[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for hlac0:ACM56309.1

[Show Plain Result]


## Summary of Sequence Search
    1::357
   22::304     3e-52  45%  306 aa  PF00146 NADHdh "NADH dehydrogenase"
    1::357

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKRKITAAFTDRIAVNRIGP
PF00146         ---------------------------------------------------ERKVLAYMQLRKGPNRVGP


                         .         .         *         .         .         .         .:140
query           FGLLIIPAAAVQLLAKELIIPEGVDRPTWDIAPILLPASAMLGFSVIPMGQIGPLNIHLADPEVGLALVF
PF00146         FGLLQPFADALKLFTKEDIIPSTANKFLFLLAPILALILALLAWAVIPFG----YPLVLADLNLGLLFFL


                         +         .         .         .         .         *         .:210
query           AFASIASVSLVMAGYASNNKYSLLGGLRAVAQNLAYEIPLIVTAMSVVVFAGTLQISGVVGAQTETLVTI
PF00146         ALSSLAVYGILLAGWASNSKYALLGALRAVAQMISYEVSLGLILLSVILLAGSLSLSDIVEAQE------


                         .         .         .         +         .         .         .:280
query           AGFDIPAWFAFVNPFAFVLFLTANMAEIGRNPFDIPEAPTEIVGGYQTEYSSAYFVLFYLGEFVHIFLGG
PF00146         -----PIWFIFPLPPLFIMFFISTLAETNRAPFDLPEAESELVSGFNTEYSGGPFALFFLAEYANIILMS


                         .         *         .         .         .         .         +:350
query           AILSVVFLGGASGPGPESISFIWFVVKVWGFFLFTQWARAAIPRVRIDQLIEIGWKGMLVLSFANLVLTx
PF00146         ALTAILFLGGWLGPLGPLLGLLWFLLKVLLLLFLFIWVRATLPRFRYDQLMHLGWKVLLPLSLANLLLT-


                         .         .         .         .         *         .         .:420
query           xxxxxxx
PF00146         -------