[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for hlac0:ACM56606.1

[Show Plain Result]


## Summary of Sequence Search
    1::266
    5::72      4e-07  38%   74 aa  PF00575 S1 "S1 RNA binding domain"
    1::266

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxGELVVGDVDEIADFGVFVDLDEYEDKRGLCHISEVASGWIKNVRDHVREGQTVVAKVLDVD
PF00575         ---------GNIYLGKVTRVEPFGAFVDLGG--GKEGFLHISELSPDRVEDPEDVLKVGDEVKVKVLKVD


                         .         .         *         .         .         .         .:140
query           ESANQIDLSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00575         RGTKGISLS-------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00575         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00575         --------------------------------------------------------