[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for hlac0:ACM57526.1

[Show Plain Result]


## Summary of Sequence Search
    1::192
    3::142     7e-28  53%  143 aa  PF07920 DUF1684 "Protein of unknown function (DUF1684)"
    1::192

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAFPGLAYFDPDPAYRFVVPLHEHDEKETVT
PF07920         ----------------------------------------AFKGLPYFPYDPAWRVEARFEPYPDPRTVT


                         .         .         *         .         .         .         .:140
query           VETTADGEQTYRRWGEFRLEIDGETVTLQAYRPTDGADRFWVPFRDETSGETTYGAGRYLDLEPDRDRVD
PF07920         VETSTGRTVRYVRVGTVEFELDGKEYTLTVYRLEEYGGGLFVPFRDATSGKETYGGGRYLDLEPPGDDL-


                         +         .         .         .         .         *         .:210
query           GEWVVDCNVAYNPTCAYNHAYECPLIPMENWLDVAIEAGEKxxxxxxxxxxx
PF07920         GTVVLDFNRAYNPPCAYSPAYTCPLPPAENRLDVAVEAGEK-----------