRUA_BURP1      ---------ALGIQYDGAAFCGWQSQPHGKTVQDALERSLAEF-----AQTSLHTT-----VAGRTDTGV
TRUA_BURP0      ---------ALGIQYDGAAFCGWQSQPHGKTVQDALERSLAEF-----AQTSLHTT-----VAGRTDTGV
TRUA_BURMS      ---------ALGIQYDGAAFCGWQSQPHGKTVQDALERSLAEF-----AQTSLHTT-----VAGRTDTGV
TRUA_BURMA      ---------ALGIQYDGAAFCGWQSQPHGKTVQDALERSLAEF-----AQTSLHTT-----VAGRTDTGV
TRUA_BURM9      ---------ALGIQYDGAAFCGWQSQPHGKTVQDALERSLAEF-----AQTSLHTT-----VAGRTDTGV
TRUA_BURM7      ---------ALGIQYDGAAFCGWQSQPHGKTVQDALERSLAEF-----AQTSLHTT-----VAGRTDTGV
TRUA_BACSU      ------------ISYDGHLFNGYQVQPGKRTVQDELEKALAVHKSKDRIP---------VVSSGRTDSGV
TRUA_SHESW      ---------ALGIEYDGSGYFGWQRQAEVDSVQGQLERALS----------IVANEPIGLFCAGRTDAGV
TRUA_PROMA      ---------ALSIQYQGSNFSGWQRQKVGHTIQAILEDAIFS---LDS------SKPAKVVAAGRTDAGV
TRUA_DEIRA      ------------VAWDGRDYAGWQEQRNAVSVQETLQTALHALG----GEGALRPV-----SAGRTDAGV
TRUA_BURTA      ---------ALGIQYDGAAFCGWQSQPHGKTVQDALERALAEF-----AQTSLHTT-----VAGRTDTGV
TRUA_THENV      ----------YRIAYDGTLFYGFTGHPRS--LEPHLRRALGD--VLGRGS--------------RTDPGV
TRUA_METI4      ------------LSYCGSGFHGWQRQGELPTVQRALEEAVAK----------IWEEPIPVEGAGRTDAGV
TRUA_SHEPC      ---------ALGIEYDGSGYFGWQRQAEVDSVQGQLERALS----------IVANEPIGLFCAGRTDAGV
TRUA_BACLD      ------------ISYDGHLFYGYQVQPGQRTIQDELEKALQTHKAKERIP---------VVSSGRTDSGV
TRUA_PELCD      ------------IEYDGTPYVGWQRQPNGLSVQQVVEEALAK----------VCGGPHSLVSSGRTDAGV
TRUA_LISIN      ------------ISYDGSGFFGYQVQPNTRTVQAEIEKALEK---MHKGKSVR------ITASGRTDTGV
TRUA_CHLPD      ------------IEYDGTGYAGWQRQAGSCTVQGEIERILSQ--ILQEDIR--------LAGAGRTDKGV
TRUA_LACC3      ------------LAYDGTNFAGYQVQPKQRTVQGVLQKALTK---------MTKGQPVHVDGSGRTDSGV
TRUA_ENTS8      ---------ALGIEYDGSKYYGWQRQQEVRSVQEKLEKALSQ----------VANEPINVFCAGRTDAGV
TRUA_LACSS      ------------VAYDGTDFAGFQVQPKQRTVQGTLEKALTK---MSKG-----AYIQVY-GSGRTDSGV
TRUA_LACCB      ------------LAYDGTNFAGYQVQPKQRTVQGVLQKALTK---------MTKGQPVHVDGSGRTDSGV
TRUA_GEOSF      ------------IEYDGTAYCGWQLQPNGITIQQVIEESLEK----------MLGQSVRLQSSGRTDAGV
TRUA_COLP3      ---------ALGIEYDGKNYCGWQRQNNVITVQEKLEKALSK--IADE--------KIEVVCAGRTDTGV
TRUA_VIBVY      ---------ALGIEYNGTDYFGWQRQREVASVQEKLEKALSKVA--------NH--PVEVQCAGRTDAGV
TRUA_VIBVU      ---------ALGIEYNGTDYFGWQRQREVASVQEKLEKALSKVA--------NH--PVEVQCAGRTDAGV
TRUA_VIBPA      ---------ALGIEYNGTNYFGWQRQREVKSVQEELEKALANH-------------PVEVQCAGRTDAGV
TRUA_VIBCM      ---------ALGIEYDGTHYYGWQRQREVKSVQEALEKALSKIA--------NH--PVEVQCAGRTDAGV
TRUA_VIBCH      ---------ALGIEYDGTHYYGWQRQREVKSVQEALEKALSKIA--------NH--PVEVQCAGRTDAGV
TRUA_VIBC3      ---------ALGIEYDGTHYYGWQRQREVKSVQEALEKALSKIA--------NH--PVEVQCAGRTDAGV
TRUA_SYNPX      ---------ALSLQYEGSAFCGWQRQRNGNSVQAQLEAAIEQ---LDP------YRPIQTFAAGRTDTGV
TRUA_HERAR      ------------VQYDGAPWQGWQTQLNGLTVQDKLEFALYKF---------TQQTITT-ACAGRTDAGV
TRUA_PELPB      ------------VEYDGTSFAGWQRQSGAVTVQGEIEVALGK--ILQE--------KISLAAAGRTDKGV
TRUA_PROM9      ---------ALLVQYDGSNYSGWQRQKNATTVQETLERALFK---------ITHQVVKTF-AAGRTDAGV
TRUA_PHOPR      ---------ALGIEYDGAKYCGWQRQVDVDSVQERLEKALSH--IANK--------PIAVFCAGRTDTGV
TRUA_LISMH      ------------ISYDGSGFYGYQVQPNTRTVQAEIEKALTK---MHKG------KTVRITASGRTDTGV
TRUA_KLEP7      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPITVFCAGRTDAGV
TRUA_ENT38      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANQPIAVCCAGRTDAGV
TRUA_VIBHB      ---------ALGIEYNGTNYFGWQRQREVKSVQEELEKALANH-------------PVEVQCAGRTDAGV
TRUA_IDILO      ---------ALCLEYDGSRYYGWQRQREVASVQQCVEEALSKIA-----NAPVEVT-----CAGRTDAGV
TRUA_BURPP      ---------ALGVQYDGSAFCGWQSQPHRNTVQDELERALREFA----------RTPVQTVVAGRTDTGV
TRUA_BORPD      ---------ALGLAYDGSSWQGWQTQPHRQTVQDTLEAALARFAGID-GSLPT-------VCAGRTDTGV
TRUA_SHEDO      ---------ALGIEYDGSSYCGWQRQVEVDSVQAQLEKALSL----------IANEPIEVVCAGRTDAGV
TRUA_LISMO      ------------ISYDGSGFYGYQVQPNTRTVQAEIEKALTK---MHKG------KTVRVTASGRTDTGV
TRUA_LISMF      ------------ISYDGSGFYGYQVQPNTRTVQAEIEKALTK---MHKG------KTVRITASGRTDTGV
TRUA_LISMC      ------------ISYDGSGFYGYQVQPNTRTVQAEIEKALTK---MHKG------KTVRITASGRTDTGV
TRUA_KLEP3      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPITVFCAGRTDAGV
TRUA_GLOVI      --EGAPARLALRVQYLGGHFFGWQWQPGQRTVQQCLEEAIARH-------------PVRYHAAGRTDTGV
TRUA_GEOSM      ------------IEYDGTAYCGWQVQPNGRTVQEALEEALAS---MLGGKTALH-------GSGRTDAGV
TRUA_CHLL2      ----------FDVEYDGTDFCGWQRQPGGITLQGELEAQLGR--ILQENISLT--------AAGRTDKGV
TRUA_BACSK      ---------ACKLSYDGTAFAGYQVQPGKRTVQSEVERALQE---IHKG-----ARVP-VVASGRTDAGV
TRUA_SHESH      ---------ALGIEYDGRQYFGWQRQAEVDSVQAQLERALSK----------VANEPIRVHCAGRTDAGV
TRUA_SALTY      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPINVFCAGRTDAGV
TRUA_SALTI      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPINVFCAGRTDAGV
TRUA_SALSV      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPINVFCAGRTDAGV
TRUA_SALPK      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPINVFCAGRTDAGV
TRUA_SALPC      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPINVFCAGRTDAGV
TRUA_SALPB      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPINVFCAGRTDAGV
TRUA_SALPA      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPINVFCAGRTDAGV
TRUA_SALNS      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPINVFCAGRTDAGV
TRUA_SALHS      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPINVFCAGRTDAGV
TRUA_SALG2      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPINVFCAGRTDAGV
TRUA_SALEP      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPINVFCAGRTDAGV
TRUA_SALDC      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPINVFCAGRTDAGV
TRUA_SALCH      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPINVFCAGRTDAGV
TRUA_SALA4      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPINVFCAGRTDAGV
TRUA_SHEAM      ---------ALGIEYDGSKFYGWQRQAEVNSVQAELERALS----------IVANEPIEVQCAGRTDAGV
TRUA_RALPJ      ---------ALGIQYDGAAFSGWQSQPHGNTVQDALESALRQFAGV--------ALPT--TVAGRTDAGV
TRUA_NEIG1      MDTAQKQRWAITLSYDGSRFYGWQKQAGGVTVQAALETALARIA------GESVAT----TVAGRTDTGV
TRUA_LACRJ      -------------AYDGTNFSGFQIQPNKRTVEQTLKNAIAKH--------PTPAIP--VIGSGRTDAGV
TRUA_LACRD      -------------AYDGTNFSGFQIQPNKRTVEQTLKNAIAKH--------PTPAIP--VIGSGRTDAGV
TRUA_FRATN      -----------QIEYFGRNYCGWQRQSHSPSVQEELEKALSK--IANQNIEVT--------CAGRTDTGV
TRUA_CITK8      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPVNVFCAGRTDAGV
TRUA_BORA1      ---------ALGLSYDGSSWQGWQTQPHGQTVQDTLEAALGQFS----GTG----APLDTLCAGRTDTGV
TRUA_AKKM8      ----------FTAAYDGRPYLGWQSQPGGRTVQDVLERAFS--GLF--------GTTCRIHGSGRTDAGV
TRUA_RALSO      ---------ALGIQYDGAAFSGWQSQPHGNTVQDVLEAALREFAGV--------ALPT--TVAGRTDAGV
TRUA_STRSV      ------------ISYDGYGFAGFQRQPHARSVQEEIEKTLTR---INKG------RPVVIHGAGRTDSGV
TRUA_PSEAE      ---------ALGIEYKGSRYRGWQRQEAGVSVQEALERALSK----------VAAEPVGVICAGRTDAAV
TRUA_NEIMB      MDTAQKQRWAITLSYDGSRFYGWQKQADGVTVQAALETALAQIA------GEAVST----TVAGRTDTGV
TRUA_ECOLI      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPITVFCAGRTDAGV
TRUA_ECODH      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPITVFCAGRTDAGV
TRUA_ECOBW      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPITVFCAGRTDAGV
TRUA_SYNWW      --------------YDGSNYHGFQLQKNANTVQAELEKAIYRLS----GERAT------IVCAGRTDAGV
TRUA_SHISS      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPITVFCAGRTDAGV
TRUA_SHIFL      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPITVFCAGRTDAGV
TRUA_SHIF8      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPITVFCAGRTDAGV
TRUA_SHIDS      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPITVFCAGRTDAGV
TRUA_SHIB3      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPITVFCAGRTDAGV
TRUA_NITEU      --------------YDGRGYCGWQKQPGCLSVQSRLESALS--GVAGR--------QIQVVAAGRTDAGV
TRUA_MANSM      ---------ALGIEYNGKNYFGWQRQEKVHSVQAELEKALSF----------VANEKIEVFCAGRTDSGV
TRUA_LACBA      --------------YDGTNFAGFQRQPNKRTVESTLTDVVNK---MAKQPDPAIV----IYGSGRTDAGV
TRUA_ECOSM      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPITVFCAGRTDAGV
TRUA_ECOSE      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPITVFCAGRTDAGV
TRUA_ECOLU      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPITVFCAGRTDAGV
TRUA_ECOLC      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPITVFCAGRTDAGV
TRUA_ECOL6      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPITVFCAGRTDAGV
TRUA_ECOHS      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPITVFCAGRTDAGV
TRUA_ECO8A      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPITVFCAGRTDAGV
TRUA_ECO7I      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPITVFCAGRTDAGV
TRUA_ECO5E      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPITVFCAGRTDAGV
TRUA_ECO57      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPITVFCAGRTDAGV
TRUA_ECO55      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPITVFCAGRTDAGV
TRUA_NITEC      --------------YDGRGYCGWQKQPDRISVQSRLESALSRIA----------SSQIQVVAAGRTDAGV
TRUA_GEOBB      ------------IEYDGTAYCGWQVQPNGRTVQEVLQEALA---AMLGEKTPLH-------GSGRTDAGV
TRUA_FRATW      -----------QIEYFGKNYCGWQRQSHSPSVQESLEKALSK--IANQNIEVT--------CAGRTDTGV
TRUA_ESCF3      ---------ALGIEYDGSRYYGWQRQNEVRSVQEKLEKALSQ----------VANEPITVFCAGRTDAGV
TRUA_ECOUT      ---------ALGIEYDGSRYYGWQRQNEVRSVQEKLEKALSQ----------VANEPITVFCAGRTDAGV
TRUA_ECOL5      ---------ALGIEYDGSRYYGWQRQNEVRSVQEKLEKALSQ----------VANEPITVFCAGRTDAGV
TRUA_ECOK1      ---------ALGIEYDGSRYYGWQRQNEVRSVQEKLEKALSQ----------VANEPITVFCAGRTDAGV
TRUA_ECO81      ---------ALGIEYDGSRYYGWQRQNEVRSVQEKLEKALSQ----------VANEPITVFCAGRTDAGV
TRUA_ECO45      ---------ALGIEYDGSRYYGWQRQNEVRSVQEKLEKALSQ----------VANEPITVFCAGRTDAGV
TRUA_ECO27      ---------ALGIEYDGSRYYGWQRQNEVRSVQEKLEKALSQ----------VANEPITVFCAGRTDAGV
TRUA_ECO24      ---------ALGIEYDGSRYYGWQRQNEVRSVQEKLEKALSQ----------VANEPITVFCAGRTDAGV
TRUA_DESAD      ------------IAYDGTNFCGWQLQPKLRTVQGDLEKAITR----------ITGTTVRVHGSGRTDSGV
TRUA_BREBN      ------------LAYDGTDFSGFQVQPDQVTVQGEIEAA------LNRVTGEDIQV----FGSGRTDAGV
TRUA_THICR      ---------AIGIEYQGTAYCGWQHQKHCDSVQQQLEKALSY--IADE--------PIGLNCAGRTDTGV
TRUA_SHEWM      ---------ALGIEYDGSKYFGWQRQVEVDSVQAQLERALSK----------VANEPISVHCAGRTDTGV
TRUA_NEIM0      MDTAQKQRWAITLSYDGSRFYGWQKQADGVTVQAALETALAQIA------GEAVST----TVAGRTDTGV
TRUA_NATTJ      ------------IAYDGSNYHGYQLQENAVTVQEKLEKAL------NTVYYPYKITP---YSASRTDSGV
TRUA_ANATD      ------------IEYDGTGYFGWQKQPNKKTIQGTIEEAIKK----------LTGEEVNLIGSGRTDRGV
TRUA_TREPS      -----------RISYDGTRFCGWQKQ-----VSGSRERAPSVQGELEKVAEKIHHQKIAVIGSGRTDSGV
TRUA_TREPA      -----------RISYDGTRFCGWQKQ-----VSGSRERAPSVQGELEKVAEKIHHQKIAVIGSGRTDSGV
TRUA_STRZT      ------------ISYDGYAFAGFQRQPHARSVQEEIEKTLTR---LNKGQTIT------VHGAGRTDSGV
TRUA_FRATT      -----------QIEYFGKNYCGWQRQSHSPSVQEELEKALSK--IANQNIEVT--------CAGRTDTGV
TRUA_FRATM      -----------QIEYFGKNYCGWQRQSHSPSVQEELEKALSK--IANQNIEVT--------CAGRTDTGV
TRUA_FRAT1      -----------QIEYFGKNYCGWQRQSHSPSVQEELEKALSK--IANQNIEVT--------CAGRTDTGV
TRUA_SHEPW      ---------ALGIEYDGSRYYGWQRQLDVDSVQGQLEKALSK----------VANEPITVQCAGRTDTGV
TRUA_SALAR      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPINVFCAGRTDAGV
TRUA_PYRIL      ----------YRIAYDGTLFYGFTG--HSRSLEPALKRVFGE--ILGRGS--------------RTDPGV
TRUA_NITOC      ---------ALGLEYDGSNFSGWQSQKGVRTVQATLEQALS----------AVANEPVTVITAGRTDAGV
TRUA_NEIMF      MDTAQKQRWAITLSYDGSRFYGWQKQADGVTVQAALETALAQIA------GEAVST----TVAGRTDTGV
TRUA_NEIG2      MDTAQKQRWAITLSYDGSRFYGWQKQAGGVTVQAALETALARIA------GESVAT----TVAGRTDTGV
TRUA_LISW6      ------------ISYDGSGFYGYQIQPNARTVQAEIEKALKK---MHKGKNVR------ITASGRTDTGV
TRUA_DESAP      ------------LAYDGTAYHGFQKQSGSPTIQETLERCLAE----------LSGAALKVTGASRTDAGV
TRUA_YERPS      ---------ALGIEYNGSRYFGWQRQQEVASVQACLEAALSK----------VANEPIGVFCAGRTDAGV
TRUA_YERPE      ---------ALGIEYNGSRYFGWQRQQEVASVQACLEAALSK----------VANEPIGVFCAGRTDAGV
TRUA_YERP3      ---------ALGIEYNGSRYFGWQRQQEVASVQACLEAALSK----------VANEPIGVFCAGRTDAGV
TRUA_PSEHT      ---------ALGVEYNGARYSGWQRQSHVNSVQQEVETALSR--ICNH--------PVAIVCAGRTDAGV
TRUA_PSEA6      ---------ALGVEYDGARFHGWQRQNEVISVQQHLEEALTRIA----------NEPIRVVCAGRTDAGV
TRUA_FRATO      -----------QIEYFGKNYCGWQRQSHSLSVQEELEKALSK--IANQNIEVT--------CAGRTDTGV
TRUA_FRATH      -----------QIEYFGKNYCGWQRQSHSLSVQEELEKALSK--IANQNIEVT--------CAGRTDTGV
TRUA_AERS4      ---------ALGIEYDGSRYFGWQRQREVISVQAELEKALSRIA--------NH--PVSIQCAGRTDAGV
TRUA_STRPN      ------------ISYDGYAFAGFQRQPHARSVQEEIEKTLTR---LNKGQAIT------VHGAGRTDSGV
TRUA_STRP7      ------------ISYDGYAFAGFQRQPHARSVQEEIEKTLTR---LNKGQAIT------VHGAGRTDSGV
TRUA_SHIBS      ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPITVFCAGRTDAGV
TRUA_PROM2      ---------ALLVQYDGYHYSGWQKQKNATTVQEILESALFK---------ITNHTVKTF-AAGRTDAGV
TRUA_PROM0      ---------ALLVQYDGSHYSGWQKQKNATTVQEILDRALLK---------ITNHTVQTF-AAGRTDAGV
TRUA_FRATF      -----------QIEYFGKNYCGWQRQSHSLSVQEELEKALSK--IANQNIEVT--------CAGRTDTGV
TRUA_CHLTE      ----SKRTIKMQIEYDGTGYSGWQRQPDVVTVQGEIERVLER----------IMQEPVSIDGAGRTDSGV
TRUA1_DESPS     ------------IAFDGTDYSGWQKQHHANTIQGEIEARLKRLSVKE----------ISLHGAGRTDAGV
TRUA_KOSOT      ------------VVYDGSNFFGYQIQPNKRTVQGVFEEALER---IHKAKIPTD-------GAGRTDTGV
TRUA_GEOSW      ------------LSYDGTHFFGYQIQPGKRTVQGELERVLEQ---MHKGKAIR------VTASGRTDAGV
TRUA1_BACHK     ------------VAYDGMHFCGYQIQPQHRTVQQEIEKALQK---LHKGE------LVRVQASGRTDSTV
TRUA1_BACCZ     ------------VAYDGMHFCGYQIQPQHRTVQQEIEKALQK---LHKGE------LVRVQASGRTDSTV
TRUA1_BACAN     ------------VAYDGMHFCGYQIQPQHRTVQQEIEKALQK---LHKGE------LVRVQASGRTDSTV
TRUA_THENN      ------------VEYDGSNFFGYQGQPDVRTVQGVILERIFKQRIYTQ-------------AAGRTDAGV
TRUA_STRGG      ------------LSYDGKDFSGWAKQTSRRTVQGEIEDALRT---VTRSSVTYDLT-----VAGRTDAGV
TRUA_AERHH      ---------ALGIEYDGSRYFGWQRQREVISVQEELEKALSRIA--------NH--PVSIQCAGRTDAGV
TRUA_VIBSL      ---------ALGIEYNGTHYFGWQRQRDVKSVQEELEKALANH-------------PVEVMCAGRTDAGV
TRUA_THEAB      ---------AIEFAYDGTKFFGYQGQPNVRTVQGDLLERIFKERIYTQ-------------AAGRTDAGV
TRUA_METFK      ---------ALGIEYDGAGFCGWQSQPNRLAVQDALLSQLAGHQVR-------------VSAAGRTDTGV
TRUA_ALCBS      ---------ALGIEYDGTDFRGWQMQQSGVTVQECLEAALSKVA--------NHSVT--VVCAGRTDAGV
TRUA1_BACCR     ------------VAYDGMHFCGYQIQPNHRTVQQEIEKALQK---LHKGE------LVRVQASGRTDSTV
TRUA1_BACC1     ------------VAYDGMHFCGYQIQPQHRTVQQEIEKALQK---LHKGE------LVRVQASGRTDSTV
TRUA_THEPX      ------------VEYDGTNYHGWQYQKNAVTVQEVLQKAIKK----------VTGEEVNLIGASRTDTGV
TRUA_THEP3      ------------VEYDGTNYHGWQYQKNAVTVQEVLQKAIKK----------VTGEEVNLIGASRTDTGV
TRUA_THEMA      ------------IEYDGSNFFGYQGQPDVRTVQGVILERIFKQRIYTQ-------------AAGRTDTGV
TRUA_STRAW      ------------LSYDGTEFSGWAKQAAGRTVQGEILRTVTRSG----------ETTYELTVAGRTDAGV
TRUA_MOOTA      ------------LAYDGSNYAGWQVQPHGPTVQGEVAAALKRL----TGE---EITP---VAAGRTDAGV
TRUA_HAEIG      ---------ALGIEYNGQNYYGWQRQEKVRSVQEELEKALS-HIANEKID---------IFCAGRTDSGV
TRUA_STRGC      ------------ISYDGHDFAGFQRQPHARSVQEEIEKTLTR---INKGQ------PVVIHGAGRTDSGV
TRUA_OCEIH      ------------VSYDGSDFAGFQVQPDHRTVQGVLEKALYN---MHKGKSIR------IQASGRTDTGV
TRUA_GEOSL      --------------YDGTNYAGWQLQPNGLSIQEVVEGALAR----------LLKEPVRLRASGRTDAGV
TRUA_THEP1      ------------IEYDGSNFFGYQGQPDVRTVQGVIEDALER----------IFKQRIYIQAAGRTDTGV
TRUA_STRMU      ------------ISYDGTNFSGFQRQPQVRTVEKTLLRLNSGQAVKIHG-------------AGRTDAGV
TRUA_RALEJ      ---------AIGLHYDGAAFSGWQSQPHRNTVQDYL------EDSIERFAGVRLLT----TVAGRTDAGV
TRUA_NEIMA      MDTAQKQRWAITLSYDGSRFYGWQKQADGVTVQAALETALAQIA------GEAVST----TVAGRTDTGV
TRUA_BURXL      ---------ALGVQYDGSVFCGWQSQPHGNTVQDELERALREFA----------QTPVQTIVAGRTDTGV
TRUA_PROMS      ---------ALLVQYDGSHYSGWQKQKNANTIQEILDKALLK---------ITNHTVKTF-AAGRTDAGV
TRUA_POLSQ      ---------ALGLQYDGSPYAGWQTQLHQPTIQDELEKALTAFIGEEAKAFPVHTI-----TAGRTDTGV
TRUA_PASMU      ---------ALGIQYNGKNYCGWQRQENVASVQEQLEKAISF----------VANQPCQIFCAGRTDSGV
TRUA_CALS8      ------------IEYDGTNYFGWQKQPNKKTVQGVIEDAIKK----------ITGEDVNLVGSGRTDRGV
TRUA_STRP4      ------------ISYDGYAFAGFQRQSHARSVQEEIEKTLTR---LNKGQTIT------VHGAGRTDSGV
TRUA_ROSDO      ---------ALKVEYNGAPFVGWQRQKEHPTIQGAIERAL----------GKIAPGPHTIAAAGRTDAGV
TRUA_PROM4      ---------ALLIQYNGSGFCGWQRQKEGNSVQSILEEAVSS---LDPFQ------PIKVVAAGRTDSGV
TRUA_NOCFA      ---------------------GWARQPGLRTVQGVLEDALGK----------VLREPIQLTVAGRTDAGV
TRUA_HAEIN      ---------ALGIEYNGQNYYGWQRQEKVRSVQEELEKALS-HIANEKIE---------IFCAGRTDSGV
TRUA_HAEI8      ---------ALGIEYNGQNYYGWQRQEKVRSVQEELEKALS-HIANEKIE---------IFCAGRTDSGV
TRUA_VARPS      ---------ALGIRYNGQAYEGWQSQRSGRTVQDKLEAALAKFA----------AQPIGTLCAGRTDAGV
TRUA_PROM5      ---------ALLVQYDGSYFSGWQRQKNAISVQEMIEDALFK----------VSNQMIKTFAAGRTDSGV
TRUA_LACH4      ------------MAYDGHLFHGFQLQPDQRTVQGTVEDALKK---------MTKGKRIIVQGSGRTDAGV
TRUA_THELT      ------------VSYDGTNFCGFQVQKDVRTVQGMFEQALEKQRVIT-------------IAAGRTDTGV
TRUA_RALEH      ---------ALGLHYDGAAFSGWQSQPHRNTVQDHLENAI------ERFAGVRLLT----TVAGRTDTGV
TRUA_FERNB      ---------AIEFSYDGTDFFGYQIQNNVRTVQGELEKALEK----------VFKIHIDTYAAGRTDTGV
TRUA_STRZJ      ------------ISYDGYAFAGFQRQSHARSVQEEIEKTLTR---LNKGQTIT------VHGAGRTDSGV
TRUA_STRR6      ------------ISYDGYAFAGFQRQSHARSVQEEIEKTLTR---LNKGQTIT------VHGAGRTDSGV
TRUA_STRPS      ------------ISYDGYAFAGFQRQSHARSVQEEIEKTLTR---LNKGQTIT------VHGAGRTDSGV
TRUA_STRPJ      ------------ISYDGYAFAGFQRQSHARSVQEEIEKTLTR---LNKGQTIT------VHGAGRTDSGV
TRUA_STRPI      ------------ISYDGYAFAGFQRQSHARSVQEEIEKTLTR---LNKGQTIT------VHGAGRTDSGV
TRUA_STRP2      ------------ISYDGYAFAGFQRQSHARSVQEEIEKTLTR---LNKGQTIT------VHGAGRTDSGV
TRUA_JANSC      ---------AFRIEYDGHPFKGWQRQTDLPSVQGAVEAALAK----------LEADVPTIAAAGRTDTGV
TRUA_CHLTA      -----------QIAYQGTSYSGWQYQPNALSIQETILKKIAGFRI-------------SVISSGRTDAGV
TRUA_BORPE      ---------ALGLAYDGSAWQGWQTQPHGVTVQDQVEAALASFA---GGGGPV-----ATVCAGRTDTGV
TRUA_THESQ      ------------IEYDGSNFFGYQGQPDVRTVQGVILERIFKQRIYTQ-------------AAGRTDAGV
TRUA_THEM4      ---------AIEFSYDGTNFFGYQGQPNVRTVQGELEKALEKERIFTQG-------------AGRTDAGV
TRUA_PYRAR      ----------YRIAYDGTLFYGFTGHPNS--LEPKLRAALGE--ILGRGS--------------RTDPGV
TRUA_FRAP2      -----------QIEYFGKNYCGWQRQSHSPSIQEELEKALSK--IANQNIEVT--------CAGRTDTGV
TRUA_CHLTB      -----------QIAYQGTSYSGWQYQPNALSIQKTILKKIAGFRI-------------SVISSGRTDAGV
TRUA_CHLT2      -----------QIAYQGTSYSGWQYQPNALSIQKTILKKIAGFRI-------------SVISSGRTDAGV
TRUA_STRZP      ------------ISYDGYAFAGFQRQSHARSVQEEIEKTLTR---LNKGQAIT------VHGAGRTDSGV
TRUA_CUPTR      ---------ALGLHYDGAAFSGWQSQPHRNTVQDHLEDAI------ERFAGVRLLT----TVAGRTDAGV
TRUA_CHRVO      ---------ALGIEYDGRAFAGWQSQPHGNTVQDRLNRALGQ--IAGNRDVVTH-------AAGRTDAGV
TRUA_CHLTR      -----------QIAYQGTSYSGWQYQPNALSIQETILKKIAGFRI-------------SVISSGRTDAGV
TRUA1_PARUW     ------------IAYDGTNYSGWQIQPNASSIQQKIQEALC---ILLKKEKVV------LVGSGRTDAGV
TRUA_THET8      --------------YDGTLFAGLQRQGRGLTVQGELERALPGIGAL-----------PKAVAAGRTDAGV
TRUA_THET2      --------------YDGTLFAGLQRQGRGLTVQGELERALPGIGAL-----------PKAVAAGRTDAGV
TRUA_PROMP      ---------ALVIQYDGSYFSGWQRQKNAISVQETIENCLFKNQIIKT------------FASGRTDAGV
TRUA_METS3      ---------ALKIGYIGTNFHGFQRQPDLRTVEEELIYHLRKLGYID------DLKKSRFRIAGRTDAGV
TRUA_HAEDU      ---------ALGIEYDGSNYFGWQRQAEVVSVQQTLEEALSK---------VTNTTIEVF-CAGRTDSGV
TRUA_BDEBA      ----------FTVAYDGTGFCGWQKQKDQISVAQVIEEALSK----------VFNEKITLFASGRTDAGV
TRUA_THEEB      ---------ALLIQYQGTHFHGWQRQVGQRTVQEVIEQAIAS--VVNH--------PVSVVAAGRTDTGV
TRUA_SHELP      ---------ALGIEYDGSRYFGWQRQAEVDSVQAQLERALSF----------VANEPISIQCAGRTDAGV
TRUA_RHORT      ------------VEYDGRGYCGWQRQDNGPTIQQSLEEAAFRCGVATRVHG-----------SGRTDSGV
TRUA_PROVI      ------------VEYDGTSFAGWQRQPNGVTVQGEIEAVLSE--ILQE--------KINLAAAGRTDRGV
TRUA_PELLD      -----------RVEYDGTPYAGWQRQPGGVTVQGELEACLSR--ILQER--------VNLAAAGRTDRGV
TRUA_OENOB      ------------ISYDGHYFEGFQTQPGSRTVQDELIKVVSKMA----------KTKIKVIGASRTDAGV
TRUA_SINMW      ------------VEYDGTDYVGWQRQDNGPSVQGAIEKALSLTGETVRVRG-----------AGRTDSGV
TRUA_MYCTU      ------------IAYDGTDFAGWAAQVGQRTVAGDLDAALTT----------IFRTPVRLRAAGRTDAGV
TRUA_MYCBO      ------------IAYDGTDFAGWAAQVGQRTVAGDLDAALTT----------IFRTPVRLRAAGRTDAGV
TRUA_LEUCK      ------------VAYDGSNFFGFQVQTKSRTVQGELNKAMAKQPV----------TPIKVVGASRTDTGV
TG124_CAEEL     ---------AIQFFYLGWEHDGLVQQPHTNTVENHIMQALIKTHLIEDW------TKCDFSRCGRTDKGV
TRUA_TREDE      ------------ISYDGTNFCGWQKQTKERTVQGELEKALTK----------IHKHPIETNGSGRTDSGV
TRUA_SYNY3      ---------ALVMQYLGTHFHGWQRQPNFSSIQEEVELAIAK----------VVGQPVTLHGAGRTDAGV
TRUA_SILPO      ---------ALKVEYLGTPFAGWQRQKDLPSVQGAIETALAR---LEPG-------PHTIAAAGRTDAGV
TRUA_RHOS1      ---------ALRIEYDGGPFAGWQRQAAQASVQGAIETAL---GRLEPG-------PHTIAAAGRTDTGV
TRUA_LACLM      ------------IAYDGTDFAGFQSQTNQRTVQEEIEKVLSKLNSFE---------PVILQGSGRTDSGV
TRUA_DESMR      ------------LAYDGTDFAGWQIQAAGRTVQGCLEEALAT----------LCGQPVRVHGAGRTDSGV
TRUA_ACTSZ      ---------ALGVEYNGKRYFGWQRQEKVLSVQEELEKALSANEKID------------LFCAGRTDSGV
TRUA_ACTPJ      ---------ALGIEYDGSRYFGWQRQDEVESVQQKLEEALSI----------VANAPIEVFCAGRTDSGV
TRUA_ACTP7      ---------ALGIEYDGSRYFGWQRQDEVESVQQKLEEALSI----------VANAPIEVFCAGRTDSGV
TRUA_ACTP2      ---------ALGIEYDGSRYFGWQRQDEVESVQQKLEEALSI----------VANAPIEVFCAGRTDSGV
TRUA_TOLAT      ---------ALGIEYFGADYYGWQRQREVNSVQQELETALSRVA--------NH--PVEIQCAGRTDAGV
TRUA_PYRAE      ----------YRIAYDGTMFYGFTGHPNSLEPRLRLIFG----EILGRGS--------------RTDPGV
TRUA_POLSJ      ---------ALGISYSGSAYEGWQSQLSGNTVQDKLESALARFA----------AQPVRTLCAGRTDAGV
TRUA_MOUSE      ------------MAYSGKGYHGMQRNLGSSTIEDDLVSALVQAGCIPENHG-TDMRKMSFQRCARTDKGV
TRUA_LACS1      -------TQRFKVAYDGTNFAGFQAQPNQRTVQFVLEKAINKMSKKDE-----YITVYG---SGRTDSGV
TRUA_DESVM      ------ARLALTVSYVGTRLAGWQIQPQPRTVQGELER------IAERIVG----APVRLHGAGRTDSGV
TRUA_CHLSY      -------TIALLLAYDGTDFAGSQWQTDIRTVQGALESAWEALTQERRR----------IVLAGRTDAGV
TRUA_CHLAA      -------TIALLLAYDGTDFAGSQWQTDIRTVQGALESAWEALTQERRR----------IVLAGRTDAGV
TRUA_BORPA      ---------ALGLAYDGSAWQGWQTQPHGVTVQDQVEAALASFA---GGGGPV-----ATVCAGRTDTGV
TRUA_BORBR      ---------ALGLAYDGSAWQGWQTQPHGVTVQDQVEAALASFA---GGGGPV-----ATVCAGRTDTGV
TRUA_AGRT5      ------------VEYDGTPYYGWQRQENGPSVQGALVRSLTGESVSIRG-------------AGRTDSGV
TRUA_SPHAL      ---------ALTIEYDGRPYMGWQRQAHGPSVQQAIEEAIHRF----------TAEEVQVLSAGRTDAGV
TRUA_RHOS4      ---------ALRIEYDGGPFAGWQRQAAQASVQGAIETAL---GRLEPG-------PHTIAAAGRTDTGV
TRUA_DELAS      ---------ALGVAYNGQRYSGWQSQLSGNTIQDHLEAALGRFA----------AQEVHTLCAGRTDAGV
TRUA_CLOCE      ------------IEYDGTNYHGWQIQKNAKTVQEVIQKALSK--LLGEDVGVT--------GCSRTDVGV
TRUA_STRSY      ------------ISYDGHDFSGFQRQPHARTVQEEIEKTLVR---LNSGQ------PVTVHGAGRTDAGV
TRUA_STRS2      ------------ISYDGHDFSGFQRQPHARTVQEEIEKTLVR---LNSGQ------PVTVHGAGRTDAGV
TRUA_ROSS1      ---------ALRIEYDGADFVGSQWQTNGRSVQGVLEAAWQQ----------LTGERRRMTLAGRTDAGV
TRUA_LEIXX      MTDQATRFR-LDIAYQGTDFAGWARQPDLRTVQGTLEEALA---TIFRCSG----EPPSLTVAGRTDAGV
TRUA_LACLS      ------------IAYDGTDFAGFQSQTNQRTVQEEIEKVLSKLNSFE---------PVILQGSGRTDSGV
TRUA_LACLA      ------------IAYDGTDFAGFQSQTNQRTVQKEIEKILTKLNSFE---------PVILQGSGRTDSGV
TRUA_HAEPS      ---------ALGIEYDGCRYCGWQRQQYVDSVQQRLEEALS---VIANSSCEVFC-------AGRTDAGV
TRUA_METNO      ------------VEYDGTAFAGWQRQAADRTVQQALEEAIER--FVNR--------PVRVHCAGRTDAGV
TRUA_HAES1      ---------ALGIEYNGTHYFGWQRQANVTSVQEKLESAVS---------FVANEFCQIY-CAGRTDSGV
TRUA_CHLAD      -------TIALLLAYDGTDFAGSQWQTDIRTVQGAIEAAWEALTQEQRR----------IVLAGRTDAGV
TRUA_BRAHW      ------------IQYDGTDFYGWQIQPNLRTVQGEIYKAVQK----------VYGEKITIYGCGRTDAGV
PUS3_HUMAN      ---------ALRIAYMGWGYQGFASQENTNTIEEKLFEALTKTRLVESRQ------TSNYHRCGRTDKGV
TRUA_RHOSK      ---------ALRIEYDGGPFAGWQRQAAQASVQGAIETAL---GRLELG-------PHTIAAAGRTDTGV
TRUA_RAT        ------------MAYSGKGYHGMQRNLGSSTIEDDLVSALVQAGCIPENHG-TDMRKMSFQRCARTDKGV
TRUA_LACAC      ------------MAYDGHLFHGFQLQPDQRTVQGTVEDALKK---------MTKGKRIIVQGSGRTDAGV
TRUA_HUMAN      ------------MAYSGKGYHGMQRNVGSSTIEDDLVSALVRSGCIPENHGED-MRKMSFQRCARTDKGV
TRUA_BRUSU      ------------VEYDGTPYVGWQRQENGHAVQGAIEQAFKKF----CGEDLT------LSAAGRTDAGV
TRUA_BRUSI      ------------VEYDGTPYVGWQRQENGHAVQGAIEQAFKKF----CGEDLT------LSAAGRTDAGV
TRUA_BRUO2      ------------VEYDGTPYVGWQRQENGHAVQGAIEQAFKKF----CGEDLT------LSAAGRTDAGV
TRUA_BRUME      ------------VEYDGTPYVGWQRQENGHAVQGAIEQAFKKF----CGEDLT------LSAAGRTDAGV
TRUA_BRUMB      ------------VEYDGTPYVGWQRQENGHAVQGAIEQAFKKF----CGEDLT------LSAAGRTDAGV
TRUA_BRUC2      ------------VEYDGTPYVGWQRQENGHAVQGAIEQAFKKF----CGEDLT------LSAAGRTDAGV
TRUA_BRUAB      ------------VEYDGTPYVGWQRQENGHAVQGAIEQAFKKF----CGEDLT------LSAAGRTDAGV
TRUA_BRUA2      ------------VEYDGTPYVGWQRQENGHAVQGAIEQAFKKF----CGEDLT------LSAAGRTDAGV
TRUA_STRCO      ------------LSYDGSEFSGWAKQAGGRTVQGEIEDALRT---VTRSRETYELT-----VAGRTDAGV
TRUA_MARMM      ------------IEYDGRPFSGWQRQDNAPSVQESLERAAEK---LD-------GAPVLVYGAGRTDSGV
TRUA_JANMA      ------------VQYDGTPWQGWQTQLNGLTVQDRLEFALSKFTL------QTVST----VCAGRTDAGV
TRUA_AGRVS      ------------VEYDGTPYVGWQRQDNGPSVQGALEAAVL---------GLTGET-VAIRGAGRTDSGV
TRUA_ROSCS      ---------ALRIEYDGTDFVGSQWQTNGRSVQGALEAAWQQ----------LTGERRRMILAGRTDAGV
TRUA_RHOP5      ------------IEYDGTPYCGWQIQENGPSIQGALAKAICGEAIRVRG-------------AGRTDAGV
TRUA_RHISN      ------------VEYDGSDYVGWQRQENGPSVQGAIEKALTGETVSIRG-------------AGRTDSGV
TRUA_PARL1      ------------IEYDGSPFVGWQAQTNGRSVQQ----------VLEEGIKGFCGQELKIFGAGRTDAGV
TRUA_ONYPE      ------------LSYDGTCYYGYQKQPQKITVQQTFEKALKK---------MTHQNIPTFAAS-RTDKGV
TRUA_METPP      ---------ALGLSYRGGAYRGWQSQPDGLTVQDRVEEALAR--FADR--------PVRTVCAGRTDAGV
TRUA_LYSSC      ------------ISYDGTHFSGYQVQPGERTVQAEIERVLA---IMHKEE------KVKVTASGRTDARV
TRUA_FRASC      MTDGLVRLR-LDLSYDGTPFAGWARQPGQRTVQGDVEDALMRVARL---------PAVRLTVAGRTDSGV
TRUA_CYAP8      ---------ALVIQYLGSRFHGWQWQPNQRTVQAEIENAIAE--VL--GETVT------LHGAGRTDAGV
TRUA_AZOSE      ------------VEYAGSAFEGFQSQAHGRTVQDHLEAAI----------GHIAAHPVRLHCAGRTDAGV
TRUA_DINSH      ---------ALKIEYDGAPFAGWQRQREQPSVQGAVEAAL-------RGLQPDHA---GIAAAGRTDAGV
TRUA_BLOFL      ------------VEYDGSMYCGWQKQKCVSSIQSCLEYALSK----------VSSESILVFCGGRTDSGV
TRUA_ANAMF      ------------VEYDGTAFIGWQRQKGVASIEDAIYRLSQQHVTV--------------FAAGRTDAGV
TRUA_ACIAC      ---------ALGVSYNGSAYRGWQSQPGGATVQDRLEAALARFA--------THEV--STICAGRTDAGV
TRUA_XYLFT      ---------ALGVEYDGSEFLGWQQLGEGPSVQATLQQALAS--VAD--------SSVRVVCAGRTDAGV
TRUA_XYLF2      ---------ALGVEYDGSEFLGWQQLGEGPSVQATLQQALAS--VAD--------SSVRVVCAGRTDAGV
TRUA_SHEPA      ---------ALGIEYDGSQYFGWQRQAEVDTVQERLEKALS----------IVANEPIAVHCAGRTDAGV
TRUA_SHEHH      ---------ALGIEYDGSQYFGWQRQAEVDTVQERLEKALS----------IVANEPIAVQCAGRTDAGV
TRUA_PYRCJ      ----------YRVAYDGALFHGFTG--HSNSVEAALRRVFGH--LLGRGS--------------RTDPGV
TRUA_PORG3      ------------LAYNGTRYSGWQTQPNAPSVQQTVEEAIST----------IVRQPVGVVGAGRTDAGV
TRUA_ERWCT      ---------ALGIEYDGSQYYGWQRQIDVASVQACLEKALSK--VADE--------PIEVLCAGRTDAGV
PUS3_BOVIN      ---------ALKIAYLGWGYQGFASQENTSTIEEKLFEALTKTRLVE------NRQTSNYHRCGRTDKGV
TRUA_VEREI      ---------ALGISYNGQAYCGWQSQPSVRTVQDALEAALGRFA--------TH--PVSTLCAGRTDAGV
TRUA_PELPD      ------------IEYDGTNYAGWQVQPN----------GLAVQQXXXXXXXXXXXXXXXXXXXXXTDAGV
TRUA_LEUMM      ------------IAYDGAEFFGFQLQESVRTVQGELNKVINK---MAKNPSPQIKV----VGASRTDTGV
TRUA_RHIME      ------------VEYDGSDYVGWQRQDNGPSVQGAIEKALTRETVSIRG-------------AGRTDSGV
TRUA_LAWIP      ----------FTLAYVGTAYHGWQTQPELPTIQSTLEKVIAS--IIGK--------PVRVCGAGRTDAGV
TRUA_DESDG      ------------IAYAGTRYAGWQIQPHAVQ-QPTVQQAVAAKAIL--------GSAVRVHGAGRTDSGV
TRUA_BIFLO      ------------LAYDGGGFYGWAKQPNLRTVQGTIEDAL--HKVL-RVPTDDAAEPLRLTVAGRTDTGV
TRUA_BIFLD      ------------LAYDGGGFYGWAKQPNLRTVQGTIEDAL--HKVL-RVPTDDAAEPLRLTVAGRTDTGV
TRUA_THEYD      ------------IQYDGTNYFGWQRQRKGRTIQATILRKIFQREIKIRG-------------AGRTDAGV
TRUA_STRT2      ------------ISYDGTLFSGFQRQPNARSIQEEIEKTLLR---LNSG------TPVTVHGAGRTDAGV
TRUA_STRT1      ------------ISYDGTLFSGFQRQPNARSIQEEIEKTLLR---LNSG------TPVTVHGAGRTDAGV
TRUA_STRP3      ------------ISYDGTLFSGFQRQRHLRTVQEEIEKTLYK---LNNG------TKIIIHGAGRTDAGV
TRUA_CLOTH      ------------IEYDGTNYHGWQKQKNAKTVQDTIERAI---------KGLT-GEKVDLIGASRTDFGV
TRUA_CHLMU      -----------RIAYQGTAYSGWQYQPNALSIQEVLETLLQK----------ISRTRISVIASGRTDAGV
TRUA_ALISL      ---------ALCIEYDGASYHGWQSQKDVTSVQEELEKALM----------VVANEPIEVMCAGRTDAGV
YL85_SCHPO      ---------AFKFAYCGWNYNGLAYQLEPTTVEGKVFEALLRAHLI------TDPSSCSFSRCGRTDKGV
TRUA_SYNP6      ---------ALVIQYLGQGFCGWQRQPRQRSVQGELESAIA----------AVVGHPVSVQSAGRTDTGV
TRUA_PARD8      ------------LGYNGKNFRGWQIQPNGMTVQQSIEEALA---ILMR-------TPVPIVGAGRTDAGV
TRUA_NITHX      ------------IEYDGGPFCGWQYQDNGPSVQGALVKAICGDAVRVHG-------------AGRTDAGV
TRUA_MESSB      ------------IEYDGGPYAGWQRQAGQHSVQEAIEKAIAAFS----GEEVT------IRGAGRTDAGV
TRUA_LEPBP      ---------ALLVEYDGTHFNGWQKQKNLPTVQSSIESAL---GIILRRNPASRLS-----VAGRTDTGV
TRUA_LEPBA      ---------ALLVEYDGTHFNGWQKQKNLPTVQSSIESAL---GIILRRNPASRLS-----VAGRTDTGV
TRUA_DECAR      ---------ALGIEYCGTGFHGWQSQAGGGTVQDALEAAL----------GEVAGVPVGVLCAGRTDAGV
TRUA_ZYMMO      ------------VEFDGRNFMGWQRQKHGATIQGSIEEAGAS----------IAGQPTPVQAAGRTDAGV
TRUA_XYLFA      ---------ALGVEYDGSEFLGWQQLGEGPSVQATLQQALASVA-----DASVRVV-----CAGRTDAGV
TRUA_VIBFM      ---------ALCIEYDGAEYYGWQRQRDVNSVQEELEKALT---IVANEPIEVH-------CAGRTDAGV
TRUA_VIBF1      ---------ALCIEYDGAEYYGWQRQRDVNSVQEELEKALT---IVANEPIEVH-------CAGRTDAGV
TRUA_STRS7      ------------ISYDGTLFSGFQRQSQARTVQEEIEKTLQK---LTGGQGIQ------IHGAGRTDAGV
TRUA_PSYIN      ---------ALGIEYDGAAYYGWQRQKEVISVQQELEQSLSKIA--------NHTVR--VHCAGRTDSGV
TRUA_OLICO      ------------IEYDGTPFCGWQYQDNGPSVQGALEDAVA-------ALAGTHVRVHG---AGRTDAGV
TRUA_MAGSA      ------------VEYDGTPFNGWQRQDKGLSVQGILEKAVEK----------LCGVPCTLHAAGRTDAGV
TRUA_LACDB      ------------LSYDGHDFHGFQSQPGQRTIQGTVEEILKQ---------MTKGQEVRVFGSGRTDAGV
TRUA_ACISJ      ---------ALGVSYNGQAYNGWQSQPSANTVQDRLEAALGRFATQE-----VHT-----ICAGRTDAGV
TRUA_SYNP2      MSQANPRKRALVIQYIGTHFCGWQRQTAERTVQAVIISTVVGQKITIHG-------------AGRTDSGV
TRUA_STRE4      ------------ISYDGTLFSGFQRQSQARTVQEEIEKTLQK---LTGGQGIQ------IHGAGRTDAGV
TRUA_RHILO      ------------IEYDGSLFAGWQHQADQPSVQQAIEQAIEKFC----------GEAVRLRAAGRTDAGV
TRUA_GLUOX      ---------ALRIEYDGTGYLGWQKQNDGTSIQG-LIEAAASKLVRNR--------PVPSITAGRTDAGV
TRUA_BLOPB      ---------ALGIEYDGSWYCGWQRQRDAPSIQSYIENAIKK----------ITSESVTVFCAGRTDSGV
TRUA_ANAMM      ------------VEYDGTAFIGWQRQ---KGVAGRSVQESIEDAIYRLSQQCVTV-----FAAGRTDAGV
TRUA_XYLFM      ---------ALGVEYDGSEFLGWQQLGEGPSVQATLQQALASVA-----DASVRVV-----CAGRTDAGV
TRUA_STRPZ      ------------ISYDGTLFSGFQRQRHLRTVQEEIEKTLYK---LNNG------TKIIIHGAGRTDAGV
TRUA_STRPM      ------------ISYDGTLFSGFQRQRHLRTVQEEIEKTLYK---LNNG------TKIIIHGAGRTDAGV
TRUA_STRPG      ------------ISYDGTLFSGFQRQRHLRTVQEEIEKTLYK---LNNG------TKIIIHGAGRTDAGV
TRUA_STRPF      ------------ISYDGTLFSGFQRQRHLRTVQEEIEKTLYK---LNNG------TKIIIHGAGRTDAGV
TRUA_STRPD      ------------ISYDGTLFSGFQRQRHLRTVQEEIEKTLYK---LNNG------TKIIIHGAGRTDAGV
TRUA_STRPC      ------------ISYDGTLFSGFQRQRHLRTVQEEIEKTLYK---LNNG------TKIIIHGAGRTDAGV
TRUA_STRPB      ------------ISYDGTLFSGFQRQRHLRTVQEEIEKTLYK---LNNG------TKIIIHGAGRTDAGV
TRUA_STRP8      ------------ISYDGTLFSGFQRQRHLRTVQEEIEKTLYK---LNNG------TKIIIHGAGRTDAGV
TRUA_STRP6      ------------ISYDGTLFSGFQRQRHLRTVQEEIEKTLYK---LNNG------TKIIIHGAGRTDAGV
TRUA_STRP1      ------------ISYDGTLFSGFQRQRHLRTVQEEIEKTLYK---LNNG------TKIIIHGAGRTDAGV
TRUA_MYCPA      -------------------------------------------GVLDEALTTVFRTPVRLRAAGRTDAGV
TRUA_CHLFF      ------------LAYQGTAYAGWQRQPNDLSIQEVIESALAR--VLGK--------PIVVSSSGRTDSGV
TRUA_RHOFD      ---------ALGVSYNGQAYQGWQSQLSRQTVQDQLEMALSKLA--------SHRV--STLCAGRTDAGV
TRUA_NITWN      ------------IEYDGGPFCGWQYQTNGPSVQGALEAAVK---AICGDDVRVH-------GAGRTDAGV
TRUA_METRJ      ------------IEYDGSPFCGWQRQADDPTVQGAIEAAVTRFS----GENAR------LTCAGRTDAGV
TRUA_METJA      -----------KIAYDGRY--SFQQQPHKQTVCDILLDALEETGFL--------AKKKVIYSGGRTDKGV
TRUA_XANP2      ------------IEYDGTPYAGWQIQADQQTVQGALAQAFKRFCGED-----VHV-----AGAGRTDAGV
TRUA_STRA1      -----------QISYDGSAFSGFQRQPNCRTVQEEIERTLKR---LNSGNDVI------IHGAGRTDAGV
TRUA_POLNS      ---------ALGLQYDGSPYSGWQTQVNHNTVQNELEKAISAF----VGEQACVVKPINTITAGRTDTGV
TRUA_PETMO      ---------AATVMYDGSNFYGYQSQPTFRTVQDEFEKALK---VIFKKEIPSY-------ACGRTDTGV
TRUA_AZOPC      ------------LAYNGRNYCGWQIQPNGITVQQRIQQCLS---ILLR-------KSVTIIGAGRTDAGV
TRUA_WOLSU      --------------YDGSAFFGSQIQKEEPSVALALQRGLKSMGIASK-----------VRFSGRTDRGV
TRUA_STRTD      ------------ISYDGTLFSGFQRQPNARSIQEEIEKTLLR---LNSG------IPVTVHGAGRTDAGV
TRUA_STRA3      -----------QISYDGSAFSGFQRQPNCRTVQEEIERTLKR---LNSGNDVI------IHGAGRTDAGV
TRUA_SILST      ---------ALKVEYHGKPFAGWQRQKDQPSVQGAIEAALAR---IEPGEHT-------IAAAGRTDTGV
TRUA_RHOCS      --------------YDGRPFVGWQRQDNGPSVQQALEEAIYRF---------TQETVTVF-CAGRTDAGV
TRUA_BUCAT      MVAKNVKTFALGVEYDGSYYHGWQRQKIVPSIQEEIEKALANHKI-------------DVVCAGRTDAGV
TRUA_BUCA5      MVAKNVKTFALGVEYDGSYYHGWQRQKIVPSIQEEIEKALANHKI-------------DVVCAGRTDAGV
TRUA_BACTN      ------------LAYDGTNYHGWQIQPNGSSVQECLMKALSTFLRRD----------VEVIGAGRTDAGV
TRUA_RHOS5      ---------ALKIEYDGAPFAGWQRQAVLPSVQGAIEAAL---GRLEPG-------PHTIAAAGRTDTGV
TRUA_RHILW      ------------VEYDGGPYVGWQRQENGPSVQGAIVLSLTGETVSIRG-------------AGRTDSGV
TRUA_LACJO      ------------MAYDGHLFHGFQIQPNQRTVQGVIEEALKK---------MTKGKRVVVHGSGRTDAGV
TRUA_DICT6      ------------LSYIGKDFWGFQKQPGKRTVQGELEKVLK---LLFDEDIKV-------IGAGRTDAGV
TRUA_CORDI      ------------LAYDGTDFHGWARQGDSDLIEDTLTLVLQR--------------PIDLTVAGRTDAGV
TRUA_CHLCH      ------------IEYDGTDFAGWQRQSGTITVQGTLLSQITQEEVLLNG-------------AGRTDKGV
TRUA_CAUSK      ------------IEYDGRPYNGFQAQASQPSVQGAIEAAVKAF------TGQTIR----IAAAGRTDTGV
TRUA_BUCAI      MVAKNVKTFALGVEYDGSYYHGWQRQKILPSIQEEIEKALANHKI-------------DVVCAGRTDAGV
TRUA_BIFA0      ------------LAYNGAAFHGWAAQPGCRTVQGTVEEALRR--ITRMPD----AGSLRLTVAGRTDAGV
TRUA2_PARUW     -----------KIAYDGQAYFGWQKTPAGPSVEKTLLEQILQHTI-------------SLQAASRTDKGV
PUS3_MOUSE      ---------ALKIAYLGWGYQGFASQENTSTIEEKLFEALTKTRLVESRQ------TSNYHRCGRTDKGV
TRUA_DIAST      ---------ALGVSYNGQAYNGWQSQPSGNTVQDRLEAALGRFATQE-----VHT-----ICAGRTDAGV
TRUA_CAMFF      ---------ALTYSYNGSKFKGSQTQPDKNAVEDCLNFALNRVGIFKP-----------VVSSSRTDKGV
TRUA2_DESPS     -----------KIAYKGTHYFGWQAQSIDTTVEGTILNALKKI---------TNYQPCTVSGASRTDGGV
TRUA2_CLOPE     ------------IEYDGTSYFGWQKQPIGNTIQQKVEEAIKK----------VTKEEVEILGSSRTDSGV
TRUA_UREPA      --------------YDGSLFYGWARQPQKRTVQGDLFKSIFKINNI------------RIIGSGRTDKGV
TRUA_UREP2      --------------YDGSLFYGWARQPQKRTVQGDLFKSIFKINNI------------RIIGSGRTDKGV
TRUA_STACT      -----------KISYQGSNFLGFQIQQHGRTVQQQFEKILKR----------MHKRHVRIHPSSRTDRGV
TRUA_SHEFN      ---------ALGIEYDGSSFCGWQRQLEVDSVQAQIEKALSY----------VANEPITVSCAGRTDTGV
TRUA_PHYMT      ------------LSYDGTNYYGFQKQLHLNTIQSVLENVLNK---------ITKQKKIKIYGASRTDKGV
TRUA_OCHA4      ------------VEYDGTPYVGWQRQENGHAVQNAIELAFKKFC----GEDLT------LSAAGRTDAGV
TRUA_COXBR      ---------ALGIRYDGSAYHGWQVQEALKTVQGEVLSAVANH-------------PVFVTCAGRTDAGV
TRUA_COXBN      ---------ALGIRYDGSAYHGWQVQEALKTVQGEVLSAVANH-------------PVFVTCAGRTDAGV
TRUA_COXB2      ---------ALGIRYDGSAYHGWQVQEALKTVQGEVLSAVANH-------------PVFVTCAGRTDAGV
TRUA_COXB1      ---------ALGIRYDGSAYHGWQVQEALKTVQGEVLSAVANH-------------PVFVTCAGRTDAGV
TRUA_BRAJA      ------------IEYDGAPFFGWQVQDTLPSVQGALEAAVKA---MTGADLRVHG-------AGRTDAGV
TRUA_ACIBY      ---------AVGIEFSGIQYRGWQQQPGVASVQETIERVLSK--IADE--------PITLHGAGRTDAGV
TRUA_ACIBT      ---------AVGIEFSGIQYRGWQQQPGVASVQETIERVLSK--IADE--------PITLHGAGRTDAGV
TRUA_ACIBS      ---------AVGIEFSGIQYRGWQQQPGVASVQETIERVLSK--IADE--------PITLHGAGRTDAGV
TRUA_ACIB5      ---------AVGIEFSGIQYRGWQQQPGVASVQETIERVLSK--IADE--------PITLHGAGRTDAGV
TRUA_ACIB3      ---------AVGIEFSGIQYRGWQQQPGVASVQETIERVLSK--IADE--------PITLHGAGRTDAGV
TRUA_STRA5      -----------QISYDGSAFSGFQRQPNCRTVQEEIERTLKR---LNSGNDVI------IHGAGRTDVGV
TRUA_HYPNA      ------------IEYNGGPYQGWMRLPGLQTVQGALEAAAAQ---LDGG-------PVEVTGAGRTDAGV
PUS1_ASHGO      ---------AVMVGYCGTGYHGMQYNPPNRTIEAELFEAFVKAGAISRANS-TDLKKNGFMRAARTDKGV
TRUA_CHLPN      ---------ALLIAYQGTAYSGWQQQPNDLSIQEVIESSLKK----------ITKTRTPLIASGRTDAGV
PUSH_ARATH      -----------RIGYVGTDYRGLQIQPSIKTIEGELEVAIYKAGIRDSNYGDLHKI--GWARSSRTDKGV
TRUA_HAES2      ---------ALGIEYNGTHYFGWQRQANVTSVQEKLESAVS---------FVANEFCQIY-CAGRTDSGV
TRUA_COREF      --------------YDGTDFHGWARQGDSD------LRTVQK--VLEDNLGMVLRAPVELTVAGRTDAGV
TRUA_TROWT      ------------VAYDGANFCGWAPQPGLRTVGGLILDALRL----------ICSEPPDIVVAARTDAGV
TRUA_PROAC      ------------IAYDGANFSGWATQPDRRTVQGELETWIPR---VLRLDQPTPLT-----VAGRTDAGV
TRUA_MYXXA      --------------YEGTRYVGWQVQPNGPSIQS----------VLESGLERLLGARVSVASAGRTDAGV
TRUA_HELPJ      ------------VAYDGAYFLGYAKQPNKLGVQDKIESALNALGIKS-----------GVIAAGRTDKGV
TRUA_TROW8      ------------VAYDGANFCGWAPQPGLRTVGGLILDALRL----------ICSEPPDIVIAARTDAGV
TRUA_RICPR      ------------IEYLGTHFAGWQRQAGVLSVQQILEEAIYKFS----------SEQVTLFGSGRTDAGV
TRUA_CAUCR      ------------VEYDGRPYAGFQAQATLPSVQGAIEAAVKAF----------CGQEVRIAAAGRTDTGV
TRUA_CAUCN      ------------VEYDGRPYAGFQAQATLPSVQGAIEAAVKAF----------CGQEVRIAAAGRTDTGV
TRUA_BUCAP      ---------ALGVEYDGSYYHGWQSQKGLSTIQSEIEKALSKIA--------NHQV--NVICAGRTDSGV
TRUA_BRASO      ------------IEYDGAPFCGWQLQETLPSVQGVLEAAVQA----------TCGVPTRVHGSGRTDAGV
TRUA2_CLOTE     -----------KVEYDGTNYSGWQKQKNIKTIQSSXXXXXXXXXXXXXX----------LIGSSRTDAGV
TRUA_STAAT      ------------IAYQGNNFLGFQIQQNGRTVQQQFEKLLQR----------MHKRHVRIHPSSRTDRGV
TRUA_STAAE      ------------IAYQGNNFLGFQIQQNGRTVQQQFEKLLQR----------MHKRHVRIHPSSRTDRGV
TRUA_STAAC      ------------IAYQGNNFLGFQIQQNGRTVQQQFEKLLQR----------MHKRHVRIHPSSRTDRGV
TRUA_STAA8      ------------IAYQGNNFLGFQIQQNGRTVQQQFEKLLQR----------MHKRHVRIHPSSRTDRGV
TRUA_STAA3      ------------IAYQGNNFLGFQIQQNGRTVQQQFEKLLQR----------MHKRHVRIHPSSRTDRGV
TRUA_METSB      ------------IEYDGAPFVGWQRQANGFSVQEAIETAL----------GGFTGESVAIHGAGRTDAGV
TRUA_CHLAB      ------------LAYQGTAYAGWQRQPNDLSIQEVIENSLAQ--VVGKRIPVT--------SSGRTDAEV
TRUA_ACICJ      ---------ALRLEYDGRGFVGWQRQENGLSVQEVLETAASR---LCGGDVPDSVV------AGRTDAGV
TRUA_RHOPB      ------------IEYDGAPYCGWQIQDNGPSVQGALETAVAICGKFVRVNG-----------AGRTDAGV
TRUA_METS4      ------------VEYDGSGFAGWQRQAADRTVQQALEEAIARFA----------GAPVRVHCAGRTDAGV
TRUA_FUSNN      --------------YDGSSYYGFQRQPNKITVQGEILRIVTKEEI-------------NLISAGRTDRGV
TRUA_ACIBC      ---------AVGIEFSGIQYRGWQQQPGVASVQETIELVLSK--IADE--------PITLHGAGRTDAGV
TRUA_POLNA      ---------ALGISYSGSAYEGWQSQLSGKTVQDKLELALSRFAV----------QPIRVMCAGRTDAGV
TRUA_BACFR      ------------LAYDGTHYHGWQIQPNGISIQECLMKALATFLRKD----------TEVIGAGRTDAGV
TRUA_BACFN      ------------LAYDGTHYHGWQIQPNGISIQECLMKALATFLRKD----------TEVIGAGRTDAGV
TRUA_ANASP      ---------ALVVQYLGTHFHGWQRQKQHRTVQEEIETAIAK--ILGH-----HVTLHG---AGRTDSGV
PUS1_YARLI      ---------ACMIGYCGTGYHGMQLNPPQKTIEGDIFQAFVKAGAINNADDPKKS---AFMRAARTDKGV
TRUA_METC4      ------------IEYDGAPFRGWQRQADDPTVQAAIETAVT------RFSGET----ARLTCAGRTDAGV
TRUA_ACIAD      ---------AVGIEFCGIRYRGWQQQAGVPSIQETIEKVLSK--IADE--------PIILHGAGRTDAGV
TRUA_DICTD      ------------ISYIGKDFYGFQKQPGKRTIQGELEKVLS--FLFDE--------EIRVIGAGRTDTGV
TRUA_WOLWR      ------------VEYNGSSFSGWQKQQHANSIQEKIENAIFNFS------GEKIALYCG----GRTDAGV
TRUA_THIDA      ---------AVGLEYRGVGFCGWQSQPQACGVQDAVEKAVSAIA----GEAIT------VTAAGRTDTGV
TRUA_MYCLE      ------------IAYDGTDFAGWAVQAGQRTVAG-----------LDEAFTTVFRTPVRLRAAGRTDTGV
TRUA_METM6      ----------FKIAYDGR--LSFQTQPHGETVCDKISNALLDCGYLDNKD-----RVPLY-HGGRTDRGV
TRUA_HELPG      ------------IAYDGAYFLGYAKQPNKLGVQDKIESALNALGIKSV-----------VVAAGRTDKGV
TRUA_HELHP      ------------IAYDGSVFSGFQKDKRLKSVLGTLKEGFARVGIKSDIIG-----------AGRTDKGV
TRUA2_BACC1     ------------IQYDGARFKGWQRLGNNNTIQGKIESVISE----------MVGKETEIIGCSRTDAGV
TRUA_THEAC      ---------AFKFGYEGSYFTGFQRGNGDHSVEDTIIDTLKASGF-------------DYAAAARTDRYV
TRUA_STRM5      ---------ALGVEYDGSDFRGWQNLGEGPSVQASLEQALSS--VAD--------TPLQVVCAGRTDAGV
TRUA_LEGPL      ---------ALVVEYDGSQYHGWQAQTGLHTIQQAVEFALSK--VAD--------SSISVVCAGRTDTGV
TRUA_BRASB      ------------IEYDGTPFCGWQLQETLPSVQGALEAAVQA----------TCGVPTRVHGSGRTDAGV
TRUA_BEII9      ------------VEYDGASFVGWQRQKNGLSVQEVIETALLA----------INGAPVGIRGAGRTDAGV
TRUA_STREM      ------------ISYDGTLFSGFQRQSQARTVQEEIEKTLQK---------LTXXXXXXXXXXXXTDAGV
TRUA_STAAR      ------------IAYQGNNFLGFQIQQNGRTVQQQFEKLLQR----------IHKRHVRIHPSSRTDRGV
TRUA_MYCPN      ------------VAYNGAPFRGWAKQPGYHTVQGQIEQNLAL----------IYQTPINIYGSGRTDKGV
TRUA_HELP2      ------------IAYDGAYFLGYAKQPNKLGVQDKIESALNALGIKS-----------AVIAAGRTDKGV
TRUA_BARHE      --------------YDGSNYAGWQRQAELRTIQSALEQALFHFS----GQQLTITT------AGRTDAGV
TRUA_BARBK      --------------YDGSNYAGWQRQAELRTVQGAVEQAIFHFS----GQQLTITT------AGRTDAGV
PUS1_YEAST      ---------AVMVGYCGTGYHGMQYNPPNPTIESALFKAFVEAGAISK-DNSNDLKKNGFMRAARTDKGV
TRUA_WOLPM      ------------VEYNGSNFSGWQKQQHANSIQEKIENAIFNFS----GEKVT------LYCGGRTDAGV
TRUA_STAAW      ------------IAYQGNNFLGFQIQQNGRTVQQQFEKLLQR----------MHKRHVRIHPSSRTDRGV
TRUA_STAAS      ------------IAYQGNNFLGFQIQQNGRTVQQQFEKLLQR----------MHKRHVRIHPSSRTDRGV
TRUA_STAAN      ------------IAYQGNNFLGFQIQQNGRTVQQQFEKLLQR----------MHKRHVRIHPSSRTDRGV
TRUA_STAAM      ------------IAYQGNNFLGFQIQQNGRTVQQQFEKLLQR----------MHKRHVRIHPSSRTDRGV
TRUA_STAA9      ------------IAYQGNNFLGFQIQQNGRTVQQQFEKLLQR----------MHKRHVRIHPSSRTDRGV
TRUA_STAA2      ------------IAYQGNNFLGFQIQQNGRTVQQQFEKLLQR----------MHKRHVRIHPSSRTDRGV
TRUA_STAA1      ------------IAYQGNNFLGFQIQQNGRTVQQQFEKLLQR----------MHKRHVRIHPSSRTDRGV
TRUA_SPHWW      ------------VEFDGRPFMGWQRQAHGPSVQQAIEEAIT----------AVTGERAVIHAAGRTDARV
TRUA_RICPU      ------------IEYLGTDLAGWQRQAGVMSVQQILEEAIYKFS----------GEQVILFGSGRTDAGV
TRUA_METPB      ------------IEYDGGPFCGWQRQADDPTVQAAIETAVT------RFSGET----ARLTCAGRTDAGV
TRUA_LEGPH      ---------ALVVEYDGSQYHGWQAQTGLHTIQQAVEFALSK--VAD--------SSISVVCAGRTDTGV
TRUA_LEGPC      ---------ALVVEYDGSQYHGWQAQTGLHTIQQAVEFALSK--VAD--------SSISVVCAGRTDTGV
TRUA_LEGPA      ---------ALVVEYDGSQYHGWQAQTGLHTIQQAVEFALSK--VAD--------SSISVVCAGRTDTGV
TRUA_BORT9      -----------KITYDGSLYYGFQIQPKKPTIQGEIEKVLEK----------ISKTKIKIHSAGRTDKGV
PUS1_KLULA      ---------AVMIGYCGTGYHGMQYNPPNDTIEKELFEAFVRAGAISKANS-TDLKKNGFQRAARTDKGV
TRUA_XANCP      ---------ALGVEYDGSEFQGWQQEHGGPSVQATLQAALSSVA-----DAPIQVV-----CAGRTDAGV
TRUA_XANCB      ---------ALGVEYDGSEFQGWQQEHGGPSVQATLQAALSSVA-----DAPIQVV-----CAGRTDAGV
TRUA_XANC8      ---------ALGVEYDGSEFQGWQQEHGGPSVQATLQAALSSVA-----DAPIQVV-----CAGRTDAGV
TRUA_STRU0      ------------ISYDGSQFQGFQRQSHARSVQEEIEKTLTK---------LTNGKEIKVHGAGRTDSGV
TRUA_HELPH      ------------IAYDGAYFLGYAKQPNKLGVQDKIENALNTLGIKSV-----------VVAAGRTDKGV
TRUA_BORRA      ------------IAYDGSLYHGFQIQPTKPTIQGEIEKALEK----------INKTKVKIQSAGRTDKGV
TRUA_BORDL      ------------IAYDGSLYHGFQIQPTKPTIQGEIEKALEK----------INKTKVKIQSAGRTDKGV
TRUA_WOLPP      ------------IEYNGSSFSGWQKQQHANSIQETIENAIFNFS----------GERVSLHCGGRTDTGV
TRUA_STAAB      ------------IAYQGNNFLGFQIQQNGRTVQQQFEKLLQR----------MHKRHVRIHPSSRTDRGV
TRUA_RICTY      ------------IEYLGTHFSGWQRQAGVLSVQQILEEAIYKFS----GEQVT------LFGSGRTDAGV
TRUA_METEP      ------------IEYDGAPFRGWQRQADDPTVQAAIETAVT------RFSGET----ARLTCAGRTDAGV
TRUA_CLOBB      ------------IEFDGTNFCGWQRQIKDRTVQGCLEKAILKI------TGEKSLT----NGSSRTDGGV
TRUA1_CLOPE     --------------YDGSKYKGWQKQSNVSTVQDKLEKVLTK----------MTSEEIQLIGCGRTDSGV
PUS1_SCHPO      ------------VGYCGSGYHGMQLNPPSKTIEGDLFDAFVKAGAVSNADDPKKV---ALARAARTDKGV
TRUA_RHOPA      ------------IEYDGAPFCGWQLQPALPSVQGALAAALATCGEAVRVHG-----------AGRTDAGV
TRUA_HYDS0      ----------FTISFVGTNYSGWQYQPNVPTIQNEVEEKL--YYIVNKKKPIKQKIRA--IGCSRTDKGV
TRUA_EHRRG      ------------IEYDGSNFIGWQKQNHSNSIQEILEKAIFKFS-------KQHVTVYG---AGRTDAGV
TRUA_EHRCJ      ------------IEYNGSNFIGWQRQKHSNSIQEILEEAIFK---FSRESVTTYV-------AGRTDAGV
TRUA2_BACCZ     ------------IQYDGARFKGWQRLGNNNTIQGKIESVISE----------MIGKEIEIIGCSRTDAGV
TRUA_THETN      ------------IEYDGTNYHGWQYQKNAITVQEVLEKAIEK----------VTGEKVNLIGSSRTDTGV
TRUA_HELPY      ------------IAYDGAYFLGYAKQPNKLGVQDKIEDALNALGIKSV-----------VIAAGRTDKGV
TRUA_ERYLH      ---------ALTLEFDGTPFMGLQRQKHGPSVQQAVEEAA--RATLNQ-DITLHS-------AGRTDTGV
TRUA_CLOB8      ------------IEFDGSNFCGWQRQPKGRTIQKVIETAIFKEEIMING-------------SSRTDAGV
TRUA_BORHD      ------------IAYDGSLYYGFQIQPTKPTIQGEIEKALEK----------ISKTKVKVHSAGRTDKGV
TRUA_AYWBP      ------------LSYDGTFYCGYXXXXXXXXXXXXFEKALKKM---------THQNIPTFAAS-RTDKGV
TRUA_AQUAE      -----------RLAFVGTNFYGWQVQPNLRTVQGEIQKALSQ--ILCEDVKVT--------GCCRTDSGV
TRUA2_BACCR     ------------IQYDGARFKGWQRLGNNNTIQGKIESVISE----------MVGKEIEIIGCSRTDAGV
PUSL1_MOUSE     --------------------------------------------------------PVRFTISSRTDAGV
TRUA_STRMK      ---------ALGVEYDGSDFRGWQNLGEGPSVQASLEQALSS--VAD--------TPLQVVCAGRTDAGV
TRUA_RICAH      ------------IEYLGTNLAGWQRQAGVMSVQQILEEAIYKFS----------GEQVILFGSGRTDAGV
TRUA_CLOAB      --------------YDGTNYCGWQKQKNVVTVQXXXXXXXXXXXXXXXD----------VIGCSRTDSGV
TRUA_UREU1      ------------IRYDGSLFYGWAKQPQKRTVQETVFKTIFKINDIK------------IIGSGRTDRGV
TRUA_EHRRW      ------------IEYDGSDFIGWQKQNHSNSIQEILEKAIFKFS-------KQHVIVYG---AGRTDAGV
TRUA_EHRCR      ------------IEYNGSNFIGWQKQKHSSSIQEILENAILKFS-------QQHTT---VYVAGRTDAGV
TRUA_CLOBA      ------------IEFDGTNFCGWQRQVKDRTVQGCLENAILKI------TGEKSLT----NGSSRTDGGV
TRUA2_BACAN     ------------IQYDGARFKGWQRLGNNNTIQGKIESVISE----------MVGKETEIIGCSRTDAGV
TRUA2_BACHK     ------------IQYDGARFKGWQRLGNNNTIQGKIESVISE----------MVGKETEIIGCSRTDAGV
TRUA_BART1      --------------YDGSNYAGWQRQAKLHTIQGALEQAIFRFS----GQQLTITT------AGRTDAGV
TRUA_BARQU      --------------YDGSNYAGWQRQAELHTIQSALEQAIFHFS----GQQLTTTT------AGRTDAGV
TRUA_WIGBR      ------------ISYQGNNYCGWQSQKNIISIQEYVELALFKFS----------GEKIKIYCAGRTDAKV
TRUA_STAES      ------------IAYQGNQFLGFXXXXXXXXXXXXILKRMHKHHVRIH-------------PSSRTDRGV
TRUA_STAEQ      ------------IAYQGNQFLGFXXXXXXXXXXXXILKRMHKHHVRIH-------------PSSRTDRGV
TRUA_SALRD      ------------VEYDGTDFHGWQIQPTVPTVQGALEEAV----------DTVVGTACRVTGSGRTDAGV
TRUA_PICTO      -----------KYGYDGTKFEGFDRSNSKNSVESVIINVLSEYNI-----------TKNIESAARTDKNV
TRUA_HELPS      ------------IAYDGAYFLGYAKQPNKLGVQDKIESALNALGI-----------KSVVVAAGRTDKGV
TRUA1_CLOTE     --------------YDGTRYKGWQKQKKVLTIQDKIETVLSKMTGEDIQ----------VIGCGRTDAGV
TRUA_HELAH      ------------IAYDGAYFLGYAKQPDKLGVQDKIESALNLLGI-----------KSVVIAAGRTDKGV
TRUA_RICCK      ------------IEYLGTDLAGWQRQAGIMSVQQILEEAIYKFS----------GEQVVLFGSGRTDAGV
TRUA_METMP      ----------FKIAYDGK--LSFQTQPHGETVCDKISNALLDCGYLDNKD-----RVPLY-HGGRTDRGV
PUS3_YEAST      ---------ALRFAYLGWNYNGLAVQKEYTTVEGTILEAMNKCKLV-----PSMVLQDKFSRCGRTDKGV
PUS2_YEAST      ------------LGYCGSGYYGMQYNPPHKTIEGEILTKLFDVGAISE-ENSLAPKKNSFMAAARTDKGV
PUS1_CANGA      ---------AVMIGYCGTGYHGMQYNPPNPTIEAALFKAFVDAGAISKANS-NDLKKNNFMRAARTDKGV
TRUA_STAS1      --------------------------------------------------------------SSRTDRGV
TRUA_RICRS      ------------IEYLGTDLAGWQRQAGVMSVQQILEEAIYKFS----------GEQVILFGAGRTDAGV
TRUA_RICRO      ------------IEYLGTDLAGWQRQAGVMSVQQILEEAIYKFS----------GEQVILFGAGRTDAGV
TRUA_CLOK5      ------------IEYDGTNYSGWQRQYNAITIQQRLEEAIEK---------ATGEFSP-VIGSSRTDAGV
PUSL1_HUMAN     ---ASGSVRARYLVYF--QYVGTDFNGVAA-VRGTQRAVGVQNYLEEAAERLNSVEPVRFTISSRTDAGV
TRUA_CORGL      ------------LAYDGTDFHGWAKQGTSD------LRTVQK--VLEDNLSMVLRETVELTVAGRTDAGV
TRUA_BACSV      ------------IQYDGGRYKGWQRLGNGNTIQGKIETVLSE----------MVGRKIEIIGSGRTDAGV
TRUA_RICFE      ------------IEYLGTNLAGWQRQAGVISVQQILEEAIYKFS----------GEQVILFGSGRTDAGV
TRUA_MESFL      --------------YDGSDFHGWIEQPKTSTIQGELNKAINR---------VTKNAVFKTIGASKTDTGV
TRUA_BUCBP      ---------ALGIEYNGSNYHGWQYQKFASSVQEKVLSIIANH-------------PVRVTCAGRTDAGV
TRUA_BORBZ      ------------IAYDGSIYHGFQIQPTKPTVQGEIEKALMK---INKKKVKIH-------SSGRTDKGV
TRUA_BORBU      ------------IAYDGSIYHGFQIQPTKPTVQGEIEKALMK---INKKKVKIH-------SSGRTDKGV
TRUA_RICBR      ------------VEYLGTNLAGWQRQSGVMSVQQILEEAIYKFS----GEQVT------LFGSGRTDAGV
TRUA_RICB8      ------------VEYLGTNLAGWQRQSGVMSVQQILEEAIYKFS----GEQVT------LFGSGRTDAGV
TRUA_DESVV      ------------IAYKGTDLHGWQVQEHATRP-----RPRTVQGVLEPIVSRMAGEQVRLHAAGRTDAGV
TRUA_DESVH      ------------IAYKGTDLHGWQVQEHATRP-----RPRTVQGVLEPIVSRMAGEQVRLHAAGRTDAGV
TRUA_MYCPE      -------TYKLKISYDGSFFRGYQKDENLITVQSELEKYLSLF----------FNTKISTFGSGRTDKYV
YCG6_SCHPO      ------------VSYRGTGFAGLQYNANVKTIQDTLFQAFARVGVQVNADSPKKIR---MCSAARTDKGV
TRUA_CAMJE      -------------SYDGSAFLGSATQPHKKGVQDALSGALSHLGIFS-----------PLLMASRTDKGV
TRUA_CAMJ8      -------------SYDGSAFLGSATQPHKKGVQDALSGALSHLGIFS-----------PLLMASRTDKGV
TRUA_ANAPZ      ------------VEYEGTSFIGWQRQ------HGVVGKSVQES--IERSIKEFCQQSVIVYAAGRTDAGV
TRUA_RICCN      ------------IEYLGTDLAGWQRQAGVMSVQQILEEAIYKFS----------GEQVILFGSGRTDAGV
TRUA_RICAE      ------------IEYLGTDLAGWQRQAGVMSVQQILEEAIYKFS----------GEQVILFGSGRTDAGV
TRUA_RHOPS      ------------IEYDGAPFCGWQLQPVLPSVQGALAAALATCGEAVRVHG-----------AGRTDAGV
TRUA_MYCGA      ------------ISYHGTKFHGYAVQNDYETVQSKLQDALAW----------IYESKIYVNASGRTDKGV
TRUA_AZOC5      ------------IEYDGTPFAGWQIQAELPTVQGVLAAAV-------KGFSGEEA---HVAGAGRTDAGV
TRUA_BORGA      ------------ITYDGSIYHGFQIQPTKPTIQGEIEKALMK---INKKKVKIH-------SSGRTDKGV
TRUA_RHOP2      ------------IEYDGAPFCGWQLQPTLPSVQGALAAALATCGEAVRVHG-----------AGRTDAGV
TRUA_COPPD      --------------FKGTNYAGFQRQKNGTAIQNVLESTLSQIN--------NRATVVRY--SGRTDAGV
PUSL1_XENLA     --------------------------------------------------------------SSRTDSGV
TRUA_NEOSM      ------------VEYVGTGFSGWQKQMSAPSVQEELLSFLLKEKI-------------AVNVAGRTDAGV
TRUA_FINM2      ------------VQYDGSKFYGWQKLNDLPSVQLEIEKAVTKM---------VHQ-PVKINGAGRTDKGV
TRUA_CAMJR      -------------SYDGTAFLGSATQPHKKGVQDALSGALSHLGIFS-----------PLLMASRTDKGV
TRUA_BORAP      ------------IAYDGSMYHGFQIQPTKPTIQGEIEKALM----------XXXXXXXXXHSSGRTDKGV
TRUA_STAHJ      --------------------------------------------------------------SSRTDRGV
TRUA_CAMJD      -------------SYDGSAFLGSATQPHKKGVQDVLSEALSHLGIFS-----------PLLMASRTDKGV
PUS2_SCHPO      ------------LGYSGYGYHGIQINNPLKTIEGDVVAVLKKLGYLKTNN--IDAEHLCIARAARTDKGV
TRUA_ORITI      ------------VEYDGTNFVGWQRQQNGLSIQQLLEDKISTF---------TKQTV-NLIAAGRTDAGV
TRUA_ORITB      ------------VEYDGTNFVGWQRQQNGLSIQQLLEDKISTF---------TKQTV-NLIAAGRTDAGV
TRUA_MYCMS      ------------LCYDGSNYHGWINQTNAISIQTTLNKAIKK--VIKTGQFKT-------IGASKTDTNV


                         .         .         *         .         .         .         .:140
query           SAVAQTVAFEAPDWLTPRAFNGHLPGSVRVWAAADVPAGFHATHDAVRRTYRYHLYAPARVEETDHDHAV
TRUA_HALMA      SARTQTVAFDAPAWLSPAAFNGELPNDVRVWASADVPEDFHATHDAAERTYTYYLYAPADADRPEHE-PV
TRUA_HALSA      SARAQTVAFDAPAWLTPDAFTGALPDPIQVWAHADAPPEFHATHDAVARTYVYYWYAP--------DSRA
TRUA_HALS3      SARAQTVAFDAPAWLTPDAFTGALPDPIQVWAHADAPPEFHATHDAVARTYVYYWYAP--------DSRA
TRUA_NATPD      SARAQTVAFEAPAWLLPRALNGELPASVRAWAAADVGDAFHATHDATARAYRYFLYAP--------EPSA
TRUA_THESM      SALGNVIAFNTPELAEARILNHHL-RDIWILGKAEVPEDFHPRFWAKNKIYRYYLF----------DEGI
TRUA_UNCMA      HALGQVVAFEQPKLTAPRIINSKLPKDLWAYARAEVPDDFDPRRHATSREYRYILYAPDVIER-------
TRUA_PYRKO      SAFFNVVSFERPDLARPEVLNHHL-SDVWVLGIAEVPDDFHPRFWAKFKTYRYYLV----------NEGF
TRUA_METTP      SALGQVIDFEDRAYLAPRVINSLLPSDVWAWARAVAPVGFSARWSALWREYRYFLFSP----------DI
TRUA_METBF      HALEQVVAFDTDNLAIPRVINSELTPGIWVWAHAEVPLSFDARRDAVSRHYRYVM----------SGKEY
TRUA_METAC      HALGQVVAFEKPNLAIPRVINSELPPAIWAWAHAEVPYYFDARRSAVSRHYHYVM--------SGEDY--
TRUA_THEON      SAFFNVVAFDVPDLVRPEVLNFHLK-DVWVLGTAEVPEDFHPRFWAKSKTYRYYLI----------DAGF
TRUA_METMA      HALGQVIAFDTPNLAIPRIINSGLPPTIWVWAHAEVPYDFDARRHAVSRHYRYVI----------SGEGY
TRUA_METBU      HAMGQVVAFDAPNLAMPRVINSKLPGTIWAWAHAIVPENFDPRRHALSRSYRYILYG----------EQF
TRUA_ARCFU      HAYGQVISFYSEDKIFPRMLNAELPEDITAWAWAKVSEDFDPRR-AKSRVYTYVMYG------SDYDISA
TRUA_THEGJ      SAFFNVVSFERADLARPEVLNHNL-HDLWVLGVAEVPDDFHPRFWAISKTYRYYLI----------DEGF
TRUA_PYRAB      SALGNVVAITTEDALNPMVLNARLE-DVWILSAIEVPQDFHPRFWAKSKVYRY--YLPSIGLEVE-----
TRUA_PYRFU      SARGNVIALSTEDIKNPMVLNSRM-SDVWIWGIAEVPEDFHPRFWANTKVYRYYL----------PSLGM
TRUA_METPE      HARGQVGAFSTPPERAVEALNGQLSPDLWCNGFAEVPPSFHPRFDAISRTYRYFF----------ADWPL
TRUA_PYRHO      SALGNVVAITTEDITNPMILNAKLK-DVWVLSAVKVPSDFHPRFWARSKVYRYYL----------PSFDL
TRUA_EXISA      HALGQVIHFEMPAERFVKALNAMLPDDILVKQAEEMDDTFHARYGAKRKEYRYHI---RQTEDPFRRHKL
TRUA_LACPL      HAFGQTLHFDLPYEINPRGLNSMLPMDTIVKAVSIVPNDFHARYDTVGKRYWYRAYQPFKRHYTGHKFAA
TRUA_SYNSC      HAAGQVVHFDCSGPIPARALNGRLPSTIRVRESVARPLDWHACYSATYRRYRYTIHNGRRPSWHCYQHRL
TRUA_GEOTN      HAYGQVIHFDTPLALSPKALNAQLPDDIAVRSVDEADSTFHARFSAKAKEYRYNVWTAAERDVAWHPYPL
TRUA_PROMM      HAAGQVVHFDCPAERWAPALNGRLPSTIRVREAVARPASWHACHSAIYRRYRYTIYNGRRTPWSWHRYQV
TRUA_EXIS2      HAQGQVIHFDTELSIAPKALNTLLPDDIRVRDCKEVASDFEARYDVVGKEYRYFVNAFRRHQSVLIPYSL
TRUA_ANOFW      HAYGQVIHFDTPDERWPKALNALLPDDVIVKEASEVPSSFHARFSVKKKEYRYRVWIGLRHYVYHHPYDV
TRUA_METTH      HALGNFVSFFTEEDIHVNQINDLLPRDIRVLAWASVMYPFKVRY-PLERHYRYILH---------REESM
TRUA_GEOKA      HAYGQVIHFDTPLSLSKKALNAQLPDDIVVRFVQEADADFHARFSAKAKEYRYKVWTAAERDVAWHPYSL
TRUA_RHOBA      HAIGQVARCVLPVWKADRAINSKLPNDIRVKAVRETRERFHPIADATGKQYQYLVQVGGSRDPFANRFVI
TRUA_METST      HSTGNVISFITDEDIHINQLNGLLPDDIKIIGEARVPYGFKVRF-PLTRTYTY--IQPISPFEKKN---L
TRUA_BURM1      HGLGQVVHFDTADFSWVRGTNAFLPPTVAVQWAKSMPDAFHARFSAFERTYYYALYVPVRSPMLDGHTPL
TRUA_BACHD      HARGQIVHFDTPVDRWPIALNSQLPADICVLEAADVPADFHARYSAKTKEYRYRVLTSAQADVFRRNYTL
TRUA_PROM3      HAAGQVVHFDCPAERWAPALNGRLPNTIRVREAVARPASWHACHSATYRRYRYTIYNGRRTPWSWHRYHV
TRUA_BURCM      HGLGQVVHFDTTDFSWVRGTNAFLPSTVSVQWAKPMPETFHARFAAFERTYYYVLYSPMLAGRAGWIHTL
TRUA_GEOUR      HALGMVAAFKTGKLLPLRAFNALLPNDIAIRDAVEAPLSFNPRADAKSKHYRYTIYNAARLSSWHLRGAL
TRUA_SYNS9      HAAAQVVHFDAAKWAP--ALNGRLPASIRVRESVERPRDWHACYSAVYRRYRYIIHNGRRTPWTWHHHRL
TRUA_METCA      HAIEQVAHFDTESRRSERSWNTALPEDVRILWVRETEPHFHARLSAIARYYRYEILSALRPRQFTWCHAL
TRUA_BURA4      HGLGQVVHFDTTDFSWVRGTNAFLPSTVSVQWAKPMPDTFHARFAAFERTYYYVLYSPMLAGRAGWIHTL
TRUA_LACF3      HALGQVAHFDLPYQIPGRALNSSLPLDVLVKEATEVAPDFHARFDAHHKRYRYRVVGPFKRNYTGHKYPV
TRUA_BACA2      HAAGQVIHFDTPKW--PFALNALLPDDIAVKTAEIADDGFHARFSAVQKEYRYFVYTEKHPDVFKRHYAL
TRUA_METLZ      SARRQSITTEKPE-LAIEALNFHLPDDIWCIGAAEVDEEFXXXXXXXXXXXXXXFPYPA-----------
TRUA_SHEB8      HATGQVVHFETNAIRNEGAWNANLPDNIAVRWVKEVDDSFHARFSATARRYRYHSFRPGILRHVSHYHGI
TRUA_DESRM      HAQGQVVNFRSEKWPVPAALNVLLPGDIKVVKAEEVPMDFHARFSAVAKTYRYSIYSPFHRYYCYHERRL
TRUA_BURS3      HGLGQVVHFDTDSWV--RGTNAFLPSTVAVQWAKPMPETFHARFSAFERTYYYALYSPMLAGRAGWIHTL
TRUA_BACP2      HAKGQVIHFDTPLSIPPFALNSLLPDDIRVLKAEEVDESFHARFSVVSKEYRYHQNVFTRQYACHFPYRL
TRUA_BURCH      HGLGQVVHFDTDSWV--RGTNAFLPSTVSVQWAKPMPDTFHARFSAFERTYYYALYSPMLAGRAGWIHTL
TRUA_BURCC      HGLGQVVHFDTDSWV--RGTNAFLPSTVSVQWAKPMPDTFHARFSAFERTYYYALYSPMLAGRAGWIHTL
TRUA_BURCA      HGLGQVVHFDTDSWV--RGTNAFLPSTVSVQWAKPMPDTFHARFSAFERTYYYALYSPMLAGRAGWIHTL
TRUA_METKA      HARYQVVVVEGPELAQPDPINARLPKDIRVIAKTEVHEEFDPRRDALRKEYRYFLGPLNRPEAAAR----
TRUA_SHESR      HATGQVVHFETNAIRNEGAWNANLPDNIAVRWAKEVDDSFHARFSATARRYRYHNFRPGILRHVSHYHGI
TRUA_SHESM      HATGQVVHFETNAIRNEGAWNANLPDNIAVRWAKEVDDSFHARFSATARRYRYHNFRPGILRHVSHYHGI
TRUA_BURVG      HGLGQVVHFDTAEFSWVRGTNAFLPPTVSVQWAKAMPDTFHARFSAFERTYYYALYSPMLAGRAGWIHTL
TRUA_SOLUE      HALAQVAAFSIENPIPVRAVNRLLPPAIRILCAEEVQADFHPRFDAVAKTYEYRMFRDEVCSPFEHPYPL
TRUA_SHESA      HATGQVVHFETNAIRNEGAWNANLPDNIAVRWAKEVDDTFHARFSATARRYRYHNFRPGILRHVSHYHGI
TRUA_PHOLL      HATGQVVHFETKDAAWTMGVNVHLPPDIAVRWVKTVDEGFHARFSATARRYRYHRYRPAVLANTHFHYPL
TRUA_SHEB5      HATGQVVHFETQAIRNEGAWNANLPDNIAVRWVKEVDDSFHARFSATARRYRYHSFRPGILRHVSHYHGI
TRUA_METMJ      HARSQVCSFDKPERAI-EALNRVLPADIWCTGWAEAPDGFHPRYSAVSRTYRYYFSAPG-----------
TRUA_SHEB9      HATGQVVHFETNAIRNEGAWNANLPDNIAVRWVKEVDDSFHARFSATARRYRYHSFRPGILRHVSHYHGI
TRUA_SHEB2      HATGQVVHFETHAIRNEGAWNANLPDNIAVRWVKEVDDSFHARFSATARRYRYHSFRPGILRHVSHYHGI
TRUA_BURPS      HGLGQVVHFDTADFSWVRGTNAFLPPTVAVQWAKPMPDTFHARFAAFERTYYYALYSPMLAGRAGWVHTL
TRUA_BURP8      HGLGQVVHFDTESWV--RGTNAFLPSTVAVQWAKPMPDAFHARFSAFERTYYYALYSPMLASRAGWIHTL
TRUA_BURP6      HGLGQVVHFDTADFSWVRGTNAFLPPTVAVQWAKPMPDTFHARFAAFERTYYYALYSPMLAGRAGWVHTL
TRUA_BURP1      HGLGQVVHFDTADFSWVRGTNAFLPPTVAVQWAKPMPDTFHARFAAFERTYYYALYSPMLAGRAGWVHTL
TRUA_BURP0      HGLGQVVHFDTADFSWVRGTNAFLPPTVAVQWAKPMPDTFHARFAAFERTYYYALYSPMLAGRAGWVHTL
TRUA_BURMS      HGLGQVVHFDTADFSWVRGTNAFLPPTVAVQWAKPMPDTFHARFAAFERTYYYALYSPMLAGRAGWVHTL
TRUA_BURMA      HGLGQVVHFDTADFSWVRGTNAFLPPTVAVQWAKPMPDTFHARFAAFERTYYYALYSPMLAGRAGWVHTL
TRUA_BURM9      HGLGQVVHFDTADFSWVRGTNAFLPPTVAVQWAKPMPDTFHARFAAFERTYYYALYSPMLAGRAGWVHTL
TRUA_BURM7      HGLGQVVHFDTADFSWVRGTNAFLPPTVAVQWAKPMPDTFHARFAAFERTYYYALYSPMLAGRAGWVHTL
TRUA_BACSU      HAAGQVIHFDTPLSIPPYALNALLPDDIAVKQAEIADDGFHARFSAVKKEYRYFVYTEKHPDVFKRHYAL
TRUA_SHESW      HATGQVVHFDTNAIRNEGAWNANLPDNIAVRWVKEVDDSFHARFSATARRYRYHSFRPGILRHVSHYHGI
TRUA_PROMA      HAAGQVVHFDSPVHRWPSALNGRLPEAIRVRDSVEQSLDWHACHSAVYRRYRYIIYNGCTPNWHKYQYQL
TRUA_DEIRA      HAEAMPLHWDVPTTFRPRALNAWLPASVSVLSAEVAPAGFHARFSCTERRYVYRLWAPQR-------HPL
TRUA_BURTA      HGLGQVVHFDTADFSWVRGTNAFLPSTVAVQWAKPMPDTFHARFAAFERTYYYALYSPMLAARAGWVHTL
TRUA_THENV      SAVGNVVMTSAK--VQPAAANSKLPRGVWVWAAAEVPEGFNPR----RARSRHYLYAPHWGEDLD-----
TRUA_METI4      HAKGQVASFAAPRKLEPRALNYHLPDTVRVWDARIVPREFSARFDAVSKTYQYLLWDPFYLGRAWHPRAM
TRUA_SHEPC      HATGQVVHFDTNAIRNEGAWNANLPDNIAVRWVKEVDDSFHARFSATARRYRYHSFRPGILRHVSHYHGI
TRUA_BACLD      HAVGQTIHFDSPKW--PYALNALLPDDISVRKAEAVNDQFHARFSAKRKEYRYMIYRGRHPDVFKRYYAL
TRUA_PELCD      HARGMVAHFVTPQPLPMAAYNRFLPAQIAVRDAALMPDDFHARYSAVGKWYRYSIYSPLACRFSWHVRTV
TRUA_LISIN      HAKGQVIHFDSELDITAEKFQKALPFDISFLTVEEAPADFHARFGTVGKEYRYKIFDPSRNFALHYPYEL
TRUA_CHLPD      HARAQIATFKSRSSLGPHSMNALLPNTIRISDPLVVPEGFHARHSAKEREYRYFVREEGRFSGCSYG-SL
TRUA_LACC3      HALGQVISFDYPGNIPAKAMNSLMPLDIEILKAEIVDADFHARYSAKGKRYLYRVARGNRLYTGHYPYKL
TRUA_ENTS8      HATGQVVHFETTDAAWTLGVNANLPGDIAVRWVKDVPAEFHARFSATARRYRYVIYRPAVLSQTHYHLPL
TRUA_LACSS      HAMGQVVHFDYPSELPARALNSLLPLDMEVVDSQLADDDFHARFSTVGKRYMYHYTNPFKRRYTGHPYPI
TRUA_LACCB      HALGQVISFDYPGNIPAKAMNSLMPLDIEILKAEIVDADFHARYSAKGKRYLYRVARGNRLYTGHYPYKL
TRUA_GEOSF      HALGMVAVFKTQKDLPVRAFNCLLPPDIAIRDASEVPLSFNPRADAISKHYRYTIYSPLTRLNSWHLRGI
TRUA_COLP3      NATNQVIHFDTKDTAWTLGVNTHLPSXXXXXXXXXXXXXFHARFSATARNYRYIIYKPLRSAILSHHFAL
TRUA_VIBVY      HGTGQVVHFDTNVERKMVAWNANLPKDIAVRWAKAVPDEFHARFSATARRYRYHALRPGILSGVSHYHGL
TRUA_VIBVU      HGTGQVVHFDTNVERKMVAWNANLPKDIAVRWAKAVPDEFHARFSATARRYRYHALRPGILSGVSHYHGL
TRUA_VIBPA      HGTGQVVHFDTNVNRKMVAWNANMPSDIAVRWAKEVPDDFHARFSATARRYRYHALRPGILNSVSHYHGL
TRUA_VIBCM      HGTGQVVHFDTTAERQMVAWNANLPKDIAVRWAMAVPDEFHARFSATARRYRYHVYRPGILNSVSHYHGL
TRUA_VIBCH      HGTGQVVHFDTTAERQMVAWNANLPKDIAVRWAMAVPDEFHARFSATARRYRYHVYRPGILNSVSHYHGL
TRUA_VIBC3      HGTGQVVHFDTTAERQMVAWNANLPKDIAVRWAMAVPDEFHARFSATARRYRYHVYRPGILNSVSHYHGL
TRUA_SYNPX      HAAGQVVHFDCGDRIPPAALNGRLPFTIRVRESVLRPKDWHACYSATYRRYRYTIHNGRRPSWHRYQLRL
TRUA_HERAR      HALEQVVHFDTQSWV--RGVNTFLPSSIAVWAAHDPAENFHARFSARSRTYHYMLYNPVRSPLLEGKRAL
TRUA_PELPB      HARAQTANFFTASSLEPHSLNSLLPQTIRISNPEEVDADFHARHSAKERQYRYFL-----IEEPSAIYGL
TRUA_PROM9      HASGQVVHFNIDCVIPANSYNGLLPSAIRILESVEVKDSWHSCYSAMYRHYRYVIFPNLFINNWSYQKIL
TRUA_PHOPR      HGTGQVVHFDVDAWTI--GVNAHLPRDISVRWATQVSDDFHARFSATARRYRYIIYNSAGVGVSHYHGHL
TRUA_LISMH      HAKGQVIHFDSELDITAEKFQKALPFDISFLTVEEVPDDFHARFGTVGKEYRYKIFDPSRDFALHYPYEL
TRUA_KLEP7      HGTGQVVHFETKDAAWTLGVNANLPGDIAVRWVKHVPADFHARFSATARRYRYVIYRPAVLSQTHFHQPL
TRUA_ENT38      HGTGQVVHFETTSVRKDAAWNANLPGDIAVRWVKDVPDDFHARFSATARRYRYIIYRPAVLGQTHFYEPL
TRUA_VIBHB      HGTGQVVHFDTNVSRKMVAWNANMPSDIAVRWAVEVNDDFHARFSATARRYRYHALRPGILNSVSHYHGL
TRUA_IDILO      HATAQIVHFDVP---VPRAVNSNLPAGIAVRWAREVDSEFSARFSATSRRYRY-IIANTRFRPGIHSAGV
TRUA_BURPP      HGLGQVVHFDTADVSWVRGTNSFLPKTISVQWAKPMPDEFHARFSAFERTYYYVLYSPMLATRAGWVHSL
TRUA_BORPD      HAAMQVVHLDAESWV--RGVNAFLPPSIAVQWAQPVPDDFHARFSARSRTYLYLLWR-GRVRPPLWAQPL
TRUA_SHEDO      HGTGQVVHFDTPDSAWTLGVNANLPDTIAVRWVKLVDDSFHARFSATARRYRYHKFRPGLLRHLSHYHGI
TRUA_LISMO      HAKGQVIHFDSELDITAEKFQKALPFDISFLTVEEVPDDFHARFGTVGKEYRYKIFDPSRNFALHYPYEL
TRUA_LISMF      HAKGQVIHFDSELDITAEKFQKALPFDISFLTVEEVPDDFHARFGTVGKEYRYKIFDPSRNFALHYPYEL
TRUA_LISMC      HAKGQVIHFDSELDITAEKFQKALPFDISFLTVEEVPDDFHARFGTVGKEYRYKIFDPSRNFALHYPYEL
TRUA_KLEP3      HGTGQVVHFETKDAAWTLGVNANLPGDIAVRWVKHVPADFHARFSATARRYRYVIYRPAVLSHTHFHQPL
TRUA_GLOVI      HASGQVVHFDTHKKLAPRGLNSLLPDDIAVRAAAYVSDHWHARFTALWREYRYCIHNSVRAQSWYYPYCL
TRUA_GEOSM      HARGMVACFQTDKGMPLRAFNCLLPADIAVREACEVPLEFHPRFDALAKHYRYTMXXXXXXXXXXXXTAL
TRUA_CHLL2      HARLQVVNFMTGSAMEAHALNSLLPDTVRVSNPHVVPLDFHARFSAKEREYRYFLLSALRCRFTGSKGSL
TRUA_BACSK      HACGQVLHFDTELTIAPEALNTHLPDDIVVTNAAMVEPDFHARYGAQAKEYRYYIQC-GPFENVFRRHAL
TRUA_SHESH      HATGQVVHFETKDSAWTLGVNVNLPDDIAVRWVKIVDDEFHARFSATARRYRYMIYGILRSGVSHYRGNI
TRUA_SALTY      HGTGQVVHFETTALRKDAAWNANLPGDIAVRWVKTVPDDFHARFSATARRYRYIIYRPAVLAKTHYYEPL
TRUA_SALTI      HGTGQVVHFETTALRKDAAWNANLPGDIAVRWVKTVPDDFHARFSATARRYRYIIYRPAVLAKTHYYEPL
TRUA_SALSV      HGTGQVVHFETTALRKDAAWNANLPGDIAVRWVKTVPDDFHARFSATARRYRYIIYRPAVLAKTHYYEPL
TRUA_SALPK      HGTGQVVHFETTALRKDAAWNANLPGDIAVRWVKTVPDDFHARFSATARRYRYIIYRPAVLAKTHYYEPL
TRUA_SALPC      HGTGQVVHFETTALRKDAAWNANLPGDIAVRWVKTVPDDFHARFSATARRYRYIIYRPAVLAKTHYYEPL
TRUA_SALPB      HGTGQVVHFETTALRKDAAWNANLPGDIAVRWVKTVPDDFHARFSATARRYRYIIYRPAVLAKTHYYEPL
TRUA_SALPA      HGTGQVVHFETTALRKDAAWNANLPGDIAVRWVKTVPDDFHARFSATARRYRYIIYRPAVLAKTHYYEPL
TRUA_SALNS      HGTGQVVHFETTALRKDAAWNANLPGDIAVRWVKTVPDDFHARFSATARRYRYIIYRPAVLAKTHYYEPL
TRUA_SALHS      HGTGQVVHFETTALRKDAAWNANLPGDIAVRWVKTVPDDFHARFSATARRYRYIIYRPAVLAKTHYYEPL
TRUA_SALG2      HGTGQVVHFETTALRKDAAWNANLPGDIAVRWVKTVPDDFHARFSATARRYRYIIYRPAVLAKTHYYEPL
TRUA_SALEP      HGTGQVVHFETTALRKDAAWNANLPGDIAVRWVKTVPDDFHARFSATARRYRYIIYRPAVLAKTHYYEPL
TRUA_SALDC      HGTGQVVHFETTALRKDAAWNANLPGDIAVRWVKTVPDDFHARFSATARRYRYIIYRPAVLAKTHYYEPL
TRUA_SALCH      HGTGQVVHFETTALRKDAAWNANLPGDIAVRWVKTVPDDFHARFSATARRYRYIIYRPAVLAKTHYYEPL
TRUA_SALA4      HGTGQVVHFETTALRKDAAWNANLPGDIAVRWVKTVPDDFHARFSATARRYRYIIYRPAVLAKTHYYEPL
TRUA_SHEAM      HATGQVVHFDTKEGAWTLGVNVHLPDDIAVRWAMPVNDDFHARFSATARRYRYHNFRPGILRKVSHYHGI
TRUA_RALPJ      HALGQVVHLDTDLVREPRGTNAFLPPTVAVRWAQEMPEDFHARFSAHRRTYYYALFGPTRAPLLEDGQSL
TRUA_NEIG1      HATAQVVHFDAQAWI--RGVNAHLPEGIAVLHARQVAPGFHARFDASGRHYRYLLRSPLLKNRAGWTHEL
TRUA_LACRJ      HALNQVAHFDIPYHLSRKALNSILPLDILIKKAELVDNDFHARYSAHRKTYRYRVVNPFKRNYTSHKYPL
TRUA_LACRD      HALNQVAHFDIPYHLSRKALNSILPLDILIKKAELVDNDFHARYSAHRKTYRYRVVNPFKRNYTSHKYPL
TRUA_FRATN      HATSQIVNFERPLSAWQRGVNALLPQDIKILAVQQVDNNFNSRFTAINRTYNYIIYNSATSSPIFAEHCL
TRUA_CITK8      HGTGQVVHFETTALRKDAAWNANLPGDIAVRWVKAVPEDFHARFSATARRYRYIIYRPAILGHTHFYEPL
TRUA_BORA1      HAAMQVVHVDAESWV--RGVNAFLPSSISIHWAKEVGEDFHARFSARSRTYVYLLWR-GRVRPALWAHPL
TRUA_AKKM8      HALGQVFHADAPDW--PAALNTRLPRTIRITHAEYVPPGFHARFSATGKTYRY-----------------
TRUA_RALSO      HALGQVVHLDTESWV--RGTNAFLPPTVAVRWAQAMPEDFHARFSAHRRTYYYALYGPTRAPLLEPGQSL
TRUA_STRSV      HALGQVLHFDLPEDRDEEALDTQTPEDIDFISVEQVSDDFHSRYNKHSKTYEFLVNPMMRHYATHYPYPL
TRUA_PSEAE      HASGQVVHFDTAVERPLKAWNANLPADISVTWARVMPAHFHARFSAMARRYRYAIYRPAHLAETWNHRPL
TRUA_NEIMB      HATAQVVHFDTPQQAWVRGVNAHLPEGIAVLHARQVAPEFHARFDAYGRHYRYLLRSPLLKNRAGWTHKL
TRUA_ECOLI      HGTGQVVHFETTALRKDAAWNANLPGDIAVRWVKTVPDDFHARFSATARRYRYIIYRPAVLSKTHFYEPL
TRUA_ECODH      HGTGQVVHFETTALRKDAAWNANLPGDIAVRWVKTVPDDFHARFSATARRYRYIIYRPAVLSKTHFYEPL
TRUA_ECOBW      HGTGQVVHFETTALRKDAAWNANLPGDIAVRWVKTVPDDFHARFSATARRYRYIIYRPAVLSKTHFYEPL
TRUA_SYNWW      HAWGQVVAFDSPGDRWAYALNSQLPEDIQVLESQETRAEFNPRFDALKKCYGYLIYRQKKKATFYRHYAL
TRUA_SHISS      HGTGQVVHFETTAQRKDAAWNANLPGDIAVRWVKAVPDDFHARFSATARRYRYIIYRPAVLSKTHFYEPL
TRUA_SHIFL      HGTGQVVHFETTAQRKDAAWNANLPGDIAVRWVKAVPDDFHARFSATARRYRYIIYRPAVLSKTHFYEPL
TRUA_SHIF8      HGTGQVVHFETTAQRKDAAWNANLPGDIAVRWVKAVPDDFHARFSATARRYRYIIYRPAVLSKTHFYEPL
TRUA_SHIDS      HGTGQVVHFETTAQRKDAAWNANLPGDIAVRWVKAVPDDFHARFSATARRYRYIIYRPAVLSKTHFYEPL
TRUA_SHIB3      HGTGQVVHFETTAQRKDAAWNANLPGDIAVRWVKAVPDDFHARFSATARRYRYIIYRPAVLSKTHFYEPL
TRUA_NITEU      HALCQVVHLETNAWI--RGTNALLPGDISILEASEVSDDFHARFSATERTYLYYLLSRPARPGIHHHYPL
TRUA_MANSM      HGTGQVVHFETPEKAWAFGTNANLPDDIAVRWAKEVPDDFHARFSATARRYRYVLYCPYGITHTHLD--L
TRUA_LACBA      HALAQVVHFDFP-FLIPKGLNSMLPMDMEVLKVEEVAPTFHARYDVSGKQYQYRMRNPFKRNYTGHKFPV
TRUA_ECOSM      HGTGQVVHFETTAQRKDAAWNANLPGDIAVRWVKAVPDDFHARFSATARRYRYIIYRPAVLSKTHFYEPL
TRUA_ECOSE      HGTGQVVHFETTAQRKDAAWNANLPGDIAVRWVKAVPDDFHARFSATARRYRYIIYRPAVLSKTHFYEPL
TRUA_ECOLU      HGTGQVVHFETTAQRKDAAWNANLPGDIAVRWVKAVPDDFHARFSATARRYRYIIYRPAVLSKTHFYEPL
TRUA_ECOLC      HGTGQVVHFETTALRKDAAWNANLPGDIAVRWVKAVPDDFHARFSATARRYRYIIYRPAVLSKTHFYEPL
TRUA_ECOL6      HGTGQVVHFETTAQRKDAAWNANLPGDIAVRWVKAVPDDFHARFSATARRYRYIIYRPAVLSKTHFYEPL
TRUA_ECOHS      HGTGQVVHFETTALRKDAAWNANLPGDIAVRWVKAVPDDFHARFSATARRYRYIIYRPAVLSKTHFYEPL
TRUA_ECO8A      HGTGQVVHFETTAQRKDAAWNANLPGDIAVRWVKAVPDDFHARFSATARRYRYIIYRPAVLSKTHFYEPL
TRUA_ECO7I      HGTGQVVHFETTAQRKDAAWNANLPGDIAVRWVKAVPDDFHARFSATARRYRYIIYRPAVLSKTHFYEPL
TRUA_ECO5E      HGTGQVVHFETTAQRKDAAWNANLPGDIAVRWVKAVPDDFHARFSATARRYRYIIYRPAVLSKTHFYEPL
TRUA_ECO57      HGTGQVVHFETTAQRKDAAWNANLPGDIAVRWVKAVPDDFHARFSATARRYRYIIYRPAVLSKTHFYEPL
TRUA_ECO55      HGTGQVVHFETTAQRKDAAWNANLPGDIAVRWVKAVPDDFHARFSATARRYRYIIYRPAVLSKTHFYEPL
TRUA_NITEC      HALCQVVHFETPLTAWVRGANALLPDDISVLWASEVNDDFHARFSATERTYLYYLLSPARQGKTGWTHSL
TRUA_GEOBB      HARGMVACFKTDKAMPLRAFNCLLPGDIAVREACEVPLEFHPRFDAHAKHYRYTIXXXXXXXXXXXXTVL
TRUA_FRATW      HATSQIVNFDRPLSAWQRGVNALLPQDIKILAVQQVDNNFNSRFTAINRTYNYIIYNSATSSPIFAEHCL
TRUA_ESCF3      HGTGQVVHFETTAQRKDAAWNANLPGDIAVRWVKAVPDDFHARFSATARRYRYIIYRPAVLSKTHFYEPL
TRUA_ECOUT      HGTGQVVHFETTAQRKDAAWNANLPGDIAVRWVKAVPDDFHARFSATARRYRYIIYRPAVLSKTHFYEPL
TRUA_ECOL5      HGTGQVVHFETTAQRKDAAWNANLPGDIAVRWVKAVPDDFHARFSATARRYRYIIYRPAVLSKTHFYEPL
TRUA_ECOK1      HGTGQVVHFETTAQRKDAAWNANLPGDIAVRWVKAVPDDFHARFSATARRYRYIIYRPAVLSKTHFYEPL
TRUA_ECO81      HGTGQVVHFETTAQRKDAAWNANLPGDIAVRWVKAVPDDFHARFSATARRYRYIIYRPAVLSKTHFYEPL
TRUA_ECO45      HGTGQVVHFETTAQRKDAAWNANLPGDIAVRWVKAVPDDFHARFSATARRYRYIIYRPAVLSKTHFYEPL
TRUA_ECO27      HGTGQVVHFETTAQRKDAAWNANLPGDIAVRWVKAVPDDFHARFSATARRYRYIIYRPAVLSKTHFYEPL
TRUA_ECO24      HGTGQVVHFETTAQRKDAAWNANLPGDIAVRWVKAVPDDFHARFSATARRYRYIIYRPAVLSKTHFYEPL
TRUA_DESAD      HALGQVAHFDVDSCFASRALNSLLPDDVTILDAQLVSPEFHSRYSAIRKTYTYTLFLPWRRHYVWKCGPL
TRUA_BREBN      HARGQVIHFDTASNIPMDVLNNQLPDSIVIRTVEEVDASFHARFDVQVKEYRYCIDNNPVADVFRHRYAL
TRUA_THICR      HAIGQIAHFETPDKAWIQGVNTQLPNDIRVTWVKPMPEDFHARFSAVARQYRYVIFAILANRVTWENRPL
TRUA_SHEWM      HATGQVVHFDTDAIRKESAWNVSLPDDIAVRWAKVVDEDFHARFSATARRYRYMIYGILRSGVSHYRTHL
TRUA_NEIM0      HATAQVVHFDTPVQAWVRGVNAHLPEGIAVLHARQVAPEFHARFDAYGRHYRYLLRSPLLKNRAGWTHKL
TRUA_NATTJ      HAKGQVANFFAPKQIPPLALNTNLPNDIAIINAEVVGSNFRARRDAIKKEYRYYVYHAPYMDPFWRNYAL
TRUA_ANATD      HALNQKANFKTPTDKFPLALNSVLPGDISIKDAVEAPLDFSARYSARQKTYKYLIYALLRNYAYYYPYQL
TRUA_TREPS      HAVGQAAHFCTPNILAYRAFNSLLPHSIRITDAREVSSQLHARFSAVMRTYRYHLH--------------
TRUA_TREPA      HAVGQAAHFCTPNILAYRAFNSLLPHSIRITDAREVSSQLHARFSAVMRTYRYHLH--------------
TRUA_STRZT      HALGQVIHFDLPYQMDEEALDTQSPEDIDVISIELVAADFHCRYAKHSKTYEFIVKNPMRRHYATHPYPL
TRUA_FRATT      HATSQIVNFDRPLSAWQRGVNALLPQDIKILAVQQVDNNFNSRFTAINRTYNYIIYNSATSSPIFAEHCL
TRUA_FRATM      HATSQIVNFDRPLSAWQRGVNALLPQDIKILAVQQVDNNFNSRFTAINRTYNYIIYNSATSSPIFAEHCL
TRUA_FRAT1      HATSQIVNFDRPLSAWQRGVNALLPQDIKILAVQQVDNNFNSRFTAINRTYNYIIYNSATSSPIFAEHCL
TRUA_SHEPW      HGTGQVVHFDTNAIRKETAWNVNLPDDIAVRWVKVVDEEFHARFSATARRYRYMIYGILRSGVSHYRGNI
TRUA_SALAR      HGTGQVVHFETTDVAWTLGVNANLPGDIAVRWVKAVADDFHARFSATARRYRYIIYRPAVLAKTHYYKPL
TRUA_PYRIL      SAVANTVMVSQK--LPIALVNSKLPRGVWAWAIAEVPQSFNPR----RAKFRHYLYVAPHWGE-------
TRUA_NITOC      HAAAQVVHFDTATFRLEHNWNANLLPEVAILWAQPVNEAFHARFSAIARHYRYIILAIANRRVTWYCQPL
TRUA_NEIMF      HATAQVVHFDTPQQAWVRGVNAHLPEGIAVLHARQVAPEFHARFDAYGRHYRYLLRSPLLKNRAGWTHKL
TRUA_NEIG2      HAAAQVVHFDIPQQAWVRGVNAHLPEGIAVLHARQVAPGFHARFDAYGRHYRYLLRSPLLKNRAGWTHKL
TRUA_LISW6      HAKGQVIHFDSDLDITADKFQKALPFDISFLTVDEAPADFHARFGTVGKEYRYKIFDPSRNFALHYPYEL
TRUA_DESAP      HARGQVVNFVTGRWRIPAALNGVLPGDIAALDAREVPADFHARYSAVAKTYSYTLY--------------
TRUA_YERPS      HATGQVVHFVTSDAAWTMGVNSHLPADIAVRWVKTVDNDFHARFSATARRYRYHRYRPAILAQTHCYMPL
TRUA_YERPE      HATGQVVHFVTSDAAWTMGVNSHLPADIAVRWVKTVDNDFHARFSATARRYRYHRYRPAILAQTHCYMPL
TRUA_YERP3      HATGQVVHFVTSDAAWTMGVNSHLPADIAVRWVKTVDNDFHARFSATARRYRYHRYRPAILAQTHCYMPL
TRUA_PSEHT      HGTGQVVHFDTDAPRDMVAFNTLLPKDIAIRFAQPVADDFHARFSATARRYRYVIYAVLNEGVTHFHHTL
TRUA_PSEA6      HATGQVVHFETPDRAWTLGINTYLPDTISVRWVKAVPEDFHARFSATARRYRYIIYSGILANGVTHIYGL
TRUA_FRATO      HATSQIVNFYSPLSAWQRGVNALLPQDIKILAVQQVDNNFNSRFTAINRTYNYIIYNSATSSPIFAEHCL
TRUA_FRATH      HATSQIVNFYSPLSAWQRGVNALLPQDIKILAVQQVDNNFNSRFTAINRTYNYIIYNSATSSPIFAEHCL
TRUA_AERS4      HATGQVIHFDTHAIRSESAWNSNLPPDIAVRWVKEVDETFHARFSATARRYRYHNYRPAILSGVSHYHET
TRUA_STRPN      HALGQVIHFDLPYQMDEEALDTQSPEDIDVISIELVADDFHCRYAKHSKTYEFTVKNPMRRHYATHPYPL
TRUA_STRP7      HALGQVIHFDLPYQMDEEALDTQSPEDIDVISIELVADDFHCRYAKHSKTYEFTVKNPMRRHYATHPYPL
TRUA_SHIBS      HGTGQVVHFEAPDAAWTLGVNANLPDDIAVRWVKAVPDDFHARFSATARRYRYIIYRPAVLSKTHFYEPL
TRUA_PROM2      HASGQVVHFDIPGFSYSNILNNLLPSTIRILESVEVKNSWHACYSAVYRHYRYVIFPNLFINNWSYQKVL
TRUA_PROM0      HASGQVVHCDV-DCVVPDVLNSLLPSSIRILESIEVKDSWHACYSALYRHYRYVIFPNLFIDNWSYQKVL
TRUA_FRATF      HATSQIVNFYSPLSAWQRGVNALLPQDIKILAVQQVNNNFNSRFTAINRTYNYIIYNSATSSPIFAEHCL
TRUA_CHLTE      HARRQVASFATPLGRLIYSANSLLPSTIRINAMRQAPESFHARFSATSREYRYFLLEPSAIDSAGCSHGK
TRUA1_DESPS     HADGMTAHFHTDTRLTQRALNRMLPGAIRILQVREMADDFHARFAATGKEYHYRLFTQKRLYMLHQEKPI
TRUA_KOSOT      HAYGQVIAFTSNDRLTPKALNANLPDDIYVRRIHEVPSNFSPRFAAKKRIYHYYI---LNTKEPDFPYEV
TRUA_GEOSW      HAYGQVIHFDTFLSLSPKALNAQLPDDIVIKDVQEADPSFHARFSAKAKEYRYKVRI---AQERDYPYPL
TRUA1_BACHK     HAKGQVIHFDTPEWQWSNALNTMLPDDIVITQVEKKTEEFHARYGVERKEYRYRVLVSKTADVYQYPYPL
TRUA1_BACCZ     HAKGQVIHFDTPEWQWSNALNTMLPDDIVITQVEKKTEEFHARYGVERKEYRYRVLVSKTADVYQYPYPL
TRUA1_BACAN     HAKGQVIHFDTPEWQWSNALNTMLPDDIVITQVEKKTEEFHARYGVERKEYRYRVLVSKTADVYQYPYPL
TRUA_THENN      HANGQLIAFNCPDRMTTEAMNANLPDDVYVKKVFEVPKNFHPRFDVKKRIYHYFIHTSREKNVFLRKYAL
TRUA_STRGG      HARGQVAHVDLPEWAEHRRLAGRLPLDVRIWRAAPAPAGFNARFSALWRRYAYRVDRPGGVDPLTHDRPL
TRUA_AERHH      HATGQVIHFDTDANRAEGAWNSNLPPDIAVRWVKQVDEGFHARFSATARRYRYHNYRPAILSGVSHYHTI
TRUA_VIBSL      HGTGQVVHFETNVDRKMVAWNANMPKDIAVRWATEVNEDFHARFSATARRYRYHALRPGILNSVSHYHGL
TRUA_THEAB      HANGQVAAFNCPERLTKNALNANLPDDIYVKKAWVVDKSFNPRFAATKRIYHYFISTNMRNYVWNFRYDL
TRUA_METFK      HALSQVVHFDTEAWV--RGVNTKLPRGVRVLWAKEVDPRFHARFDAYQRSYQYWLVAPAVMKAGWFHQPL
TRUA_ALCBS      HGTGQVVHFEMKSWIM--GGNTNLPRDVTIRWAVPVSDDFHARFSAVSRRYRYVIYNHARSQVTWNHRPL
TRUA1_BACCR     HAKGQVIHFDTPEWQWSNALNTMLPDDIVIRQVEKKTEEFHARYGVEKKEYRYRVLLSKTADVYQYPYPL
TRUA1_BACC1     HAKGQVIHFDTPEWQWNNALNTMLPDDIVITQVEKKTEEFHARYGVERKEYRYRVLLSKTADVYQYPYPL
TRUA_THEPX      HALYQVANFKTPAEKLPYALNSVLPDDIVVVQAKDVEDSFHARYSAKRKRYKYHISYPLNIEE-------
TRUA_THEP3      HALYQVANFKTPAEKLPYALNSVLPDDIVVVQAKDVEDSFHARYSAKRKRYKYHISYPLNIEE-------
TRUA_THEMA      HANGQLIAFNCPDRMTTEAMNANLPDDVYVKEVFEVPVNFHPRFDVTKRIYHYFILTSLRKYVWWFPYEL
TRUA_STRAW      HARGQVAHVDLPGELWAKRLAGRLPKDVRVWSLTEAPSGFNARFSAIWRRYAYRVTDNTRSHVLWHDWPL
TRUA_MOOTA      HARGQVISFSTPVERWPLALNSVLPADIAALEAVEVAPDFHARYCAKRKWYRYTIYVFCRRYSWHLRQPL
TRUA_HAEIG      SGTGQVVHFETPEKAWAFGTNAHLPDDIAVAWAKQVDDEFHARFSATARRYRYILYSAILAGGITHCHLL
TRUA_STRGC      HALGQVLHFDLPEERDGEALDTQTPEDIDFISVEQVSDDFHSRYNKHSKTYEFLVNPMMRHYATHYPYPX
TRUA_OCEIH      HAVGQVIHFDSPLEIPERALNTLLPDDVRIQKVEKKTEEFHARYSVKEKEYHYFVLNEQRGYVYHEPRKL
TRUA_GEOSL      HARGMVAAFDTDRSIPLRAFNALLPPDIAVRSADEALPGFNPRFAATGKHYRYTIHRGVRLQSWHVRGAL
TRUA_THEP1      HANGQLIAFNCPDRMTTEAMNANLPDDVYVKEVFEVPVNFHPRFDVTKRIYHYFILTSLRKYVWWFPYEL
TRUA_STRMU      HAYGQVIHFDLPQQRDLEGLDTQTPDDIDVIQVEQVADDFHARYQKHRKTYEFDLGRPMRHYATHFPYKV
TRUA_RALEJ      HALGQVIHLDTTSWV--RGINAFLPPSIALQWARPVDESFHARFLAFERMYYYALYTGPHRVPLAHGRAL
TRUA_NEIMA      HATAQVVHFDTPQQAWVRGVNAHLPEGIAVLHARQVAPEFHARFDAYGRHYRYLLRSPLLKNRAGWTHKL
TRUA_BURXL      HGLGQVVHFDTADVSWVRGTNSFLPKTISVQWAKPMPDEFHARFSAFERTYYYVLY--------------
TRUA_PROMS      HASGQVIHFDI-DCVIPDVLNSLLPSTIRILESVEVKDSWHACYSASYRHYRYVIFPNLFINNWSYQKVL
TRUA_POLSQ      HALGQVVHFDTEDFSWVRGVNTFLPKSIVVNWAKEVPEEFSARFSAYERTYIYALHAPCRSPIVNPDQFL
TRUA_PASMU      HATGQVVHFETDAIRAEKAWNANLPDDISVSWAKCVTDDFHARFSATARRYRYILYCSAILPETHCXXXX
TRUA_CALS8      HALGQKANFKTPTEKFPLALNSVLPNDISIKDAAEVSLDFSARYSAKQKTYKYHKFRPAILCNYVYPYEL
TRUA_STRP4      HALGQVIHFDLPYQMDEEALDTQSPEDIDVISIELVADDFHCRYAKHSKTYEFILKNPMRRHYATHPYPL
TRUA_ROSDO      HAIAQVAHCDLEDWRLSEALNYHLPAPIAITACTAVDAEWHARFSARQRQYLFRILAPATHQKWQVKQKL
TRUA_PROM4      HASGQVAHFDCSGFIPANALNGRLPKAIRVRYSALRPITWHACFSATYRRYRYTIYNGCKPNWHRYQFRL
TRUA_NOCFA      HAEGQVAHFD-----TAAEFDGFLPKDVRVKRADVVPPDFDARFSAIRRHYVYRLTAPYGAEPVPCKSAV
TRUA_HAEIN      SGTGQVVHFETPEKAWAFGTNAHLPDDIAVSWAKQVDDEFHARFSATARRYRYILYSAILAGGITHCHLL
TRUA_HAEI8      SGTGQVVHFETPEKAWAFGTNAHLPDDIAVAWAKQVDDEFHARFSATARRYRYILYSAILAGGITHCHLL
TRUA_VARPS      HALMQVVHFDTTSWM--RGTNRFLPDDIAVQWAQPVPDEFHCRASALARRYLYVLQSPVRPSLDSSMHPL
TRUA_PROM5      HASGQVVHFDI-DFVIPNVLNSRLPSTIRILESVEVKKNWHACYSAVYRHYRYVINNSKKWSWHRYQKSL
TRUA_LACH4      HAIGQVIHFDYPGKTIPAALNSMMPTDIIFNNCEIVNENFHARYSIKGKWYRYHFVNPFKRFYTGHSYAL
TRUA_THELT      HANGQIVCFDCDEESMKNAMNANLPDDIYVRKVVEVDKNFHPRFDAKRRIYHYLIYNSQEPNLFIRNYAL
TRUA_RALEH      HALGQVIALEREPFSWVRGVNAFLPPSIALQWALPVDQGFHARFLAFERMYYYALYTGPHRVPLVHGRAL
TRUA_FERNB      HANGQVVSFDCPDRLIKNAINANLPGDIYIKKVWFTHPTFNPRYEAKRRIYHYYIDTSTRRYVWWFPYEL
TRUA_STRZJ      HALGQVIHFDLPYQMDEEALDTQSPEDIDVISIELVADDFHCRYAKHSKTYEFIVKNPMRRHYATHPYPL
TRUA_STRR6      HALGQVIHFDLPYQMDEEALDTQSPEDIDVISIELVADDFHCRYAKHSKTYEFIVKNPMRRHYATHPYPL
TRUA_STRPS      HALGQVIHFDLPYQMDEEALDTQSPEDIDVISIELVADDFHCRYAKHSKTYEFIVKNPMRRHYATHPYPL
TRUA_STRPJ      HALGQVIHFDLPYQMDEEALDTQSPEDIDVISIELVADDFHCRYAKHSKTYEFIVKNPMRRHYATHPYPL
TRUA_STRPI      HALGQVIHFDLPYQMDEEALDTQSPEDIDVISIELVADDFHCRYAKHSKTYEFIVKNPMRRHYATHPYPL
TRUA_STRP2      HALGQVIHFDLPYQMDEEALDTQSPEDIDVISIELVADDFHCRYAKHSKTYEFIVKNPMRRHYATHPYPL
TRUA_JANSC      HALGQVAADMQRDWRLAEALNYHLPAPVAITACARAHDDFHARFSATWRSYTYRMIAPL-VHARGHAWAV
TRUA_CHLTA      HAQGQIAHFHCPDFTDPRMLNALLPHDIVIHDAVMTDGDFHSRFSAIAKEYRYTLLPHHRLFCFSPRYKL
TRUA_BORPE      HAAMQVIHLDTDDESWVRGVNAFLPPSIVVQWARPVSEAFHARFSARSRTYVYLLWR-GRVRPALWAQPL
TRUA_THESQ      HANGQLIAFNCPDRMTKNAMNANLPDDVYVKEVFEVSKNFHPRFDVKKRIYHYFILTSLRKYVWWFPYEL
TRUA_THEM4      HANGQVAAFNCPDRLAKNALNANLPEDIYVKKAWEVEKNFNPRFRAKKRIYHYLVSTNEKVFKRNYKYKL
TRUA_PYRAR      SAVANVVM--TSQRLHLGYVNSKLPRGVWAWGVAEVPEGFNPRRAKAR---RYLYVAPHWGEDVE-----
TRUA_FRAP2      HATSQVVNFHSSSWM--RGTNALLPQGIKILDIKEVDNDFNSRFTATNRTYNYIIYNSAISSPILAEHCL
TRUA_CHLTB      HAQGQIAHFHCPDFTDPRMLNALLPHDIVIRDAVMTDGDFHSRFSAIAKEYRYTLLPHHRLFCFSPRYKL
TRUA_CHLT2      HAQGQIAHFHCPDFTDPRMLNALLPHDIVIRDAVMTDGDFHSRFSAIAKEYRYTLLPHHRLFCFSPRYKL
TRUA_STRZP      HALGQVIHFDLPYQIDEEALDTQSPEDIDVISIELVADDFHCRYAKHSKTYEFIVKNPMRRHYATHPYPL
TRUA_CUPTR      HALGQVIHLDTELVREPRGVNAFLPPSIALQWALPVDVGFHARFLAYERMYYYALYTGPHRVPMVHGRAL
TRUA_CHRVO      HAAMQVVHFDTPLNAWVRGVNALLPPEVAVWAREVGDDXXXXXXXXXXXXXXXLLTHPVRSKVGWYHQAL
TRUA_CHLTR      HAQGQIAHFHCPDFTDPRMLNALLPHDIVIRDAVMTDEDFHSRFSAIAKEYRYTLLPHHRLFCFSPRYKL
TRUA1_PARUW     HAKGQVAHFHFQDYIDLSSLNGLLPRDIRIKAVEPVSPRFHSQYSAIRKEYHYYLHLNQRLYSWHFQRKI
TRUA_THET8      HALAMPVESAIPVEKVPEALNRLLPEDLKVVGAREVAPDFHARKDALWRAYRYRI---------------
TRUA_THET2      HALAMPVESAIPVEKVPEALNRLLPEDLKVVGAREVAPDFHARKDALWRAYRYRI---------------
TRUA_PROMP      HASGQVIHFDI-DFLIPDVLNSRLPHTIRILESVEVKSSWHACYSAVYRHYRYNLFL-NKWSWHRYQKYL
TRUA_METS3      HSLGNVISFQSEKEVRVNEINNSLPDDIQILAKAPVRFGFKPRY-AEMRQYRYVLF--------------
TRUA_HAEDU      HGTGQVVHFEVERPLASWCFNAHLANDIAVKWAVKVAEDFHARFSATARRYRYIIFAILPKGVAHYHYPL
TRUA_BDEBA      HALNQVCHFSTHRKIDPNALNSHLPPSIVAKKAWIAPDDFHATLSATHKTYRYLIVNKPRPSAHLNRYAI
TRUA_THEEB      HAAGQTVNSPIPVHRWPGILNARLPADVVIRAAAAVPPDWHARFSALWRRYRYTLYTDLRPWTWHYYYAL
TRUA_SHELP      HATGQVVHFETNAVRKESAWNVNLPDDIAVRWAKDVDDEFHXXXXXXXXXXXXHQFRPGRSGVSHYPGQI
TRUA_RHORT      HALGQVAHLDLPAATVMKALNAHLPQPIAVIDAAEVAEDFHARFSAEERSYRY------RILNRIAPPTL
TRUA_PROVI      HARGQVVNFSTRSPLEHHSLNCLLPSSICIPSSQLVPDDFHARFSALERQYRYFIPEPSALRYTGCSHGV
TRUA_PELLD      HALGQVVNFQTASSLEAHSLNCLLPDTIRVDCPQEVDMEFHARFSAAERQYRYFL---------------
TRUA_OENOB      HANGQVINFIFPFDLNEKAINSQLPTDILVKKVEKVPINFNARHSSHRKRYLYRVSTSKFIDPFKRFYTL
TRUA_SINMW      HARGQVAHLDLTRAWKPNALNAHLSERVSILEVEEAAADFDARFSAIRRHYLYRIISPLALEARRAPKAL
TRUA_MYCTU      HASGQVAHVDVPADALPNAYAGHVXADVRILDITRAPAGFDARFSALRRHYVYRLTAPYGVEPTAWPREL
TRUA_MYCBO      HASGQVAHVDVPADALPNAYAGHVXADVRILDITRAPAGFDARFSALRRHYVYRLTAPYGVEPTAWPREL
TRUA_LEUCK      HAFGQVVHFDLPFDINPKGLNTLLPRDILIKAVTKVSDDFHARFSTHAKRYFYRVSTPFKRHYTGHFHHL
TG124_CAEEL     SAFKQTAAYKASGEELPKMLNGVLPKTIRVFAWAPVAQTFNARFDCNRRTYKYS-FAKADLNLE------
TRUA_TREDE      HAARQAVNFRASNFLP--ALNSILPKDIRVMDAAEVSPLLHARFNALSRTYRYKIKCGKTIFAHEQPYTP
TRUA_SYNY3      HAAAQVAHFDDPVGQIPKILNGHLPQDIIVRGSAAVDSHWHARFSALWRRYRYSIY--------------
TRUA_SILPO      HGLGQVAHCDTRDWRLSEALNYHLPQPVAITAAARVAEDWHARFSATERQYLFRLL--MRRAPATHDHRL
TRUA_RHOS1      HATGQVAHCDVREWDPFRALNAHLPLPVAIVAAARVPEEFHARFSAVEXXXXXXXXXXXXPEVHDRPHPL
TRUA_LACLM      HAFGQVIHFDARDLERLRGLDTQTPADIAVKKVELVPDDWHARYQKHEKTYEYYLENSVRHSKAYFRYPL
TRUA_DESMR      HALAQVAHADVPEHRAGKALTALLPKDVAVTEARLVAPDFHSRFDATGKEYRYTLWTPGHVLPWRRPYVW
TRUA_ACTSZ      HGTGQVVHFETEVVRPERAWNANLPDDIAVKWAKTADDEFHARFSATARRYRYLIYTPLRPEGVTHCHPL
TRUA_ACTPJ      HGTGQVVHFETQAIRPLQSWNANLPDDIAVKWAVEVSEDFHARFSATARRYRYIIFSAILPKGVSHYHEL
TRUA_ACTP7      HGTGQVVHFETQAIRPLQSWNANLPDDIAVKWAVEVSEDFHARFSATARRYRYIIFSAILPKGVSHYHEL
TRUA_ACTP2      HGTGQVVHFETQAIRPLQSWNANLPDDIAVKWAVEVSEDFHARFSATARRYRYIIFSAILPKGVSHYHAL
TRUA_TOLAT      NATGQVIHFDTTANRQMSAWNAQLPDDIAVRWAHVVDDNFHARFSATARRYRYIIYEPLRKGVSHYYHPL
TRUA_PYRAE      SAVGNVV-------MTGRKMNSKMPKGAWAWGIAEVPEGFNPRRAKLR---RYLYVAPHWGEDVD-----
TRUA_POLSJ      HGLMQVVHFDTVSWV--RGTNAFLPSDIAVQWAREVPDTFHCRGSAIARRYAYVLESPVRPSVEAGRRPL
TRUA_MOUSE      SAAGQVVSLKV--WLIDDILNSHLPSHIRILGLKRVTGGFNSKNKCDARTYCYMLFAFAHKDRDVQDEAE
TRUA_LACS1      HALGQVVHFDFPHPISARGLNSMLPLDCEVVDCKIVPNDFHSRYTTHGKRYLYRVVNPFKRLYTGHKYPL
TRUA_DESVM      HAEAQVAHMDVPDHRADRAFNAGLPDDISVAAVVRVPDEFHARFDARGKTYTYRLWPERR----------
TRUA_CHLSY      HATGQVAHVQTTTW---RGLNAHLPVDLAIQNVGEAVPDFHARFSAIQREYRYLIDCAARHQVLHYAGTL
TRUA_CHLAA      HATGQVAHVQTTTW---RGLNAHLPVDLAIQNVGEAVPDFHARFSAIQREYRYLIDCAARHQVLHYAGTL
TRUA_BORPA      HAAMQVIHLDTDDESWVRGVNAFLPPSIVVQWARPVSEAFHARFSARSRTYVYLLWR-GRVRPALWAQPL
TRUA_BORBR      HAAMQVIHLDTDDESWVRGVNAFLPPSIVVQWARPVSEAFHARFSARSRTYVYLLWR-GRVRPALWAQPL
TRUA_AGRT5      HAVGQVAHIDSRDWKLRNALNAHLXXXXXXXXXXXXTEDFDARFSALRRHYLYRIICRKSRLALEHKRAL
TRUA_SPHAL      HAIAMRAHVDIEKPLTPEALNAQLPAPIAVIGCEVVPDDWHARFACIGRSYEYRIVNRRAPLTWDKGLAL
TRUA_RHOS4      HASGQVAHCDVREWDPFRALNAHLPLPVAIVAAARVPEEFHARFSAVEXXXXXXXXXXXXPEVHDRPHPL
TRUA_DELAS      HGLMQVVHFDTPSWV--RGTNTFLPPDIAVQWAQPVPDAFHSRACATARRYAYLLQSPVRPSVEAGRHAL
TRUA_CLOCE      HAYGQVAHFKIPGDKFSYAINNLLPDDIVIKNSEEVPEEFHARYSAKGKKYRYLIYNSPHASAIMRNRSL
TRUA_STRSY      HAYGQVIHFDLAGSRDVEALDTQTSEDIDVVSVEQVADDFHCRYAKHSKTYEFLVNPMMRHYATFYPYDL
TRUA_STRS2      HAYGQVIHFDLAGSRDVEALDTQTSEDIDVVSVEQVADDFHCRYAKHSKTYEFLVNPMMRHYATFYPYDL
TRUA_ROSS1      HARGQVANVRTDTRHTVRGLNGILPEDVGVLAAWEAPDDFHARYSAVRREYRYVIYVPRRL-----DTAA
TRUA_LEIXX      HATGQVAHVDSPEQVAKRRVNGVLVPDVLVSRATEAPAGFDARFSALWRRYEYRVADRIALRDPLQRHRV
TRUA_LACLS      HAFGQVIHFDARDLERLRGLDTQTPADIAVKKVELVPDDWHARYQKHEKTYEYYLENSVRHSKAYFRYPL
TRUA_LACLA      HAFGQVIHFDLKGKVRDLGLDTQTPADIAVKKVELVPDDWHARYQKHEKTYEYYLENSQRHSKAYFRYPL
TRUA_HAEPS      HATGQVVHFDTDSWCL--GTNAHLPEDIVVKWAIGVSDDFHARFSALARRYRYVIYSAILPKGISHYHSL
TRUA_METNO      HASHQVVHLDLDEWRTDTATNAHLPEPVSVLSAARVGPDFDARHSALKRHYRYRILALARGYVWHVPWXX
TRUA_HAES1      HATGQVVHFDTKAIRSEKAWNANLPADIAVRWAKVVSEDFHARFSATARRYRYLIYHPLRTGVTHHHVAL
TRUA_CHLAD      HASGQVAHVQATIW---RGLNAHLPTDVTVQNVGEAVRDFHARYSAIEREYRYLICAPVPLPQLRHQGTL
TRUA_BRAHW      HALGQVANFRVPKMLVPIALNSYLDRDLRIIKAEEMPDSFNARASATFREYLYIVHNSSRYAWFYRKNVI
PUS3_HUMAN      SAFGQVISLDLRSQF-PRGLNRVLPPDIRILAWAPVEPSFSARFSCLERTYRY-FFPRADLDIVTMDYAA
TRUA_RHOSK      HATGQVAHCDAREWDPFRALNAHLPLPVAIVAAARVSEEFHARFSAVEXXXXXXXXXXXXPEVHDRPHPL
TRUA_RAT        SAAGQVVSLKV--WLIDDILNSHLPSHIRILGLKRVTGGFNSKNKCDARTYCYMLFAFAHKDRDVQDEAE
TRUA_LACAC      HAIGQVIHFDYPGKEIPAALNSMMPTDIVFTDCQIVDEDFHARYSIKGKWYRYRLVNPFKRFYTGHPYQL
TRUA_HUMAN      SAAGQVVSLKV--WLIDEKINSHLPSHIRILGLKRVTGGFNSKNRCDARTYCYLLFAFAHQDETYRLSAE
TRUA_BRUSU      HATAQVAHVDAKDWGAGKAVNAHLDERISILNVEKTTDTFDARFSARARHYLYRIHNRRAPLAVDYQRAL
TRUA_BRUSI      HATAQVAHVDAKDWGAGKAVNAHLDERISILNVEKTTDTFDARFSARARHYLYRIHNRRAPLAVDYQRAL
TRUA_BRUO2      HATAQVAHVDAKDWGAGKAVNAHLDERISILNVEKTTDTFDARFSARARHYLYRIHNRRAPLAVDYQRAL
TRUA_BRUME      HATAQVAHVDAKDWGAGKAVNAHLDERISILNVEKTTDTFDARFSARARHYLYRIHNRRAPLAVDYQRAL
TRUA_BRUMB      HATAQVAHVDAKDWGAGKAVNAHLDERISILNVEKTTDTFDARFSARARHYLYRIHNRRAPLAVDYQRAL
TRUA_BRUC2      HATAQVAHVDAKDWGAGKAVNAHLDERISILNVEKTTDTFDARFSARARHYLYRIHNRRAPLAVDYQRAL
TRUA_BRUAB      HATAQVAHVDAKDWGAGKAVNAHLDERISILNVEKTTDTFDARFSARARHYLYRIHNRRAPLAVDYQRAL
TRUA_BRUA2      HATAQVAHVDAKDWGAGKAVNAHLDERISILNVEKTTDTFDARFSARARHYLYRIHNRRAPLAVDYQRAL
TRUA_STRCO      HARGQVAHVDLPRWAEHKRLAGRLPRDVRVWALREAPSGFNARFSAVWRRYAYRVTNPGGVDPLWHDWPL
TRUA_MARMM      HALAQVAHLDAKDLSTDKAINYHLPDPVAVIEAARVSDDFHARFSATRRHYLYRMIAPLTLDRGQVTRKL
TRUA_JANMA      HGLEQVVHFDTSSWV--RGVNTFLPPSIAVWATPDEQDNFHARFSARSRMYQYVLYNPVRSPLLEGKRKL
TRUA_AGRVS      HASGQVAHVDLRQWIPYKALNAHLAQAISILAAEAVPDAFDARFSALKRHYLYRIMSPSRLALEANSKPL
TRUA_ROSCS      HARGQVVSTNTRHSLATRGLNGVLPEDIGILAAWEVPEEFHARYSAVRREYRYVIYVPRRLDVAAMDRAI
TRUA_RHOP5      HALAQVAHCDVPKQLPPDALNAHLPQPIGVITAEIVPDDFEARFSAIKRHYVYRISXXXXXXXXXXPRRL
TRUA_RHISN      HAMGQVAHLDTREWKTXXXXXXXXXERVSILDAAEVPPEFDARFSAIRRHYLYRIISPLALEARRAPKTL
TRUA_PARL1      HALGQVVDFEAPDTLRD-AVNAHMPHPVAIVEAEEVPDSFEARFSAVKRHYMYRIVNRRAPLTLDRGQAL
TRUA_ONYPE      HSQGQTLHFQTTFFLKPTHFNYLLPPDIRVRQMNFATPNFHARYSAKSKIYQY-VFSKKPLNAFNHHFQI
TRUA_METPP      HALNQVVHLDTEIEREPRGTNRYLPPDIAVQWCRPVDAAFHARNSARGRRYAY-LLLESPVRPAIEAGAV
TRUA_LYSSC      HATGQTLHFDTPLAIPTKALNVQLPRDIRVLSVEEVAHDFHA