[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for hlac0:ACM57205.1

[Show Plain Result]


## Summary of Sequence Search
    1::323
    2::40      5e-07  54%   48 aa  PF07582 AP_endonuc_2_N "AP endonuclease family 2 C terminus"
  109::186     2e-06  46%  200 aa  PF01261 AP_endonuc_2 "Xylose isomerase-like TIM barrel"
    1::323

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07582         ----------------------------------------------------------------------
PF01261         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07582         ----------------------------------------------------------------------
PF01261         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxDLAKHADHHGVDVAIEMHPNMLVYEPTGMLALREATNERIGANFDPSHLYWQGIDVIE
PF07582         ----------------------------------------------------------------------
PF01261         ------------ELADYAAKHGVRLAIENHPGEGTYEEA--LRLLEAVGSNVGLNLDTGHAFAAGEDPVE


                         .         .         .         +         .         .         .:280
query           AIRFLGDHDAIHHFHAKDTKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxWKDVVSTLRMVG
PF07582         ----------------------------------------------------------WKAIFSALRQIG
PF01261         ALEKLGDR--IGHVHLKDSK--------------------------------------------------


                         .         *         .         .         .         .         +:350
query           YEGALSIEHEDSLTSSREGLEKAVDVLxxxxxxxxxxxxxxxx
PF07582         YDGWLSIEHEDALMSPEEGAREAAAFL----------------
PF01261         -------------------------------------------