[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for hlac0:ACM57207.1

[Show Plain Result]


## Summary of Sequence Search
    1::349
    4::98      1e-10  44%   98 aa  PF01188 MR_MLE "Mandelate racemase / muconate lactonizing enzyme,
   11::110     2e-08  42%  110 aa  PF02746 MR_MLE_N "Mandelate racemase / muconate lactonizing enzyme,
    1::349

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxRGTQTDAENVIVKIADEAGMTGVGGAAPSAHYGETADTVEAVLPDLLDA
PF01188         ----------------------------------------------------------------------
PF02746         ---------------------RGTRTEAEVVLVEIETDDGIVGWGEAVP---YGR-AETVAAALEEHLAP


                         .         .         *         .         .         .         .:140
query           VERVGDPXXXXXXXXXXXXVVNGNPAARAAVSIAVHDLAAKRLGVPLHRLWGxxxxxxxxxxxxxxxxxx
PF01188         ----------------------------------------------------------------------
PF02746         LLIGLDPADIEALWQLLDRALFGNSAAKAAIDMALWDLLAKAAGVPLYQLLG------------------


                         +         .         .         .         .         *         .:210
query           xxVREKAEAAVDAGYPILKIKLGTDRDRELIDAVREAAPDARLRVDANEAWTPREAVRKCEWLADRDVEF
PF01188         --VAEEAEEAVEEGFRAIKVKVGVPEDVERVEAVREAVGDVDLLVDANGRWTPEEAIRLAKALEPYGLFW
PF02746         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VEQPVPAEDPEGLRFVYERSALPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01188         LEEPLPAEDQEGLAELRRHTTTP-----------------------------------------------
PF02746         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01188         ---------------------------------------------------------------------
PF02746         ---------------------------------------------------------------------