[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for hlac0:ACM57204.1

[Show Plain Result]


## Summary of Sequence Search
    1::377
    1::99      4e-15  53%  107 aa  PF02894 GFO_IDH_MocA_C "Oxidoreductase family, C-terminal
    2::98      3e-13  43%  119 aa  PF01408 GFO_IDH_MocA "Oxidoreductase family, NAD-binding Rossmann
    1::377

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxRIGVLGYRFMGKAHANALARLPMFFPDAPDIERHTLVGRXXXXXXXXXXRFGFSHTATDWEDSL
PF02894         ----------------------------------------------------------------------
PF01408         ------RVGIIGAGRIGRAHLRALLRLP-------GVELVAVADRDPERAEAFAEKFGIP-AYTDYEELL


                         .         .         *         .         .         .         .:140
query           DEVDVFYNLGPNHVHAEPSIAALEAGVPVLCEKPLAPTLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02894         ----------------------------------------------------------------------
PF01408         ADIDAVVIATPDHTHAEIALAALEAGKHVLCEKPLALTL-------------------------------


                         +         .         .         .         .         *         .:210
query           xKGLIEDGELGEIRQVRGRYLQDWLVDPEAPWAWRMDADTAGSGALGDLGAHTLDLADFLVGDEVGEIDR
PF02894         -KELIDSGELGEIRHVRGEYLQDW-AGPPSPWRWRWDP-AAGGGALLDLGIHDLDLARWLLG--------
PF01408         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VSGHLQTFVDERPVYDEAGDVEEYRDVTVDDAYTAQVAYESGAMGSFEATxxxxxxxxxxxxxxxxxxxx
PF02894         ----------EPPVVVAATGRTVPPGGEVEDAAFANLAFGSGAVSTVAAS--------------------
PF01408         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02894         ----------------------------------------------------------------------
PF01408         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02894         ---------------------------
PF01408         ---------------------------