[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for hlac0:ACM56614.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cbgA.bssp"
#ERROR : Can't open dsspfile "2avdA.bssp"
#ERROR : Can't open dsspfile "3eeyA.bssp"
#ERROR : Can't open dsspfile "3eeyI.bssp"
#ERROR : Can't open dsspfile "3a25A.bssp"
#ERROR : Can't open dsspfile "2br5A.bssp"
#ERROR : Can't open dsspfile "3eeyG.bssp"
#ERROR : Can't open dsspfile "3eeyB.bssp"
#ERROR : Can't open dsspfile "2br5C.bssp"
#ERROR : Can't open dsspfile "3dr5A.bssp"
#ERROR : Can't open dsspfile "3c3pC.bssp"
#ERROR : Can't open dsspfile "2an3A.bssp"
#ERROR : Can't open dsspfile "2br4A.bssp"
#ERROR : Can't open dsspfile "3c3yA.bssp"
#ERROR : Can't open dsspfile "3e05C.bssp"
#ERROR : Can't open dsspfile "2br5D.bssp"
#ERROR : Can't open dsspfile "3eeyC.bssp"
#ERROR : Can't open dsspfile "3c3pA.bssp"
#ERROR : Can't open dsspfile "2br5F.bssp"
#ERROR : Can't open dsspfile "3eeyF.bssp"
#ERROR : Can't open dsspfile "1cmvB.bssp"
#ERROR : Can't open dsspfile "1aqjA.bssp"
#ERROR : Can't open dsspfile "2br4F.bssp"
#ERROR : Can't open dsspfile "2br3B.bssp"
#ERROR : Can't open dsspfile "3egiD.bssp"
#ERROR : Can't open dsspfile "2br3A.bssp"
#ERROR : Can't open dsspfile "3e05H.bssp"
#ERROR : Can't open dsspfile "2a14A.bssp"
#ERROR : Can't open dsspfile "2br3D.bssp"
#ERROR : Can't open dsspfile "3e05E.bssp"
#ERROR : Can't open dsspfile "1dl5A.bssp"
#ERROR : Can't open dsspfile "3c6kD.bssp"
#ERROR : Can't open dsspfile "3dulB.bssp"
#ERROR : Can't open dsspfile "1dctA.bssp"
#ERROR : Can't open dsspfile "3e05F.bssp"
#ERROR : Can't open dsspfile "2as0A.bssp"
#ERROR : Can't open dsspfile "2br3F.bssp"
#ERROR : Can't open dsspfile "3b3gA.bssp"
#ERROR : Can't open dsspfile "3dulA.bssp"
#ERROR : Can't open dsspfile "1dusA.bssp"
#ERROR : Can't open dsspfile "3e05A.bssp"
#ERROR : Can't open dsspfile "3c6kC.bssp"
#ERROR : Can't open dsspfile "1eg2A.bssp"
#ERROR : Can't open dsspfile "3c6kA.bssp"
#ERROR : Can't open dsspfile "2cmgA.bssp"
#ERROR : Can't open dsspfile "3e05G.bssp"
#ERROR : Can't open dsspfile "2ar0B.bssp"
#ERROR : Can't open dsspfile "3e7pA.bssp"
#ERROR : Can't open dsspfile "2bm8K.bssp"
#ERROR : Can't open dsspfile "3egiB.bssp"
#ERROR : Can't open dsspfile "3e05D.bssp"
#ERROR : Can't open dsspfile "3c6mB.bssp"
#ERROR : Can't open dsspfile "1booA.bssp"
#ERROR : Can't open dsspfile "2bm9B.bssp"
#ERROR : Can't open dsspfile "3egiA.bssp"
#ERROR : Can't open dsspfile "3busA.bssp"
#ERROR : Can't open dsspfile "2an3B.bssp"
#ERROR : Can't open dsspfile "2bm8B.bssp"
#ERROR : Can't open dsspfile "3e05B.bssp"
#ERROR : Can't open dsspfile "2cl5B.bssp"
#ERROR : Can't open dsspfile "3dxzA.bssp"
#ERROR : Can't open dsspfile "1aqiA.bssp"
#ERROR : Can't open dsspfile "3dp7A.bssp"
#ERROR : Can't open dsspfile "3cjqD.bssp"
#ERROR : Can't open dsspfile "2bt8A.bssp"
#ERROR : Can't open dsspfile "3c6kB.bssp"
#ERROR : Can't open dsspfile "2bm8A.bssp"
#ERROR : Can't open dsspfile "2bm8G.bssp"
#ERROR : Can't open dsspfile "2cl5A.bssp"
#ERROR : Can't open dsspfile "3bwmA.bssp"
#ERROR : Can't open dsspfile "3bgdA.bssp"
#ERROR : Can't open dsspfile "1aqjB.bssp"
#ERROR : Can't open dsspfile "3duwA.bssp"
#ERROR : Can't open dsspfile "3cjtA.bssp"
#ERROR : Can't open dsspfile "3cjrA.bssp"
#ERROR : Can't open dsspfile "3b3fA.bssp"
#ERROR : Can't open dsspfile "3c3pB.bssp"
#ERROR : Can't open dsspfile "3bxoA.bssp"
#ERROR : Can't open dsspfile "3a27A.bssp"
#ERROR : Can't open dsspfile "2an4A.bssp"
#ERROR : Can't open dsspfile "3dliA.bssp"
#ERROR : Can't open dsspfile "2br5E.bssp"
#ERROR : Can't open dsspfile "2e58A.bssp"
#ERROR : Can't open dsspfile "3cggA.bssp"
#ERROR : Can't open dsspfile "2admA.bssp"
#ERROR : Can't open dsspfile "2b9eA.bssp"
#ERROR : Can't open dsspfile "3bzbB.bssp"
#ERROR : Can't open dsspfile "3busB.bssp"
#ERROR : Can't open dsspfile "2bh2A.bssp"
#ERROR : Can't open dsspfile "2dulA.bssp"
#ERROR : Can't open dsspfile "3dxyA.bssp"
#ERROR : Can't open dsspfile "3dxxA.bssp"
#ERROR : Can't open dsspfile "1d2gA.bssp"
#ERROR : Can't open dsspfile "3bwcB.bssp"
#ERROR : Can't open dsspfile "2e58B.bssp"
#ERROR : Can't open dsspfile "3bzbA.bssp"
#ERROR : Can't open dsspfile "2b2cA.bssp"
#ERROR : Can't open dsspfile "1af7A.bssp"

## Summary of PDB Search
:221
    3e-15  24%  3cbgA  [x.x.x] O-METHYLTRANSFERASE
    1e-13  24%  2avdA  [x.x.x] CATECHOL-O-METHYLTRANSFERASE
    2e-10  15%  3eeyA  [x.x.x] PUTATIVE RRNA METHYLASE
    2e-10  13%  3eeyI  [x.x.x] PUTATIVE RRNA METHYLASE
    3e-10  17%  3a25A  [x.x.x] UNCHARACTERIZED PROTEIN PH0793
    4e-10  13%  2br5A  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    4e-10  13%  3eeyG  [x.x.x] PUTATIVE RRNA METHYLASE
    6e-10  16%  3eeyB  [x.x.x] PUTATIVE RRNA METHYLASE
    6e-10  13%  2br5C  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    2e-09  20%  3dr5A  [x.x.x] PUTATIVE O-METHYLTRANSFERASE
    3e-09  16%  3c3pC  [x.x.x] METHYLTRANSFERASE
    5e-09   8%  2an3A  [x.x.x] PHENYLETHANOLAMINE N-METHYLTRANSFERASE
    5e-09  12%  2br4A  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    6e-09  20%  3c3yA  [x.x.x] O-METHYLTRANSFERASE
    7e-09  20%  3e05C  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    1e-08  11%  2br5D  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    2e-08  14%  3eeyC  [x.x.x] PUTATIVE RRNA METHYLASE
    2e-08  19%  3c3pA  [x.x.x] METHYLTRANSFERASE
    4e-08  10%  2br5F  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    9e-08  15%  3eeyF  [x.x.x] PUTATIVE RRNA METHYLASE
    2e-07  12%  1cmvB  [b.57.1] HUMAN CYTOMEGALOVIRUS PROTEASE
    2e-07  20%  1aqjA  [c.66.1 - d.287.1] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI
    2e-07  14%  2br4F  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    2e-07  13%  2br3B  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    3e-07  19%  3egiD  [x.x.x] TRIMETHYLGUANOSINE SYNTHASE HOMOLOG
    3e-07  12%  2br3A  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    3e-07  20%  3e05H  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    5e-07   9%  2a14A  [x.x.x] INDOLETHYLAMINE N-METHYLTRANSFERASE
    7e-07  12%  2br3D  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    8e-07  20%  3e05E  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    2e-06  15%  1dl5A  [c.66.1 - d.197.1] PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE
    2e-06  17%  3c6kD  [x.x.x] SPERMINE SYNTHASE
    2e-06  25%  3dulB  [x.x.x] O-METHYLTRANSFERASE, PUTATIVE
    2e-06  13%  1dctA  [c.66.1] PROTEIN (MODIFICATION METHYLASE HAEIII)
    3e-06  15%  3e05F  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    3e-06  21%  2as0A  [x.x.x] HYPOTHETICAL PROTEIN PH1915
    4e-06  11%  2br3F  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    4e-06  12%  3b3gA  [x.x.x] HISTONE-ARGININE METHYLTRANSFERASE CARM1
    4e-06  25%  3dulA  [x.x.x] O-METHYLTRANSFERASE, PUTATIVE
    4e-06  10%  1dusA  [c.66.1] MJ0882
    5e-06  18%  3e05A  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    5e-06  17%  3c6kC  [x.x.x] SPERMINE SYNTHASE
    6e-06  17%  1eg2A  [c.66.1] MODIFICATION METHYLASE RSRI
    6e-06  13%  3c6kA  [x.x.x] SPERMINE SYNTHASE
    7e-06   8%  2cmgA  [x.x.x] SPERMIDINE SYNTHASE
    7e-06  19%  3e05G  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    8e-06  10%  2ar0B  [x.x.x] TYPE I RESTRICTION ENZYME ECOKI M PROTEIN
    1e-05  15%  3e7pA  [x.x.x] PUTATIVE METHYLTRANSFERASE
    1e-05  10%  2bm8K  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    1e-05  20%  3egiB  [x.x.x] TRIMETHYLGUANOSINE SYNTHASE HOMOLOG
    1e-05  16%  3e05D  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    1e-05  15%  3c6mB  [x.x.x] SPERMINE SYNTHASE
    1e-05  14%  1booA  [c.66.1] PROTEIN (N-4 CYTOSINE-SPECIFIC METHYLTRANSFERASE
    1e-05  10%  2bm9B  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    1e-05  18%  3egiA  [x.x.x] TRIMETHYLGUANOSINE SYNTHASE HOMOLOG
    1e-05  23%  3busA  [x.x.x] METHYLTRANSFERASE
    1e-05   9%  2an3B  [x.x.x] PHENYLETHANOLAMINE N-METHYLTRANSFERASE
    2e-05  11%  2bm8B  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    3e-05  17%  3e05B  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    3e-05  16%  2cl5B  [x.x.x] CATECHOL O-METHYLTRANSFERASE
    3e-05  12%  3dxzA  [x.x.x] TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE
    3e-05  16%  1aqiA  [c.66.1 - d.287.1] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI
    4e-05   9%  3dp7A  [x.x.x] SAM-DEPENDENT METHYLTRANSFERASE
    7e-05  15%  3cjqD  [x.x.x] RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE
    7e-05   8%  2bt8A  [x.x.x] SIGMA C
    8e-05  15%  3c6kB  [x.x.x] SPERMINE SYNTHASE
    9e-05  12%  2bm8A  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    9e-05  10%  2bm8G  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    1e-04  18%  2cl5A  [x.x.x] CATECHOL O-METHYLTRANSFERASE
    1e-04  16%  3bwmA  [x.x.x] CATECHOL O-METHYLTRANSFERASE
    1e-04  10%  3bgdA  [x.x.x] THIOPURINE S-METHYLTRANSFERASE
    2e-04  14%  1aqjB  [c.66.1 - d.287.1] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI
    2e-04  20%  3duwA  [x.x.x] O-METHYLTRANSFERASE, PUTATIVE
    2e-04  17%  3cjtA  [x.x.x] RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE
    2e-04  14%  3cjrA  [x.x.x] RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE
    3e-04  13%  3b3fA  [x.x.x] HISTONE-ARGININE METHYLTRANSFERASE CARM1
    3e-04  16%  3c3pB  [x.x.x] METHYLTRANSFERASE
    3e-04  12%  3bxoA  [x.x.x] N,N-DIMETHYLTRANSFERASE
    3e-04  14%  3a27A  [x.x.x] UNCHARACTERIZED PROTEIN MJ1557
    4e-04  10%  2an4A  [x.x.x] PHENYLETHANOLAMINE N-METHYLTRANSFERASE
    4e-04  10%  3dliA  [x.x.x] METHYLTRANSFERASE
    4e-04  10%  2br5E  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    4e-04  16%  2e58A  [x.x.x] MNMC2
    4e-04  12%  3cggA  [x.x.x] SAM-DEPENDENT METHYLTRANSFERASE
    5e-04  20%  2admA  [c.66.1 - d.287.1] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI
    6e-04  12%  2b9eA  [x.x.x] NOL1/NOP2/SUN DOMAIN FAMILY, MEMBER 5 ISOFORM 2
    6e-04  16%  3bzbB  [x.x.x] UNCHARACTERIZED PROTEIN
    6e-04  21%  3busB  [x.x.x] METHYLTRANSFERASE
    6e-04  14%  2bh2A  [x.x.x] 23S RRNA (URACIL-5-)-METHYLTRANSFERASE RUMA
    6e-04   8%  2dulA  [x.x.x] N(2),N(2)-DIMETHYLGUANOSINE TRNA
    7e-04  17%  3dxyA  [x.x.x] TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE
    7e-04  17%  3dxxA  [x.x.x] TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE
    7e-04  16%  1d2gA  [c.66.1] GLYCINE N-METHYLTRANSFERASE
    7e-04  22%  3bwcB  [x.x.x] SPERMIDINE SYNTHASE
    7e-04  15%  2e58B  [x.x.x] MNMC2
    8e-04  11%  3bzbA  [x.x.x] UNCHARACTERIZED PROTEIN
    8e-04  18%  2b2cA  [x.x.x] SPERMIDINE SYNTHASE
    8e-04  17%  1af7A  [x.x.x] CHEMOTAXIS RECEPTOR METHYLTRANSFERASE CHER
:221

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDILSDSAERFLAATAPEHTATQVEMAALADDWGFPISGPEAGAVLRLLARLTDAERVFEFGSGFGYSAT
3cbgA           ---FDPSLYSYLQSISADDSFYLAQLRTAHLPGAPMQISPEQAQFLGLLISLTGAKQVLEIGVFRGYSAL
2avdA           --------QYLLSRSMREHPALRSLRLTLEQPQGDSMMTCEQAQLLANLARLIQAKKALDLGTFTGYSAA
3eeyA           -----------------------------------------------IKMFVKEGDTVVDATCGNGNDTA
3eeyI           ---------------------------------------------DYIKMFVKEGDTVVDATCGNGNDTA
3a25A           ---------------------------------------------VRMAKVAKPDELVVDMFAGIGHLSL
2br5A           ----------PLDRWAEAPRDLGYSDFSPYQWRGLRMLDPDTQAVYHDMLWELRPRTIVELGVYNGGSLA
3eeyG           ---------------------------------------------DYIKMFVKEGDTVVDATCGNGNDTA
3eeyB           ---------------------------------------------DYIKMFVKEGDTVVDATCGNGNDTA
2br5C           ----------PLDRWAEAPRDLGYSDFSPYQWRGLRMLDPDTQAVYHDMLWELRPRTIVELGVYNGGSLA
3dr5A           -----------------------------------------------------------AITPAAGLVGL
3c3pC           IPIVDSRIGAYLDGLLPEADPVVAAEQ-IARERNIPIVDRQTGRLLYLLARIKQPQLVVVPGDGLGCASW
2an3A           --------------------------RGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQL
2br4A           --------DWPLDRWAEAPRDLGYSDFSPYQWRGLRMLDPDTQAVYHDMLWELRPRTIVELGVYNGGSLA
3c3yA           -----------------------------SHPDSYMSTSPLAGQLMSFVLKLVNAKKTIEVGVFTGYSLL
3e05C           --------------------------DDEFATAKKLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSI
2br5D           -VLTDRPRDWPLDRWAEAPRDLGYSFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLA
3eeyC           ---------------------------------------------DYIKMFVKEGDTVVDATCGNGNDTA
3c3pA           -PIVDSRIGAYLDGLLPEADPVVAAEQI-ARERNIPIVDRQTGRLLYLLARIKQPQLVVVPGDGLGCASW
2br5F           ------------------------DFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLA
3eeyF           ---------------------------------------------DYIKMFVKEGDTVVDATCGNGNDTA
1cmvB           INHDDTAVVGHVAASVRDGLFCLGCVTSPRFLEIVRRASEKSELVSRGPVSPLQPDKVVEFLSGSYAGLS
1aqjA           ---------------------------------------PEVVDFMVSLAEAPRGGRVLEPACAHGPFLR
2br4F           --------------------------SPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLA
2br3B           --------------------------SPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLA
3egiD           ------------------------------EGWFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCGVGGNTI
2br3A           ----------PLDRWAEAPRDLGYSDFSPYQWRGLRMLDPDTQAVYHDMLWELRPRTIVELGVYNGGSLA
3e05H           --------------------------DDEFATAKKLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSI
2a14A           ------------------------SFDGSPSPEAEMLKFNLECLHKTFGPGGLQGDTLIDIGSGPTIYQV
2br3D           --------------------------SPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLA
3e05E           --------------------------DDEFATAKKLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSI
1dl5A           ---------------------------------YSTSSQPSLMALFMEWVGLDKGMRVLEIGTGYNAAVM
3c6kD           --------------------------------------------------------DVLILGGGDGGILC
3dulB           ---------------------------NAAANLPAHDVSPTQGKFLQLLVQIQGARNILEIGTLGGYSTI
1dctA           --------------------------------------------------------NLISLFSGAGGLDL
3e05F           --------------------------DDEFATAKKLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSI
2as0A           --------------------------------QKTGFFLDQRENRLALEKWVQPGDRVLDVFTYTGGFAI
2br3F           --------------------------SPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLA
3b3gA           ---------------------------------------GTYQRAILQNHTDFKDKIVLDVGCGSGILSF
3dulA           ---------------------------NAAANLPAHDVSPTQGKFLQLLVQIQGARNILEIGTLGGYSTI
1dusA           ------------------------------------FSYGKVDKGTKILVENVVVDKILDLGCGYGVIGI
3e05A           --------------------------DDEFATAKKLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSI
3c6kC           --------------------------------------------------------DVLILGGGDGGILC
1eg2A           -------------------------------RVGHPTQKPAAVIERLVRALSHPGSTVLDFFAGSGVTAR
3c6kA           --------------------------------------------------------DVLILGGGDGGILC
2cmgA           -------------------------------------------LAHMGGCTKKELKEVLIVDGFDLELAH
3e05G           --------------------------DDEFATAKKLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSI
2ar0B           ---------------------------------WQYFTPRPLIKTIIHLLKPQPREVVQDPAAGTAGFLI
3e7pA           -----------------------------------PGSPEVTLKALSFIDNLTNKSLIADLGCGTGGQTM
2bm8K           --------------------------SPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLA
3egiB           --------------------------KLDREGWFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCGVGGNTI
3e05D           --------------------------DDEFATAKKLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSI
3c6mB           -------------------------------------------------------KDVLILGGGDGGILC
1booA           ------------------------------GIKAHPARFPAKLPEFFIRMLTEPDDLVVDIFGGSNTTGL
2bm9B           --------------------------SPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLA
3egiA           ------------------------------EGWFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCGVGGNTI
3busA           ------------------------------EDAGADVSVDDATDRLTDEIALLDVDRVLDVGCGIGKPAV
2an3B           ---------------------------------------------QTFATGEVSGRTLIDIGSGPTVYQL
2bm8B           -VLTDRPRDWPLDRWAEAPRDLGYSFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLA
3e05B           --------------------------DDEFATAKKLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSI
2cl5B           --------QQNAKPGDPQSVLEAIDTYCTQKEWAMNVG-DAKGQIMDAVIREYSPSLVLELGAYCGYSAV
3dxzA           ---------------------------------------EFSEDMLDFPALGREAPVTLEIGFGMGASLV
1aqiA           ---------------------------------------PEVVDFMVSLAEAPRGGRVLEPACAHGPFLR
3dp7A           ------------------------QVQKSWFGFDHFYSDQSFGKALEIV-FSHHPKRLLDIGGNTGKWAT
3cjqD           -------------------------------------------------------DKVLDLGTGSGVLAI
2bt8A           ------------------------------------------------SLDMDPYFCSQRVSLTSYSAEA
3c6kB           --------------------------------------------------------DVLILGGGDGGILC
2bm8A           -------------------------FSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLA
2bm8G           --------------------------SPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLA
2cl5A           -DTKEQRILRYVQQNAKPGDPQSVLEAYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAV
3bwmA           -DTKEQRILNHVLQHAEPGNAQSVLEAICEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAV
3bgdA           -----------------------------HISFHQEQGHQLLKKHLDTFLKGQSGLRVFFPLCGKAIEMK
1aqjB           ---------------------------------------PEVVDFMVSLAEAPRGGRVLEPACAHGPFLR
3duwA           ---------------------------NAAANLPAHDVSPTQGKFLQLLVQIQGARNILEIGTLGGYSTI
3cjtA           ---------------------------------------ETTRLALKALARLRPGDKVLDLGTGSGVLAI
3cjrA           -------------------------------------------------------DKVLDLGTGSGVLAI
3b3fA           --------------------------GYLSQQQNMMQDYVRTGTYQRAILQNHTDKIVLDVGCGSGILSF
3c3pB           ----------------------------IARERNIPIVDRQTGRLLYLLARIKQPQLVVVPGDGGCASWW
3bxoA           ----------------------------------------------LVRSRTPEASSLLDVACGTGTHLE
3a27A           ------------------------------DVAKIMWSQGNIEERKRMAFISNENEVVVDMFAGIGYFTI
2an4A           ---------------------------------------------QTFATGEVSGRTLIDIGSGPTVYQL
3dliA           ------------------------------EEKFRGSRELVKARLRRYIPYFKGCRRVLDIGCGRGEFLE
2br5E           --------------------------SPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLA
2e58A           ---------------------------------------FVRPSRILEKAKERKVIRILDVGFGLGYNLA
3cggA           ----------------------------------LAAAGNDIYGEARLIDAAPRGAKILDAGCGQGRIGG
2admA           ---------------------------------------PEVVDFMVSLAEAPRGGRVLEPACAHGPFLR
2b9eA           ---------------------------------GHLILQDRASCLPAMLLDPPPGSHVIDACAAPGNKTS
3bzbB           ---------------------------------------------LCWQPELIAGKTVCELGAGAGLVSI
3busB           -------------------------------WESVDDATDRLTDEIALL-DVRSGDRVLDVGCGIGKPAV
2bh2A           ------------------------------FIQVNAGVNQKMVARALEWLDVQPEDRVLDLFCGMGNFTL
2dulA           ------------------------------PPVFYNPRMALNRDIVVVLLNILNPKIVLDALSATGIRGI
3dxyA           -----------------------------------------------------EAPVTLEIGFGMGASLV
3dxxA           ----------------------EHALENYWPVMGVEFS-EDMLDFPALFGR--EAPVTLEIGFGMGASLV
1d2gA           ---------------------------WQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSI
3bwcB           ------------------------------------------------LCSHPKPERVLIIGGGDGGVLR
2e58B           --------------------------------IRESLYKFVRPSRILEKAKERKVIRILDVGFGLGYNLA
3bzbA           -------------------------------QVQTTSGARALADTLCWQPELIAGKTVCELGAGAGLVSI
2b2cA           -------------------------------------------LAHLPMFAHPDPKRVLIIGGGDGGILR
1af7A           ----------------------------------------------------SDIDTEVLEKARSGIYRL


                         .         .         *         .         .         .         .:140
query           WFLRGGADAVICAEFDEEEAKRGVQFAADGGYADSVTFEVGDAMETIERYDGPFDVVLIDHLKGRYADAY
3cbgA           AMALPPDGQIIACDQDPNATAIAKKYWQKAGVAEKISLRLGPALATLEQLTQEFDLIFIDADKRNYPRYY
2avdA           LALPADGR-VVTCEVDAQPPELGRPLWRQAEAEHKIDLRLKPALETLDELLAAGDVAVVDADKENCSAYY
3eeyA           FLASLVGENGRVFDIQDKAIANTTKKLTDLNLIDRVTLIKDGHQNMDKYIDCPVKAVMFNSISTRPETTI
3eeyI           FLASLVGENGRVFDIQDKAIANTTKKLTDLNLIDRVTLIKDGHQNMDKYIDCPVKAVMFNRPETTIQALS
3a25A           PIAVYGKAKVIAIEKDPYTFKFLVENIHLNKVEDRMSAYNMDNRDFP--GENIADRILMGYV-VRTHEFI
2br5A           WFRDLTKIMGIDCQVIGIDRDL-SRCQIPASDMENITLHQGDCSDLTTFREMAHPLIFIDNAHANTFNIM
3eeyG           FLASLVGENGFGFDIQDKAIANTTKKLTDLNLIDRVTLIKDGHQNMDKYIDCPVKAVMFNLGETTIQALS
3eeyB           FLASLVGENVFGFDIQDKAIANTTKKLTDLNLIDRVTLIKDGHQNMDKYIDCPVKAVMFNSISTRPETTI
2br5C           WFRDLTKIMGIDCQVIGID-RDLSRCQIPASDMENITLHQGDCSDLTTFREMAHPLIFIDNAHANTFNIM
3dr5A           YILNADNTTLTCIDPESEHQRQAKALFREAGYSPSRVRFLLSRPDVSRLANDSYQLVFGQVSPDLKALVD
3c3pC           WFRAISISSRVVIDPDRDNVEHARRLHDNGLIDRVELQVGDPLGIAAGQRDIDILFDCDVFNGADVLERN
2an3A           LSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPI
2br4A           WFRDLTKIMGIDCQVIGIDRDLSRCQIPASDMETLHQGDCSDLTTFEHLREMAHPLIFIDDAHANTFNIM
3c3yA           LTALPDDGKITAIDFDREAYEIGLPFIRKAGVEHKINFIESDAMDNLLQGQESEGSYFVDADKPNYIKYH
3e05C           EASNLMPNGRIFALERNPQYLGFIRDNLKKFVARNVTLVEAFAPEGLDDLP-DPDRVFIGGSGGMLEEII
2br5D           WFRDLTKIMGIDCQVIGIDRDLSRCQIPASDMEN--ITLHQGDCTFEHLREMAHPLIFIDNHANTFNIMK
3eeyC           FLASLVGENVFGFDIQDKAIANTTKKLTDLNLIDRVTLIKDGHQNMDKYIDCPVKAVMFNRPETTIQALS
3c3pA           WFARAISISSRVVIDPDRDNVEHARRLHDNGLIDRVELQVGDPL------GIAAGQRDIDDCDVFNGADV
2br5F           WFRDLTKIMGIDCQVIGIDRDLSRCQIPASDM-----ENITLHQGDCHLREMAHPLIFIDNAHANTNIMK
3eeyF           FLASLVGENGRVFGFDDKAIANTTKKLTDLNLIDRVTLIKDGHQNMDKYIDCPVKAVMFNRPETTIQALS
1cmvB           LSKHSVGRRRGTLAVYGRDPEWVTQRFPDLTAAD-RDGLRAQWQRGDPF-RSDSYGLLGNSVDALYIRER
1aqjA           AFREGTGYRFVGVEIDPKALDLPPWAEGILA--DFLLWEPGEAFD-LILGNPPYGIVAVKDLYKKAFS--
2br4F           WFRDLTKIMGIDCQVIGIDLSRCQIPASDMENITLHQGDCSDLTTFEHLREMAHPLIFIDDHANTFNIMK
2br3B           WFRDLTKIMGIDCQVIGIDRDLSRCQIPDMENITLHQGDCSDLTTFEHLREMAHPLIFIDDHANTFNIMK
3egiD           QFALTGRVIAIDIDPVKIALAR--NNAEVYGIADKIEFICGDFLLSPPWGAETFDIRTSPDGFLPRNADI
2br3A           WFRDLTKIMGIDCQVIGIDRDLSRCQIPAMENITLHQGDCSDLTTFEHLREMAHPLIFIDDAHANTFNMK
3e05H           EASNLMPNGRIFALERNPQYLGFIRDNLKKFVARNVTLVEAFAPEGLDDLP-DPDRVFIGGSGGMLEEII
2a14A           LAACDSFQDITLSDFTDRNREELEKWLKKEPGAYDWTPAVKFACELEGNSG-RWEEKEE-----------
2br3D           WFRDLTKIMGIDCQVIGIDRDLSRCQIPASDMITLHQGDCSDLTTFEHLREMAHPLIFIDDHANTFNIMK
3e05E           EASNLMPNGRIFALERNPQYLGFIRDNLKKFVARNVTLVEAFAPEGLDDLP-DPDRVFIGGSGGMLEEII
1dl5A           SRVVGEKGLVVSVEYSRKICEIAKRNVERLGIENVIFVCGDG--YYGVPEFSPYDVIFVTVGVDEVPETW
3c6kD           EIVKLKPKMVTMVEIDQMVIDGCKKYVLDNLKGDCYQVLIEDCIPVLKRYGREFDYVINDSTWEFLRLIL
3dulB           WLARSSGGRVVTLEASEKHADIARSNIERANLNDRVEVRTGLALDSLQQIEEPFDFIFIDADKQNNPAYF
1dctA           GFQKAGFRIICANEYDKSIWKTYESNHSAKLIKGDISKISSDEFPKCDGIIGGPPCQSWSE---------
3e05F           EASNMPNGRIFALERNPQYLGFIRDNLKKFVARNVTLV--EAFAPEGLDDLPDPDRVFIGGSGGMLEEII
2as0A           HAAIAGADEVIGIDKSPRAIETAKENAKLNGVEDRKFIVGSAFEEKLQKKGEKFDIVVLDAGLRAYFNVN
2br3F           WFRDLTKIMGIDCQVIGIDRDLSRCQIPMENITLHQGDCSDLTTF-EHLREMAHPLIFIDDHANTFNIMK
3b3gA           FAAQAGAR-KIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLPDIIISEPMGYMLFNERMLESY
3dulA           WLARSSGGRVVTLEASEKHADIARSNIERANLNDRVEVRTGLALDSLQQIEEPFDFIFIDADKQNNPAYF
1dusA           ALADEVK--STTADINRRAIKLAKENIKLNNLDNYDIRVVHSDLYENVKDRKYNKIIPIRAGKEVLHRII
3e05A           EASNLMPNGRIFALERNPQYLGFIRDNLKKFVARNVTLVEAF-APEGLDDLPDPDRVFIGGSGGMLEEII
3c6kC           EIVKLKPKMVTMVEIDQMDGCKKYMRKLDNLKGDCYQVLIEDCIPVLKRYGREFDYVINDLTAVPISTSL
1eg2A           VAIQEGRN-SICTDAAPVFKEYYQKQLTFLRSYEIVEGAANFGAA-------------------------
3c6kA           EIVKLKPKMVTMVEIDQMVIDGCKKYMRKVLDNDCYQVLIEDCIPVLKRYGREFDYVINDLTWEFLRLIL
2cmgA           QLFKYDTHIDFV-QADEKILDSFISFFPHFHEVK-NNKNFTHAKQLLDLDIKKYDLIFCLQ--EPDIHRI
3e05G           EASNLMPNGRIFALERNPQYLGFIRDNLKKFVARNVTLVEAFAPEGLDDLPDPDRVFIGGSG-GMLEEII
2ar0B           EADRYVKSQFIGLELVPGTRRLALNCLLHDIEGNLDHGGAIRLGNTLGSDLPKAHIVATNPPFGSAAGTN
3e7pA           ILAQHVPGKITGIDFFPGFIERFNKNAEKLNLQNRVKGIVGS-MDDLSFEKDSLDLIWSEGAIYGFERGL
2bm8K           WFRDLTKIMGIDCQVIGIDRDLSRCQIPASDMENITLHQGDCSDLTTFEHLREMAIFIDNAHANTFNIMK
3egiB           QFALTG--RVIAIDIDPVKIALARNNAEVYGIADKIEFICGDFLL-------------------------
3e05D           EASNLMPNGRIFALERNPQY---LGFIRDNLKKFVARNVTLVEAF-APEGLDDLPDPDRVGSGGMLEEII
3c6mB           EIVKLKPKMVTMVEIDQMYMRKTCGDVLDNLKGDCYQVLIEDCIPVLKRYGREFDYVINDLTWEFLRLIL
1booA           VAERESRK-WISFEMKPEYVAASAFRFLDNNISE---EKITDIYNRILN-GESLDLNSI-----------
2bm9B           WFRDLTKIMGIDCQVIGIDRDLSRCQIPASDMENITLHQGSDLTTFEHLREMAHPIFIDNAHANTFNIMK
3egiA           QFAL--TGRVIAIDIDPVKIALARNNAEVYGIADKIEFICGDFLL--LASFLKADVVFLSTAETFDIRTS
3busA           RLATARDVRVTGISISRPQVNQANARATAAGLANRVTFSYAD--ADLPFEDASFDAVWALELHHPDRGRA
2an3B           LSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGE-------------------
2bm8B           WFRDLTKIMGIVIGIDRDLSRCQIPASDMENITLHQGDCSDLTTFEHL-REMAHPLIFIDNAHANTFNIM
3e05B           EASNLMPNGRIF---ALERNPQYLGFIRDNLKKFVARNVTLVEAF-APEGLDDLPDPFIGGSGGMLEEII
2cl5B           RMARQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLTLDMVFLDHWKDRYLPDTLL
3dxzA           AMAKDRPEQDFLGIEVHSPGVGACLASAHEEGLSNLRVMCHDEVLHKMIPDNSLRMVQLFFRRIVQVPFA
1aqiA           AFREGTGYRFVGVEIDPKALDLPPWAEGILADFLLWEPGEAFDLILGNPPIVKAVKDLYKGKYNLYGAFL
3dp7A           QCVQYNKEVEVTIVDLPQQLEMMRKQTAGLSGSERIHGHGANLLDRDVPFPTGFDAFLDCFSEEEVISIL
3cjqD           AAEKLG-GKALGVDIDPMVLPQAEANAKRNGVRPRFLEG----SLEAALPFGPFDLLVANLYAELHAALA
2bt8A           QLMQFRWMARDTIDMTVNAHCHGRRTDYMMSSTGNLTVTSNVVLLTFDLSDITSDLARLVPSAGFQAASF
3c6kB           EIVKLKPKMVTMVEIDQMVIDGCKKYMRKVLDNDCYQVLIEDCIPVLKRYGREFDYVINDLTWEFLRLIL
2bm8A           WFRDLTKIMGIDCQVIGIDRDLSRCQIPASDMENIHQGDCSDLTTFEHLREMAHPLIFIDNHANTFNIMK
2bm8G           WFRDLTKIMGIDCQVIGIDRDLSRCQIPASDMENITLHQGDCSDLTTFEHLREMAIFIDNAHANTFNIMK
2cl5A           RMARLLQPGLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPKYDVDTLDMDHWKDRYLPDTLL
3bwmA           RMARLLSPGARLITIEINPRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDLPDTLL
3bgdA           WFADRGHTVVGVEISEIGIREFFAEQNLSYTEEPLAEIAGAKVFKS------------------------
1aqjB           AFREGTGYRFVGVEIDPKALDLPPWAEGILADFLLWEPGEAFDLILGNYGIVFKAVKDLYK---------
3duwA           WLARSSGGRVVTLEASEKHADIARSNIERANLNDRVEVRTGLALD-SLQQIENEKYIFIDADKQNNPAYF
3cjtA           AAEKLGGK-ALGVDIDPMVLPQAEANAKRNGVRPRFLE----GSLEAALPFGPFDLLVANLYAELHAALA
3cjrA           AAEKLGGK-ALGVDIDPMVLPQAEANAKRNGVRPRFLEGSLEAALPFGPFDLLVANLYAELHAALAPRYR
3b3fA           FAAQAGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEESLPEQVDIISEPMGYMLFNERMLESY
3c3pB           FARAISISSRVVIDPDRDNVEHARRLHDNGLIDRVELQVGDPLGIAAG--QRDIDILFDCD--VFNGADV
3bxoA           HFTKEFGD-TAGLELSEDMLTHARKRLPDATLHQGDMRDFRLGRKFSAVVSMFSSVGYLKTTEELG-AAV
3a27A           PLAKYSKPKLVYAIEKNPTAYHYLCENIKLNKLNNVIPILADNR-DVELKDVADRV--IMGYVHKTHKFL
2an4A           LSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKE-------------
3dliA           LCKEEGIESIGVDINEDMIK----FCEGKFNVVKSDAIEYLKSLPDKYLDGVMISHFVEHLDPERLFELL
2br5E           WFRDLTKIMGIDCQVIGIDRDLSRCQIPASDMENITLHQGDCSDLTTFLREMAHPLIIDNAHANTFNIMK
2e58A           VALKHLWEVVEIISFEKELLKEFPILPEPYREIHEFLLERVPEY--------------------------
3cggA           YLSKQGHDVLGT-DLDPILIDYAKQDFPEARWVVGDLSV--DQISETDFDLIVSAGNVGFLAEDGREPAL
2admA           AFREAHGTGYRFVGVEIDPKALDLPPWAEGILADFLLWEPGEAFD-LILGNPPYGIVGWKGKYNLYGAFL
2b9eA           HLAALLKNQIFAFDLDAKRLASMATLLARAGVSCCELAEEDSDPRYHEVHYILLDPSCSGVRLHALAGRA
3bzbB           VAFLAGADQVVATDYPDPEILNSLESNIREHRASPKVVPYRWGDSPDSLGLQRFQVVLLASFHQAHDALL
3busB           RLATARDVRVTGISISRPQVNQANARATAAGLANRVTFSYADADLPFE--DASFDAVWALELHHPDRGRA
2bh2A           PLATQAAS-VVGVEGVPALVEKGQQNARLNGLQNVTFYHENLEEDVTK--QPWAKNGFDKVLLDPARAGA
2dulA           RFALETPAEEVWLDISEDAYELMKRNVMLNFDGE-LRESKGRAIL-KGEKTIVINHDDAN----------
3dxyA           AMAKDRPEQFLGIEVHSPGVGACLASAHEEGLSNLRVM-CHDAVEVLHKMDNSLRMVQLRHNKRRQVPFA
3dxxA           AMAKDRPEQFLGIEVHSPGVGACLASAHEEGLSNLRVM-CHDAVEVLHKMDNSLRMVQLFF---------
1d2gA           MLVEEGFSVTSVDASDKKYALKERRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNDQSEHRLAL
3bwcB           EVLRGTVEHCDLVDIDGEVEQSKQHFPQISRSLADATVRVGDGLAFVRQTPDNTYDVVIIDTEAFYKDVL
2e58B           VALKHLWEVVEIISFEKELLKEFPILPEPYREIHEFLLERVPEYEGERLSL-------------------
3bzbA           VAFLAGADQVVATDYPDPEILNSLESNIREHTAASPKVVPYRWGDSPDSLQRCTGLQRFQVVLLADLLSF
2b2cA           EVLKHESVEVTMCEIDEDVAKKFLPGMSCGFSHPKLDLFCGDGFEFLKNHKNEFDVIITDS------SYY
1af7A           SELKTLSPQQLQRYFMRGTGPHEGLVRVRQELANYVEFSSVNLLEKQYNVPGPFDAIFCRNVKTTQEDIL


                         +         .         .         .         .         *         .:210
query           RAVLPKVRTGGVIVADNITRGPIDFGDLVAHFEDGAPLPDPEVDGETRGIGEYVGTVRSDEAVETAILPV
3cbgA           EIGLNLLRRGGLMVIDNVLW-------------HGKVTEVDPQEAQTQVLQQFNRDLAQDERVRISVIPL
2avdA           ERCLQLLRPGGILAVLRVLW-------------RGKVLQPPKGDVAAECVRNLNERIRRDVRVYISLLPL
3eeyA           QAAMELLVTGGII---------------------------------------------------------
3eeyI           K-AMELLVTGGII---------------------------------------------------------
3a25A           PKALSIAKDGAIIHYHNTVPEKLMPREPFETFKRIT----------------------------------
2br5A           WAVDHLLEEGDYFIIEDMIPYWYRYAP-------------------------------------------
3eeyG           K-AMELLVTGGII---------------------------------------------------------
3eeyB           QAAMELLVTGGII---------------------------------------------------------
2br5C           WAVDHLLEEGDYFIIEDMIPYWYRYAP-------------------------------------------
3dr5A           AAWPLLRRGGALVLADALL--------------DGTIADQTRKDRDTQAARDADEYIRSIEGAHVARLPL
3c3pC           RCLAK----NALLIAVNALRRGLR----------------------------------------------
2an3A           DVHQPQ----------------------------------------------------------------
2br4A           WAVDHLLEEGDYFIIEDMIPYWYRYAEYLGAFRDVLSMDM------------------------------
3c3yA           ERLMKLVKVGGIVAYDNTLWGG--------TVAQPESEVPDFMKENREAVIELNKLLAADPRIEIVHLPL
3e05C           DAVDRRLKSEGVIVLNAVTL--------------------------------------------------
2br5D           WAVDHLLEEGDYFIIEDMIPYA------------------------------------------------
3eeyC           K-AMELLVTGGII---------------------------------------------------------
3c3pA           LERNRCLAKNALLIAVNALR-RGALREFNHHLSR-----RRDFFTTIVPVGNGVLLGY------------
2br5F           WAVDHLLEEGDYFIIEDMIPY---------WYRYAPQLFSEYLGAFRDVLSMDMLYANASSQLDRGVL--
3eeyF           K-AMELLVTGGII---------------------------------------------------------
1cmvB           LPKL---RYDKQLVG-------------------------------------------------------
1aqjA           ----------------------------------------------------------------------
2br4F           WAVDHLLEEGDYFIIEDMIP--------------------------------------------------
2br3B           WAVDHLLEEGDYFIIEDMIP--------------------------------------------------
3egiD           DQVASLAGPGGVEIEQNFLNNKLK--TITAYFGD------------------------------------
2br3A           WAVDHLLEEGDYFIIEDMIPYWYRYAEYLGAFRDVLSMDM------------------------------
3e05H           DAVDRRLKSEGVIVLNAVTLDTLTK---------------------------------------------
2a14A           ----------------------------------------------------------------------
2br3D           WAVDHLLEEGDYFIIEDMIP--------------------------------------------------
3e05E           DAVDRRLKSEGVIVLNAVTLDT------------------------------------------------
1dl5A           FTQL---KEGGRVIVPINLKLSRRQPAFLFKKKDP-----------------------------------
3c6kD           DLSMKVLKQDGKYFT-------------------------------------------------------
3dulB           EWALKLSRPGTVIIGDNVVREGEVIIRRFYEL--------------------------------------
1dctA           ----------------------------------------------------------------------
3e05F           DAVDRRLKSEGVIVL--NAVTLDTLTKAVEFLEDHGYMVEVA----------------------------
2as0A           FAGLNLVKDGGILVTCSCSQHVDQFKDIIA----------------------------------------
2br3F           WAVDHLLEEGDYFIIEDMIPYWYRYAPQLFSEYLGAFRDVLSMDML------------------------
3b3gA           LHAKKYLKPSGNMFPTIGDVH-------------------------------------------------
3dulA           EWALKLSRPGTVIIGDNVVRIRRFYELIAAEPR-------------------------------------
1dusA           EEGKELLKDNGIWVVIQTKQGAKSLAKYKDVFGN------------------------------------
3e05A           DAVDRRLKSEGVIVLNAVTLD--TLTKAVEFLEDHGYMVEVA----------------------------
3c6kC           DLSMKVLKQDGKYFT-------------------------------------------------------
1eg2A           ----------------------------------------------------------------------
3c6kA           DLSMKVLKQDGKYFTQGNCVNLTEALSLYELYCPVEFSKEIV----------------------------
2cmgA           DGLKRMLKEDGVFISVAKHP--------------------------------------------------
3e05G           DAVDRRLKSEGVIVLNAVTLDT------------------------------------------------
2ar0B           I---------------------------------------------------------------------
3e7pA           KEWRNYLKPGGYLAVSESVW--------------------------------------------------
2bm8K           WAVDHLLEEGDYFIIEDMIP--------------------------------------------------
3egiB           ----------------------------------------------------------------------
3e05D           DAVDRRLKSEGVIVLNAVTL--------------------------------------------------
3c6mB           DLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQ--------------------------------------
1booA           ----------------------------------------------------------------------
2bm9B           WAVDHLLEEGDYFIIEDMIPYWYRY---------------------------------------------
3egiA           PDGFEIFRLSKKIT--------------------------------------------------------
3busA           LREARVLRPGGTVAIADFVL--------------------------------------------------
2an3B           ----------------------------------------------------------------------
2bm8B           WAVDHLLEEGDYFIIEDMIP--------------------------------------------------
3e05B           DAVDRRLKSEGVIVLNAVTL--------------------------------------------------
2cl5B           LEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGTHYSSYLEYM----------------------------
3dxzA           ELVKSKLQLGGVFHMATDWEPYAE--HMLEVMSSIDGYKNSESNDYVPRPASRPVTKFEGHGVWDLMF--
1aqiA           EKAVRLLKPGGVLV--------------------------------------------------------
3dp7A           TRVAQSIGKDSKVYIMETLWDRQRYETASYCLT-------------------------------------
3cjqD           PRYREALVPGGRALLTGILKDRAP--LVREAMAGA-----------------------------------
2bt8A           PVDVSFTRDSATHAYQAYGVYSSS----------------------------------------------
3c6kB           DLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQ--------------------------------------
2bm8A           WAVDHLLEEGDYFIIEDMIP--------------------------------------------------
2bm8G           WAVDHLLEEGDYFIIEDMIP--------------------------------------------------
2cl5A           LEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGTHYSSYLEYM----------------------------
3bwmA           LEECGLLRKGTVLLADNVICPG------------------------------------------------
3bgdA           ----------------------------------------------------------------------
1aqjB           ----------------------------------------------------------------------
3duwA           EWALKLSRPGTVIIGDNVVREGEVIDNTSNDPRVQGIRRFYELIAAEPRVSATA----------------
3cjtA           PRYREALVPGGRALLTGILKDRAP--LVREAMAGA-----------------------------------
3cjrA           EALVP----GGRALLTGILKDRAP--LVREAMAGA-----------------------------------
3b3fA           LHAKKYLKPSGNMFPTIGDVH-------------------------------------------------
3c3pB           LERNRCLAKNALLIAVNALRREFNHHLSRRRD------------------------------FFTTIVPV
3bxoA           ASFAEHLEPGGVVVVEPWWFP--ETFADGWVSADVVRRDGRTVARVSHSVREGNATRMEVHFT-------
3a27A           DKTFEFLKDRGVIHYHETVAEKIMYERPIERLKF------------------------------------
2an4A           ----------------------------------------------------------------------
3dliA           SLCYSKMKYSSYIVIESPNPTSLYSLINFYIDPTHKKPVHPE----------------------------
2br5E           WAVDHLLEEGDYFIIEDMIP--------------------------------------------------
2e58A           ----------------------------------------------------------------------
3cggA           ANIHRALGADGRAVIGFGAGRGWVFGDFLEVAERVGLELENAFESW------------------------
2admA           EKAVRLLKPGGVLV--------------------------------------------------------
2b9eA           LCHALTFPSLQRLV--------------------------------------------------------
3bzbB           RSVKLLALPANDPTAVALVTFTHHRPHLAERDLAFFRLVNA-----------------------------
3busB           LREARVLRPGGTVAIADFVL--------------------------------------------------
2bh2A           AGVMQQIPIRIVYVSCNPATLARDSEALLKAGY-------------------------------------
2dulA           ----------------------------------------------------------------------
3dxyA           ELVKSKLQLGGVFHMEPYAEHMLEVMSSIDGYKNLSESNDYVPRPASRPVTKF-----------------
3dxxA           ----------------------------------------------------------------------
1d2gA           KNIASMVRPGGLLVIDHKNYDYILSTGCAPPGKNIYYKSD------------------------------
3bwcB           RILKP----DGICCNQGES---------------------------------------------------
2e58B           ----------------------------------------------------------------------
3bzbA           HQAHDALLPANDPTAVALVT-FTHDLAFFRLVNADGALIAEP----------------------------
2b2cA           ELLRDALKEDGILSSQGESVWLHLPLIAHLVAFNRKIFPAV-----------------------------
1af7A           RRFVPLLKPDGLLF--------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GSGIAVSTKVx
3cbgA           GDGMTLALK--
2avdA           GDGLTLAFKI-
3eeyA           -----------
3eeyI           -----------
3a25A           -----------
2br5A           -----------
3eeyG           -----------
3eeyB           -----------
2br5C           -----------
3dr5A           GAGLTVVTK--
3c3pC           -----------
2an3A           -----------
2br4A           -----------
3c3yA           GDGITFCRRL-
3e05C           -----------
2br5D           -----------
3eeyC           -----------
3c3pA           -----------
2br5F           -----------
3eeyF           -----------
1cmvB           -----------
1aqjA           -----------
2br4F           -----------
2br3B           -----------
3egiD           -----------
2br3A           -----------
3e05H           -----------
2a14A           -----------
2br3D           -----------
3e05E           -----------
1dl5A           -----------
3c6kD           -----------
3dulB           -----------
1dctA           -----------
3e05F           -----------
2as0A           -----------
2br3F           -----------
3b3gA           -----------
3dulA           -----------
1dusA           -----------
3e05A           -----------
3c6kC           -----------
1eg2A           -----------
3c6kA           -----------
2cmgA           -----------
3e05G           -----------
2ar0B           -----------
3e7pA           -----------
2bm8K           -----------
3egiB           -----------
3e05D           -----------
3c6mB           -----------
1booA           -----------
2bm9B           -----------
3egiA           -----------
3busA           -----------
2an3B           -----------
2bm8B           -----------
3e05B           -----------
2cl5B           -----------
3dxzA           -----------
1aqiA           -----------
3dp7A           -----------
3cjqD           -----------
2bt8A           -----------
3c6kB           -----------
2bm8A           -----------
2bm8G           -----------
2cl5A           -----------
3bwmA           -----------
3bgdA           -----------
1aqjB           -----------
3duwA           -----------
3cjtA           -----------
3cjrA           -----------
3b3fA           -----------
3c3pB           GNGVLLGYRL-
3bxoA           -----------
3a27A           -----------
2an4A           -----------
3dliA           -----------
2br5E           -----------
2e58A           -----------
3cggA           -----------
2admA           -----------
2b9eA           -----------
3bzbB           -----------
3busB           -----------
2bh2A           -----------
2dulA           -----------
3dxyA           -----------
3dxxA           -----------
1d2gA           -----------
3bwcB           -----------
2e58B           -----------
3bzbA           -----------
2b2cA           -----------
1af7A           -----------