[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for hlac0:ACM56614.1

[Show Plain Result]


## Summary of Sequence Search
    1::221
   20::187     1e-19  37%  191 aa  PF01596 Methyltransf_3 "O-methyltransferase"
    1::221

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPEAGAVLRLLARLTDAERVFEFGSGFGYSAT
PF01596         ---------------------------------------PEQGQFLYLLVRLIGAKRILEIGTYTGYSAL


                         .         .         *         .         .         .         .:140
query           WFLRGGADAVICAEFDEEEAKRGVQFAADGGYADSVTFEVGDAMETIERYDGPFDVVLIDHLKGRYADAY
PF01596         WLALALPEKITTIEINPERAEIARENIEKAGLADRIDLREGDALETLPRLEGTFDFIFIDADKDNYLNYL


                         +         .         .         .         .         *         .:210
query           RAVLPKVRTGGVIVADNITRGPIDFGDLVAHFEDGAPLPDPEVDGETRGIGEYVGTVRSDEAVETAILPV
PF01596         ELALRLLRPGGVIVADNVLW--------------PGRVADPDADRKTVRIREFNEALAADPRVETTLLPI


                         .         .         .         +         .         .         .:280
query           GSGIxxxxxxx
PF01596         GDGL-------