[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for hlac0:ACM57207.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3derA.bssp"
#ERROR : Can't open dsspfile "3dfyE.bssp"
#ERROR : Can't open dsspfile "3dfyN.bssp"
#ERROR : Can't open dsspfile "3dfyB.bssp"
#ERROR : Can't open dsspfile "3eezA.bssp"
#ERROR : Can't open dsspfile "3dfyL.bssp"
#ERROR : Can't open dsspfile "3dfyH.bssp"
#ERROR : Can't open dsspfile "3dfyF.bssp"
#ERROR : Can't open dsspfile "1ec7C.bssp"
#ERROR : Can't open dsspfile "1ec7B.bssp"
#ERROR : Can't open dsspfile "3cyjA.bssp"
#ERROR : Can't open dsspfile "3cb3C.bssp"
#ERROR : Can't open dsspfile "2dw7A.bssp"
#ERROR : Can't open dsspfile "2akzA.bssp"
#ERROR : Can't open dsspfile "2dw6A.bssp"
#ERROR : Can't open dsspfile "3d46A.bssp"
#ERROR : Can't open dsspfile "3boxA.bssp"
#ERROR : Can't open dsspfile "3cb3D.bssp"
#ERROR : Can't open dsspfile "1ec7A.bssp"
#ERROR : Can't open dsspfile "2akmB.bssp"
#ERROR : Can't open dsspfile "3cb3B.bssp"
#ERROR : Can't open dsspfile "3dfyA.bssp"
#ERROR : Can't open dsspfile "1ec8A.bssp"
#ERROR : Can't open dsspfile "2al2A.bssp"
#ERROR : Can't open dsspfile "1chrA.bssp"
#ERROR : Can't open dsspfile "3dg6A.bssp"
#ERROR : Can't open dsspfile "2al2B.bssp"
#ERROR : Can't open dsspfile "2bahA.bssp"
#ERROR : Can't open dsspfile "1ec9A.bssp"
#ERROR : Can't open dsspfile "1bkhB.bssp"
#ERROR : Can't open dsspfile "1bkhC.bssp"
#ERROR : Can't open dsspfile "3bjsA.bssp"
#ERROR : Can't open dsspfile "2al1B.bssp"
#ERROR : Can't open dsspfile "3ddmA.bssp"
#ERROR : Can't open dsspfile "3cb3A.bssp"
#ERROR : Can't open dsspfile "1dtnA.bssp"
#ERROR : Can't open dsspfile "3ct2A.bssp"
#ERROR : Can't open dsspfile "3dgbA.bssp"
#ERROR : Can't open dsspfile "3bjsB.bssp"
#ERROR : Can't open dsspfile "1ebhA.bssp"
#ERROR : Can't open dsspfile "1bkhA.bssp"
#ERROR : Can't open dsspfile "3dg3A.bssp"
#ERROR : Can't open dsspfile "3dipB.bssp"
#ERROR : Can't open dsspfile "3bsmA.bssp"
#ERROR : Can't open dsspfile "3dipA.bssp"
#ERROR : Can't open dsspfile "1ec9D.bssp"
#ERROR : Can't open dsspfile "3dfhA.bssp"
#ERROR : Can't open dsspfile "1ec7D.bssp"
#ERROR : Can't open dsspfile "1bqgA.bssp"

## Summary of PDB Search
:349
    1e-48  32%  3derA  [x.x.x] MUCONATE CYCLOISOMERASE
    3e-43  32%  3dfyE  [x.x.x] MUCONATE CYCLOISOMERASE
    1e-41  32%  3dfyN  [x.x.x] MUCONATE CYCLOISOMERASE
    6e-41  32%  3dfyB  [x.x.x] MUCONATE CYCLOISOMERASE
    1e-40  27%  3eezA  [x.x.x] PUTATIVE MANDELATE RACEMASE/MUCONATE LACTONIZING
    2e-39  32%  3dfyL  [x.x.x] MUCONATE CYCLOISOMERASE
    2e-39  32%  3dfyH  [x.x.x] MUCONATE CYCLOISOMERASE
    4e-39  33%  3dfyF  [x.x.x] MUCONATE CYCLOISOMERASE
    6e-38  20%  1ec7C  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    5e-37  19%  1ec7B  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    6e-37  23%  3cyjA  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME-
    7e-36  20%  3cb3C  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    1e-35  17%  2dw7A  [x.x.x] BLL6730 PROTEIN
    5e-34  16%  2akzA  [x.x.x] GAMMA ENOLASE
    1e-33  18%  2dw6A  [x.x.x] BLL6730 PROTEIN
    1e-33  14%  3d46A  [x.x.x] PUTATIVE GALACTONATE DEHYDRATASE
    2e-33  14%  3boxA  [x.x.x] L-RHAMNONATE DEHYDRATASE
    1e-32  20%  3cb3D  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    2e-31  19%  1ec7A  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    6e-31  15%  2akmB  [x.x.x] GAMMA ENOLASE
    1e-30  20%  3cb3B  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    1e-30  30%  3dfyA  [x.x.x] MUCONATE CYCLOISOMERASE
    9e-30  18%  1ec8A  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    2e-29  17%  2al2A  [x.x.x] ENOLASE 1
    2e-29  28%  1chrA  [d.54.1 - c.1.11] CHLOROMUCONATE CYCLOISOMERASE
    8e-28  25%  3dg6A  [x.x.x] MUCONATE CYCLOISOMERASE
    1e-27  16%  2al2B  [x.x.x] ENOLASE 1
    5e-27  29%  2bahA  [x.x.x] N-ACYLAMINO ACID RACEMASE
    9e-27  18%  1ec9A  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    9e-27  22%  1bkhB  [d.54.1 - c.1.11] MUCONATE LACTONIZING ENZYME
    2e-26  22%  1bkhC  [d.54.1 - c.1.11] MUCONATE LACTONIZING ENZYME
    2e-26  24%  3bjsA  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    3e-26  16%  2al1B  [x.x.x] ENOLASE 1
    1e-25  22%  3ddmA  [x.x.x] PUTATIVE MANDELATE RACEMASE/MUCONATE LACTONIZING
    3e-25  20%  3cb3A  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    3e-25  21%  1dtnA  [x.x.x] MANDELATE RACEMASE
    6e-24  24%  3ct2A  [x.x.x] MUCONATE CYCLOISOMERASE
    1e-23  26%  3dgbA  [x.x.x] MUCONATE CYCLOISOMERASE
    1e-23  24%  3bjsB  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    3e-23  17%  1ebhA  [d.54.1 - c.1.11] ENOLASE
    1e-22  23%  1bkhA  [d.54.1 - c.1.11] MUCONATE LACTONIZING ENZYME
    2e-22  25%  3dg3A  [x.x.x] MUCONATE CYCLOISOMERASE
    3e-20  20%  3dipB  [x.x.x] ENOLASE
    2e-19  24%  3bsmA  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    3e-19  22%  3dipA  [x.x.x] ENOLASE
    1e-18  19%  1ec9D  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    3e-16  22%  3dfhA  [x.x.x] MANDELATE RACEMASE
    1e-13  18%  1ec7D  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    7e-11  20%  1bqgA  [x.x.x] D-GLUCARATE DEHYDRATASE
:349

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTLETEFERVSLPLENPFTIFRGTQTDAENVIVKIADEAGMTGVGGAAPSAHYGETADTVEAVLPDLLDA
3derA           -----KLSLKRYEYEKPFHITGSVSSESRNVEVEIVLESGVKGYGEASPSFRVGERVEALLAIENAVREM
3dfyE           ----------------KLSLKRYEYEESRNVEVEIVLESGVKGYGEASPSFRVGERVEALLAIENAVREM
3dfyN           ------------NVKLSLKRYEYEKSESRNVEVEIVLESGVKGYGEASPSFRVGERVEALLAIENAVREM
3dfyB           ------------NVKLSLKRYEYEKPESRNVEVEIVLESGVKGYGEASPSFRVGERVEALLAIENAVREM
3eezA           --------QVDLPLEHPYWKFELLDA----TLVKLETDAGITGWGEGTPWGHTPAHGPGIRAGIETMAPF
3dfyL           ----------------NVKLSLKRYSESRNVEVEIVLESGVKGYGEASPSFRVGERVEALLAIENAVREM
3dfyH           ----------------RYEYEKESRN----VEVEIVLESGVKGYGEASPSFRVGERVEALLAIENAVREM
3dfyF           ---------------------YEKPSESRNVEVEIVLESGVKGYGEASPSFRVGERVEALLAIENAVREM
1ec7C           --------PVAGHDSMLMNLSGAHAPFFTRNIVIIKDNSGHTGVGEIPGGEKIRK---TLEDAIPLVVG-
1ec7B           ---------VAGHDSMLMNLSGAHAPFFTRNIVIIKDNSGHTGVGEIPGGEKIRKTLEDAIPLVGEYKNV
3cyjA           -----EVSAYTVPTDYPESDGTLQWDSTTMILVEA-HGGGRKGLGYTYGDVSVGRFVESKLAGV-AEGSD
3cb3C           ---------------RISSCYLPLMTEIAILFAEIETAGGHQGLGFSYSKRAGGPGQFAHAREIAPALIG
2dw7A           ----VDVREITKPISSPIRNAYIDFTKMTTSLVAVVTDVVREGKRVVGYGFNSNGRYGQGGLIRADPKKL
2akzA           ------------MLELDGTENKSKFGANAILGVSLAVCKAGAAERELPLYRHIAQLAGNSDLILPVPAFN
2dw6A           ----VDVREITKPISSPIRNAYIDFTKMTTSLVAVVTDVVREGKRVVGYGFNSNGRYGQGGLIREDPKKL
3d46A           --------PMSKYRDYEQSRQSFGINVLGTLIVEVEAENRQTGFAVSTAGEMGCFIVEKHLNRFIEGKCV
3boxA           --------PMSKYRDYEQSRQSFGINVLGTLIVEVEAENRQTGFAVSTAGEMGCFIVEKHLNRFIEGKCV
3cb3D           ---------------------PLPMTEIAILFAEIETAGGHQGLGFSYSKRAGGPGQFAHAREIAPALED
1ec7A           -----QVIPVAGHDSMLMNLSGAHAPFFTRNIVIIKDNSGHTGVGEIPGGEKIRK---TLEDAIPLVVG-
2akmB           --------------ELDGTENKSKFGANAILGVSLAVCKAGAAERELPLYRHIAQLAGNSDLILPVPAFN
3cb3B           ---------CYLPLATPIMTEIAI------LFAEIETAGGHQGLGFSYSKRAGGPGQFAHAREIAPALIG
3dfyA           -----KLSLKRYEYEKPFHITGSVSSESRNVEVEIVLESGVKGYGEASPSFRVNERVEALLAIENAVREM
1ec8A           ---EMQVIPVAGHDSMLMNLSGAHAPFFTRNIVIIKDNSGHTGVGEIPGGEKIRKTLEDAIPLVVGKVLT
2al2A           -----------------------------------AAEKNVPLYKHLADLSKSKTS----PYVLPVPFLN
1chrA           ---AIEAVIVDVPTKRPIQMSITTVHQQSYVIVRVYSE-GLVGVGSVGGPVWSAECAETIKIIVERYLAP
3dg6A           --------PFSIPYTKPLRFASGEVHAAEHVLVRVHTDDGIVGVAEAPPRPFTGETQTGIVAVIEQYFAP
2al2B           ----------------------------------------------------YKHLADLSKSKTSPYVLP
2bahA           ----------------IVVARLPLKT-HKVVPLLILHGEGVQGVAEGTMEARPMYREETIAGALDLLRGT
1ec9A           ---EMQVIPVAGHDSMLMNLSGAHAPFFTRNIVIIKDNSGHTGVGEIPGGEKIRKTLEDAIPLVYKNVLT
1bkhB           ------------IVDLPTIRPQQQTL----VVLRVRCSDGVEGIGEATTIGGLAYGYESPEGIKANIDAH
1bkhC           ----------------AIIVDLPTIQQQTLVVLRVRCSDGVEGIGEATTIGGLAYGYESPEGIIDAHLAP
3bjsA           -----NAIPLSYRLP-TVTMGVGSTIKRDAIIIRVETSEGITGYGEAHPGRSPGAITSLIHNTIAPMLKA
2al1B           ----------------------------------------------------YKHLADLSKSKTSPYVLP
3ddmA           ----------ITPARVRAHVFRYPVHDRPAVLVEVEDSDGAVGWGEVWCNFPACGAEHRARLVEPLLTDP
3cb3A           -----RISSCYLPLATPISDAKKPMTEIAILFAEIETAGGHQGLGFSYSKRAGGPGQFAHAREIAPALIG
1dtnA           -----RTRAVNVPLAYPVHTAVGTVGTAPLVLIDLATSAGVVGHSYLFAYTPVALKSKQLLDDMAAMI--
3ct2A           ------------------------------VLIRLRCADGIEGLGESTTIGGLAYGNESPDSIKTNIDRF
3dgbA           ---------VDLPTIRPHKLAMHTMQNQTLVLIRLRCADGIEGLGESTTIGGLAYGNESPDSIKTNIDRF
3bjsB           -----NAIPLSYRLP-TVTMGVGSTIKRDAIIIRVETSEGITGYGEAHPGRSPGAITSLIHNTIAPMLKA
1ebhA           -----------------------------------AAEKNVPLYKHLADLSKSKTSPY----VLPVPFLN
1bkhA           ----------------AIIVDLPTIQ-QTLVVLRVRCSDGVEGIGEATTIGGLAYGYESPEGIKANIDAH
3dg3A           ----------------PFSIPYTAAEH---VLVRVHTDDGIVGVAEAPPRPFTGETQTGIVAVIEQY-FA
3dipB           -----------LPRITALRTIRLPE-RPKLIWVEVETEDGLTGLGETFRGAQAVEAV--LHEQTAPAII-
3bsmA           -----------LKIRDAYTIVTCPGRNF--VTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALGR
3dipA           -----------LPRITALRTIPERPKL---IWVEVETEDGLTGLGETFRGAQAVEAV--LHEQTAPAII-
1ec9D           ---EMQVIPVAGHDSMLMNLSGAHAPFFTRNIVIIKDNSGHTGVGEIPGGEKIRKTLEDAIPLVYKNVLT
3dfhA           ----------------------------------------------------------------------
1ec7D           PVVEMQVIPVAGHDSMLMNLSGAHAPFFTRNIVIIKDNSGHTGVGEIPGGEKIRKTLEDAIPLVV-----
1bqgA           ---DLKVVPVAGHDS-MLLNLSGAHGPLFTRNILILTDSSGHVGVGEVPG---GEGIRKTLEDARHLL-I


                         .         .         *         .         .         .         .:140
query           VERVGDPXXXXXXXXXXXXVVNGNPAARAAVSIAVHDLAAKRLGVPLHRLWGLDPTAAPATSYTIGLDET
3derA           I--TGIDVRNYARIFEITDRLFGFPSLKAAVQFATLDALSQELGTQVCYLLGGKRDEIE-TDKTVGIDTV
3dfyE           I--TGIDVRNYARIFEITDRLFGFPSLKAAVQFATLDALSQELGTQVCYLLGGKRDEIE-TDKTVGIDTV
3dfyN           I--TGIDVRNYARIFEITDRLFGFPSLKAAVQFATLDALSQELGTQVCYLLGGKRDEIE-TDKTVGIDTV
3dfyB           I--TGIDVRNYARIFEITDRLFGFPSLKAAVQFATLDALSQELGTQVCYLLGGKRDEIE-TDKTVGIDTV
3eezA           VLGL-DPRRLLDVERAMDIALPGHLYAKSPIDMACWDIAGQAAGLPIADLMGGGSRTPRPIASSVGAKSV
3dfyL           I--TGIDVRNYARIFEITDRLFGFPSLKAAVQFATLDALSQELGTQVCYLLGGKRDEIE-TDKTVGIDTV
3dfyH           I--TGIDVRNYARIFEITDRLFGFPSLKAAVQFATLDALSQELGTQVCYLLGGKRDEIE-TDKTVGIDTV
3dfyF           I--TGIDVRNYARIFEITDRLFGFPSLKAAVQFATLDALSQELGTQVCYLLGGKRDEIE-TDKTVGIDTV
1ec7C           -KTLGEY--KNVLTLVRNTFARTTIHVVTGIEAAMLDLLGQHLGVNVASLLGDDSCDWYRLRHEEAMTPD
1ec7B           LTLVRNTFADRDGRGLQTFDLRTTIHVVTGIEAAMLDLLGQHLGVNVASLLGDDSCDWYRLRHEEAMTPD
3cyjA           ALSPPAVWARMQAAIRNAGRPGVGAMAVSAVDIALWDLKARLLGLPLADLPRFHAEVPVYGSGGFTSYPL
3cb3C           PSDIAKLWDKLCWAGASAGRSGLSTQAIGAFDVALWDLKAKRAGLSLAKLLGSYRDSVRCYNTSGGFTPI
2dw7A           LNEAGDNVWAAMMINEKPGGHGERSVAVGTIDMAVWDAVAKIAGKPLFRLLAEVKANPRVFVYAAGGKGL
2akzA           VINGGSHAGNKLAMQEFMILPVGAESFRDAMRLGAEVYHTLK-GVIKDKYGKDATNVGDEGGFAPNILEN
2dw6A           LNEAGDNLDPDKVWAAMMINEGERSVAVGTIDMAVWDAVAKIAGKPLFRLLAEVKANPRVFVYAAGGKGL
3d46A           SDIKLIHDQMLGATMYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVYKLLGGAVRDEIQFYATGARPDL
3boxA           SDIKLIHDQMLGATMYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVYKLLGGAVRDEIQFYATGARPDL
3cb3D           PSDIAKLWDKLCWAGASAGRSGLSTQAIGAFDVALWDLKAKRAGLSLAKLLGSYRDSVRCYNTSGGFLPI
1ec7A           -KTLGEY-KNVLTLVRNTFALRTTIHVVTGIEAAMLDLLGQHLGVNVASLLGDDSCDWYRLRHEEAMTPD
2akmB           VINGGSHAGNKLAMQEFMILPVGAESFRDAMRLGAEVYHTLK-GVIKDKYGKDATNVGDEGGFAPNILEN
3cb3B           PSDIAKLWDKLCWAGASAGRSGLSTQAIGAFDVALWDLKAKRAGLSLAKLLGSYRDSVRCYNTSGGFLHT
3dfyA           I--TGIDVRNYARIFEITDRLFGFPSLKAAVQFATLDALSQELGTQVCYLLG-GKRDEIETDKTVGIDTV
1ec8A           LVRNTFADRDAGGRGLQTFDLRTTIHVVTGIEAAMLDLLGQHLGVNVASLLGDDSCDWYRLRHEEAMTPD
2al2A           VLNGGSHAGGALALQEFMIAPTGAKTFAEALRIGSEV--YHNLKSLTKKRYGASAGNVDEGGVAPNIQTA
1chrA           HLLGTDAFNVSGALQTMARAVTGNASAKAAVEMALLDLKARALGVSIAELLGPLRSAIPIAWTLASGDTK
3dg6A           ALIGLTLTEREVAHTRMARTV-GNPTAKAAIDMAMWDALGQSLRLSVSEMLGGYTDRMRVSHMLGFDDPV
2al2B           VPFLNVLNGGALALQEFMIAPTGAKTFAEALRIGSEVY--HNLKSLTKKRYGASAGNVDEGGVAPNIQTA
2bahA           FLPLGQTFANPEAVSDALGSYRGNRMARAMVEMAAWDLWARTLGVPLCTLLGGHKEQVEVGVSLGIQADE
1ec9A           LVRNTFADRDAGGRGLQTFDLRTTIHVVTGIEAAMLDLLGQHLGVNVASLLGDDSCDWYRLRHEEAMTPD
1bkhB           LAPALAADNINAAMLKLDKLAKGNTFAKSGIESALLDAQGKRLGLPVSELGGRVRDSLEVAWTLASGDTA
1bkhC           ALIGLAADNINAAMLKLDKLAKGNTFAKSGIESALLDAQGKRLGLPVSELGGRVRDSLEVAWTLASGDTA
3bjsA           TDCVGAWQRVHRMQLSSHGLGAGAALAISGIDMALWDIRGKAANMPLYELLGGSKRRIPAYAGGIALQPK
2al1B           VPFLNVLNGGALALQEFMIAPTGAKTFAEALRIGSEVY--HNLKSLTKKRYGASAGNVDEGGVAPNIQTA
3ddmA           AQAFAHLEARTAVLAIQTGEPGPLAQAIAGLDIALCDLAARRAGQPLWAWLG---GSGDRIGVYASGINP
3cb3A           PSDIAKLWDKLCWAGASAGRSGLSTQAIGAFDVALWDLKAKRAGLSLAKLGSYRDSVRCYNTSGGFLHTP
1dtnA           ---VNEPLAPVSLEAMLAKRFCLAGYTGLIIDMAAWDALGKVHETPLVKLLGANAR-PVQAYDSHSLDGV
3ct2A           VAPLLDASNINAAMLRLEQSIRGNTFAKSGIESALLDAQGKRLGLPVSELGGRVRDALPVAWTLASGDTA
3dgbA           VAPLQDASNINAAMLRLEQSIRGNTFAKSGIESALLDAQGKRLGLPVSELLGRVRDALPVAWTLASGDTA
3bjsB           TDCVGAWQRVHRMQLSSHGLGAGAALAISGIDMALWDIRGKAANMPLYELLGGSKRRIPAYAGGIALQPK
1ebhA           VLNGGSHAGGALALQEFMIAPTGAKTFAEALRIGSEVY--HNLKSLTKKRYGASAGNVDEGGVAPNIQTA
1bkhA           LAPGLAADNINAAMLKLDKLAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEVAWTLASGDT
3dg3A           PALIGLTLTEREVAHTRMARTVGNPTAKAAIDMAMWDALGQSLRLSVSEMLGGYTDRMRVSHMLGFDDPV
3dipB           GRAAENITSISSELLNPYVGFGSSSAAASAVDIALWDLAGQRAGVPLHVALGG----AARDRVPVYATFM
3bsmA           IEDTWQYLYRGAYWRRGPVTMT----AIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTI
3dipA           GRAAENITSISSELLNPYVGFGSSSAAASAVDIALWDLAGQRAGVPLHVALG-GAARDRVPVYATCAGYD
1ec9D           LVRNTFADRDAGGRGLQTFDLRTTIHVVTGIEAAMLDLLGQHLGVNVASLLGDDSCDWYRLRHEEAMTPD
3dfhA           ------------------------NNAISGVDMALWDIKAKLAGMPLHQLFGGKSRDAIPVYTHATSDTM
1ec7D           GKTLGEYKNVLTLVRNTFADRRTTIHVVTGIEAAMLDLLGQHLGVNVASLLGDDSCDWYRLRHEEAMTPD
1bqgA           NQSIGNYQSLLNKVRNAFADLRIAVHAVTAVESALLDLLGQHLQVPVAALEGQQRDAVEMLGYLFYVGDR


                         +         .         .         .         .         *         .:210
query           ERVREKAEAAVDAGYPILKIKLGTDRDRELIDAVREAAPDARLRVDANEAWTPREAVRKCEWLADRDVEF
3derA           ENRVKEAKKIFEEGFRVIKIKVGENEDIEAVEEIAKVTRGAKYIVDANMGYTQKEAVEFARAVYQKDIAV
3dfyE           ENRVKEAKKIFEEGFRVIKIKVGLKEDIEAVEEIAKVTRGAKYIVDANMGYTQKEAVEFARAVYQKDIAV
3dfyN           ENRVKEAKKIFEEGFRVIKIKVGLKEDIEAVEEIAKVTRGAKYIVDANMGYTQKEAVEFARAVYQIDIAV
3dfyB           ENRVKEAKKIFEEGFRVIKIKVGENEDIEAVEEIAKVTRGAKYIVDANMGYTQKEAVEFARAVYQKDIAV
3eezA           EETRAVIDRYRQRGYVAHSVKIGGERDIARIRDVEDIEPGEIVLYDVNRGWTRQQALRVMRATEDLHVMF
3dfyL           ENRVKEAKKIFEEGFRVIKIKVGLKEDIEAVEEIAKVTRGAKYIVDANMGYTQKEAVEFARAVYQIDIAV
3dfyH           ENRVKEAKKIFEEGFRVIKIKVGLKEDIEAVEEIAKVTRGAKYIVDANMGYTQKEAVEFARAVYQKDIAV
3dfyF           ENRVKEAKKIFEEGFRVIKIKVGLKEDIEAVEEIAKVTRGAKYIVDANMGYTQKEAVEFARAVYQIDIAV
1ec7C           AVVRLAEAAYEKYGFNDFKLKGGVLEEAESIVALAQRFPQARITLDPNGAWSLNEAIKIGKYLKG-SLAY
1ec7B           AVVRLAEAAYEKYGFNDFKLKGGVEEEAESIVALAQRFPQARITLDPNGAWSLNEAIKIGKYLKGSLA-Y
3cyjA           RRLQEQLGGWAAAGIPRVKMKVGREPEKDPRAAREAIGESVELMVDANGAYTRKQALYWAGAFAREGISY
3cb3C           DQLMVNASASIERGIGGIKLKVGQALDIARVTAVRKHLGAVPLMVDANQQWDRPTAQRMCRIFEPFNLVW
2dw7A           SMLRGEMRGYLDRGYNVVKMKIGGAPIEEDRMRIEAVGKDAQLAVDANGRFNLETGIAYAKMLRDYPLFW
2akzA           SEALELVKEAIDKAGYTEKIVIGMDVAASEFYRDGKYDLDFKSPTDPSRYITGDQLGALYQDFVRDPVVS
2dw6A           SMLRGEMRGYLDRGYNVVKMAIGGAEDRMRIEAVLEEGKDAQLAVDANGRFNLETGIAYAKMLRDYPLFW
3d46A           AKEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKCPDFWLMLDCWMSQDVNYATKLAHACAPFNLKW
3boxA           AKEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKCGDFWLMLDCWMSQDVNYATKLAHACAPFNLKW
3cb3D           DQLMVNASASIERGIGGIKLKVGQALDIARVTAVRKHLGAVPLMVDANQQWDRPTAQRMCRIFEPFNLVW
1ec7A           AVVRLAEAAYEKYGFNDFKLKGGGEEEAESIVALAQRFPQARITLDPNGAWSLNEAIKIGKYLK-GSLAY
2akmB           SEALELVKEAIDKAGYTEKIVIGMDVAASEFYRDGKYDLDFKSPTDPSRYITGDQLGALYQDFVRDPVVS
3cb3B           PIDQLMVNASIERGIGGIKLKVGQPDGALDIARVTAVRDAVPLMVDANQQWDRPTAQRMCRIFEPFNLVW
3dfyA           ENRVKEAKKIFEEGFRVIKIKVGEKEDIEAVEEIAKVTRGAKYIVDANMGYTQKEAVEFARAVYQKGIDV
1ec8A           AVVRLAEAAYEKYGFNDFKLKGGVLEEAESIVALAQRFPQARITLDPNGAWSLNEAIKIGKYLKGSLA-Y
2al2A           EEALDLIVDAIKAAGHDGKVKIGLDCASSEFFKDGKYDDFKNPNSDKSKWLTGPQLADLYHSLMKRPIVS
1chrA           RDLDSAVEMIERRRHNRFKVKLGFRSPQDDLIHMEALGSKAYLRVDVNQAWDEQVASVYIPELEALGVEL
3dg6A           KMVAEAERIRETYGINTFKVKVGRRPVQLDTAVVRALGDAIELYVDGNRGWSAAESLRAMREMADLDLLF
2al2B           EEALDLIVDAIKAAGHDGKVKIGLDCASSEFFKDGKYDDFKNPNSDKSKWLTGPQLADLYHSLMKRPIVS
2bahA           QATVDLVRRHVEQGYRRIKLKIKPGWDVQPVRATREAFPDIRLTVDANSAYTLADAGRLR-QLDEYDLTY
1ec9A           AVVRLAEAAYEKYGFNDFKLKGGVLEEAESIVALAQRFPQARITLDPNGAWSLNEAIKIG-KYLKGSLAY
1bkhB           RDIAEARHMLEIRRHRVFKLKIGANPDLKHVVTIKRELGSASVRVDVNQYWDESQAIRACQVLGDNGIDL
1bkhC           RDIAEARHMLEIRRHRVFKLKIGANPVEKHVVTIKRELGDSSVRVDVNQYWDESQAIRACQVLGDNGIDL
3bjsA           ESLAEEAQEYIARGYKALKLRIGDRVDIERVRHVRKVLGEVDILTDANTAYTMADARRVLPVLAEIQAGW
2al1B           EEALDLIVDAIKAAGHDGKVKIGLDCASSEFFKDGKYDDFKNPNSDKSKWLTGPQLADLYHSLMKRPIVS
3ddmA           ENPEDVVARKAAEGYRAFKLKVGFDDARRNALHVRELLGATPLMADANQGWDLPRARQMAQRLGPAQLDW
3cb3A           DQLMVNASASIERGIGGIKLKVGQPDGALDIARVTAVRDAVPLMVDANQQWDRPTAQRMCRIFEPFNLVW
1dtnA           KLATERAVTAAELGFRAVKTKIGYPALDQDLAVVRSIRDDFGIMVDYNQSLDVPAAIKRSQALQQEGVTW
3ct2A           KDIAEAQKMLDLRRHRIFKLKIGAGEVDRDLAHVIAIKDSASVRVDVNQAWDEAVALRACRILGGNGIDL
3dgbA           KDIAEAQKMLDLRRHRIFKLKIGADRDLAHVIAIKKALGDASVRVDVNQAWDEAVALRACRILGGNGIDL
3bjsB           ESLAEEAQEYIARGYKALKLRIGDAVDIERVRHVRKVLGEVDILTDANTAYTMADARRVLPVLAEIQAGW
1ebhA           EEALDLIVDAIKAAGHDGKVKIGLDCASSEFFKDGKYDDFKNPNSDKSKWLTGPQLADLYHSLMKRPIVS
1bkhA           ARIAEARHMLEIRRHRVFKLKIGANPVEKHVVTIKRELGSASVRVDVNQYWDESQAIRACQVLGDNGIDL
3dg3A           KMVAEAERIRETYGINTFKVKVGRRPVQLDTAVVRALRDAIELYVDGNRGWSAAESLRAMREMADLDLLF
3dipB           RDAGVLAESLVAEGYAAMKIWPFDKDGLEPFRKIRAAVGQRIIMCELHSLWGTHAAARICNALADYGVLW
3bsmA           EDCLGEVARHVELGYRAVRVQSGVNHAPKLFAAVRERFGDDHVLHDVHHRLTPIEAARLGKAVEPYHLFW
3dipA           FDAGVLAESLVAEGYAAMKIWPFDDDGLEPFRKIRAAVGRIEIMCELHSLWGTHAAARICNALADYGVLW
1ec9D           AVVRLAEAAYEKYGFNDFKLKGGVLEEAESIVALAQRFPQARITLDPNGAWSLNEAIKIGKYLKGSLA-Y
3dfhA           EGIYDLVEGFLEKGYKHIRCQLGFDQDQYMFKSLREKYGQFHILHDVHERLFPNQAIQFAKEVEQYKPYF
1ec7D           AVVRLAEAAYEKYGFNDFKLKGGVLEEAESIVALAQRFPQARITLDPNGAWSLNEAIKIGKYLKGSLA-Y
1bqgA           SVVALAEAAYDRYGFKDFKLKGGVEDEIAAVTALSERFPDARITLDPNGAWSLKEAVALCRD-QHHVLAY


                         .         .         .         +         .         .         .:280
query           VEQPVPAEDPEGLRFVYERSALPVAADESCVTLSDIPAIADRCDIANLKLMKTGGLLEAKRMIAAARAHG
3derA           YEQPVRREDIEGLKFVRFHSPFPVAADESARTKFDVMRLVKEVDYVNIKLMKS-GISDALAIVEIAESSG
3dfyE           YEQPVRREDIEGLKFVRFHSPFPVAADESARTKFDVMRLVKEVDYVNIKLMK-SGISDALAIVEIAESSG
3dfyN           YEQPVRREDIEGLKFVRFHSPFPVAADESARTKFDVMRLVKEVDYVNIKLMK-SGISDALAIVEIAESSG
3dfyB           YEQPVRREDIEGLKFVRFHSPFPVAADESARTKFDVMRLVKEVDYVNIKLMK-SGISDALAIVEIAESSG
3eezA           EQPGETLDDIAAIR---PLHSAPVSVDECLVTLQDAARVARDAEVFGIKLNRVGGLTRAARMRDIALTHG
3dfyL           YEQPVRREDIEGLKFVRFHSPFPVAADESARTKFDVMRLVKEVDYVNIKLMK-SGISDALAIVEIAESSG
3dfyH           YEQPVRREDIEGLKFVRFHSPFPVAADESARTKFDVMRLVKEVDYVNIKLMK-SGISDALAIVEIAESSG
3dfyF           YEQPVRREDIEGLKFVRFHSPFPVAADESARTKFDVMRLVKEVDYVNIKLMK-SGISDALAIVEIAESSG
1ec7C           AEDPCGAEQGFSMAEFRRATGLPTATNMIATDWRQMHTLSLQSVDIPLADPHFWTMQGSVRVAQMCHEFG
1ec7B           AEDPCGAEQREVMAEFRRATGLPTATNMIATDWRQMHTLSLQSVDIPLADPHFWTMQGSVRVAQMCHEFG
3cyjA           LEEPVSSEDREGLRLLRDRGGVAIAAGEYEWTLPQLHDLAGCVDILQADVTRCGGITGLLRVDGICRGHQ
3cb3C           IEEPLDAYDHEGHAALALQFDTPIATGEMLTSAAEHGDLIRHADYLMPDAPRVGGITPFLKIASLAEHAG
2dw7A           YEEVGDPLDYALQAALAEFYPGPMATGENLFSHQDARNLLRDRDWLQFDCALSYGLCEYQRTLEVLKTHG
2akzA           IEDPFDQDDWAAWSKFTANVGIQIVGDDLTVTNPKRIEEEKACNCLLLKVNQIGSVTEAIQACKLAQENG
2dw6A           YEEVGDPLDYALQAALAEFYPGPMATGENLFSHQDARNLLRYRDWLQFDCALSYGLCEYQRTLEVLKTHG
3d46A           IEECLPPQQYEGYRELKRNAPAGMMVTSGEHHGTLQSFRTTGIDIMQPDVGWCGGLTTLVEIAALAKSRG
3boxA           IEECLPPQQYEGYRELKRNAPAGMMVTSGEHHGTLQSFRTTGIDIMQPDVGWCGGLTTLVEIAALAKSRG
3cb3D           IEEPLDAYDHEGHAALALQFDTPIATGEMLTSAAEHGDLIRHADYLMPDAPRVGGITPFLKIASLAEHAG
1ec7A           AEDPCGAEQGFSMAEFRRATGLPTATNMIATDWRQMHTLSLQSVDIPLADPHFWTMQGSVRVAQMCHEFG
2akmB           IEDPFDQDDWAAWSKFTANVGIQIVGDDLTVTNPKRIEEEKACNCLLLKVNQIGSVTEAIQACKLAQENG
3cb3B           IEEPLDAYDHEGHAALALQFDTPIATGEMLTSAAEHGDLIRHADYLMPDAPRVGGITPFLKIASLAEHAG
3dfyA           YEQPVRREDIEGLKFVRFHSPFPVAADESARTKFDVMRLVKEVDYVNIK-LMKSGISDALAIVEIAESSG
1ec8A           AEDPCGAEQGFSMAEFRRATGLPTATNMIATDWRQMHTLSLQSVDIPLADPHFWTMQGSVRVAQMCHEFG
2al2A           IEDPFAEDDWEAWSHFFKTAGIQIVADDLTVTNPKRIAEKKAADALLLAVNQIGTLSESIKAAQDSFAAG
1chrA           IEQPVGRENTQALRRLSDNNRVAIMADESLSTLASAFDLARDVDVFSLKLCNMGGVSATQKIAAVAEASG
3dg6A           AEELCPADDVLSRRRLVGQLDMPFIADESVPTPADVTREVLGATAISIK-TARTGFTGSTRVHHLAEGLG
2al2B           IEDPFAEDDWEAWSHFFKTAGIQIVADDLTVTNPKRIAEKKAADALLLKVNQIGTLSESIKAAQDSFAAG
2bahA           IEQPLAWDDLVDHAELARRIRTPLCLDESVASASDARKALALGGVINLKVARVGGHAESRRVHDVAQSFG
1ec9A           AEDPCGAEQGFSMAEFRRATGLPTATNMIATDWRQMHTLSLQSVDIPLADPHFWTMQGSVRVAQMCHEFG
1bkhB           IEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAADASIFALKIAKNGGPRAVLRTAQIAEAAG
1bkhC           IEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAADASIFALKIAKNGGPRAVLRTAQIAEAAG
3bjsA           LEEPFACNDFASYEVAKITPLVPIAAGENHYTRFEFGQMLDAVQVWQPDLSKCGGITEGIRIAAMASAYR
2al1B           IEDPFAEDDWEAWSHFFKTAGIQIVADDLTVTNPKRIAEKKAADALLLKVNQIGTLSESIKAAQDSFAAG
3ddmA           LEEPLRADRPAAEWAELAQAAMPLAGGENIAGVAAFETALAALRVMQPDLAKWGGFSGCLPVARAVVAAG
3cb3A           IEEPLDAYDHEGHAALALQFDTPIATGEMLTSAAEHGDLIRHADYLMPDAPRVGGITPFLKIASLAEHAG
1dtnA           IEEPTLQHDYEGHQRIQSKLNVPVQMGENWLGPEEMFKAIGACRLAMPDAMKIGGVTGWIRASALAQQFG
3ct2A           IEQPISRNNRAGMVRLNASSPAPIMADESIECVEDAFNLAREASVFALKIAKNGGPRATLRTAAIAEAAG
3dgbA           IEQPISRNNRAGMVRLNASSPAPIMADESIECVEDAFNLAREASVFALKIAKNGGPRATLRTAAIAEAAG
3bjsB           LEEPFACNDFASYEVAKITPLVPIAAGENHYTRFEFGQMAGAVQVWQPDLSKCGGITEGIRIAAMASAYR
1ebhA           IEDPFAEDDWEAWSHFFKTAGIQIVADDLTVTNPKRIAEKKAADALLLKVNQIGTLSESIKAAQDSFAAG
1bkhA           IEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAADASIFALKIAKNGGPRAVLRTAQIAEAAG
3dg3A           AEELCPADDVLSRRRLVGQLDMPFIADESVPTPADVTREVLGATAISIK-TARTGFTGSTRVHHLAEGLG
3dipB           VEDPIAKMDNPAVADLRRQTRAPICGGENLAGTRRFHEMLCAIDFVMLDLTWCGGLSEGRKIAALAETHA
3bsmA           LEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNIDYIRMPLTHGGGITAMRRVADLASLYH
3dipA           VEDPIAKMNIPAVADLRRQTRAPICGGENLAGTRRFHEMLCAIDFVMLDLTWCGGLSEGRKIAALAETHA
1ec9D           AEDPCGAEQGFSMAEFRRATGLPTATNMIATDWRQMGTLSLQSVDIPLADPHFWTMQGSVRVAQMCHEFG
3dfhA           IEDILPPNQTEWLDNIRSQSSVSLGLGELFNNPEEWKSLNRRIDFIRCHVSQIGGITPALKLGHLCQNFG
1ec7D           AEDPCG--AEQGFSGREVMAEFRRATGLPTATNMMGHTLSLQSVDIPLADPHFWTMQGSVRVAQMCHEFG
1bqgA           AEDPCGAENREVMAEFRRSTGLRTATNMIATDWRQMHAIQLQSVDIPLADPHFWTMQGSVRVAQMCNEWG


                         .         *         .         .         .         .         +:350
query           LEVMCGCMIESNXXXXXXXXXXXXXXXXXXXGSLLLAEDQYDGIEMGGGEIRLGDQERAGTGARPxxxx
3derA           LKLMIGCMGES----------------------------------------------------------
3dfyE           LKLMIGCMGES----------------------------------------------------------
3dfyN           LKLMIGCMGES----------------------------------------------------------
3dfyB           LKLMIGCMGES----------------------------------------------------------
3eezA           IDMFVMATGGS----------------------------------------------------------
3dfyL           LKLMIGCMGES----------------------------------------------------------
3dfyH           LKLMIGCMGES----------------------------------------------------------
3dfyF           LKLMIGCMGES----------------------------------------------------------
1ec7C           LTWGSHSNNHF----------------------------------------------------------
1ec7B           LTWGSHSNNHF----------------------------------------------------------
3cyjA           IPFSAHCAPAVS---------------------------------------------------------
3cb3C           LMLAPHFAMELH---------------------------------------------------------
2dw7A           WSPSRCIPHGGHQMSLNIAAGLGLGGNESYPDLFQPYGGFPDGVRVENGHITMPDLPGIG---------
2akzA           WGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSENQLMRIEEELGDE----ARFAGHNFR-----
2dw6A           WSPSRCIPHGGHQMSLNIAAGLGLGGNESYPDLFQPYGGFPDGVRVENGHITMPDLPGIG---------
3d46A           QLVVPHGSSVY----------------------------------------------------------
3boxA           QLVVPHGSSVY----------------------------------------------------------
3cb3D           LMLAPHFAMELH---------------------------------------------------------
1ec7A           LTWGSHSNNHF----------------------------------------------------------
2akmB           WGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAQLMRIEEELGDEA--RFAGHNFRN----
3cb3B           LMLAPHFAMEL----------------------------------------------------------
3dfyA           LKLMIGCMGES----------------------------------------------------------
1ec8A           LTWGSHSNNHF----------------------------------------------------------
2al2A           WGVMVSHRSGE----------------------------------------------------------
1chrA           IASYGGTMLDS----------------------------------------------------------
3dg6A           LDMVMGNQIDG----------------------------------------------------------
2al2B           WGVMVSHRSGE----------------------------------------------------------
2bahA           APVWCGGMLES----------------------------------------------------------
1ec9A           LTWGSHSNNHF----------------------------------------------------------
1bkhB           IGLYGGTMLEG----------------------------------------------------------
1bkhC           IGLYGGTMLEG----------------------------------------------------------
3bjsA           IPINAHSS-------------------------------------------------------------
2al1B           WGVMVSHRSGE----------------------------------------------------------
3ddmA           LRYCPHYL-------------------------------------------------------------
3cb3A           LMLAPHFAMEL----------------------------------------------------------
1dtnA           IPMSSHLFQEI----------------------------------------------------------
3ct2A           IGLYGGTMLEG----------------------------------------------------------
3dgbA           IGLYGGTMLEG----------------------------------------------------------
3bjsB           IPINAHSS-------------------------------------------------------------
1ebhA           WGVMVSHRSGE----------------------------------------------------------
1bkhA           IGLYGGTMLEG----------------------------------------------------------
3dg3A           LDMVMGNQIDG----------------------------------------------------------
3dipB           RPLAPHTGPVALMAGLHLALHAPTAIFQEVVRASWYADLVDHLPVIQEGIALAPTRPGLG---------
3bsmA           VRTGFHG--------------------------------------------------------------
3dipA           RPLAPHTGPVA----------------------------------------------------------
1ec9D           LTWGSHSN-------------------------------------------------------------
3dfhA           VRIAWHC--------------------------------------------------------------
1ec7D           LTWGSHSN-------------------------------------------------------------
1bqgA           LTWGSHSNNHF----------------------------------------------------------