[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for hlac0:ACM57526.1

[Show Plain Result]


## Summary of Sequence Search
    1::192
  404::495     3e-04  30%  709 aa  EFG_BIFAA RecName: Full=Elongation factor G;         Short=EF-G;
  404::495     0.001  30%  709 aa  EFG_BIFA0 RecName: Full=Elongation factor G;         Short=EF-G;
    1::192

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDEKETVT
EFG_BIFAA       ---------------------------------------------------------------DEKSPIS
EFG_BIFA0       ---------------------------------------------------------------DEKHPIS


                         .         .         *         .         .         .         .:140
query           VETTADGEQTYRRWGEFRLEIDGETVTLQAYRPTDGADRFWVPFRDETSGETTYGAGRYLDLEPDRDRVD
EFG_BIFAA       LESMTFPDPVIEVAVEPKTKADQEKMSIALAKLSDEDPTFQVK-TDEESGQTLISGMGELQLDIIVDRMR
EFG_BIFA0       LESMTFPDPVIEVAVEPKTKADQEKMSLALAKLSDEDPTFQVK-TDEESGQTLISGMGELQLDIIVDRMR


                         +         .         .         .         .         *         .:210
query           GEWVVDCNVAYNPTCAYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
EFG_BIFAA       REFKVECNVG-NPQVAY-----------------------------------
EFG_BIFA0       REFKVECNVG-KPQVAY-----------------------------------