[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for hlac0:ACM55757.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1n0uA2.bssp"
#ERROR : Can't open dsspfile "1n0uA3.bssp"
#ERROR : Can't open dsspfile "1darA2.bssp"
#ERROR : Can't open dsspfile "1darA4.bssp"
#ERROR : Can't open dsspfile "1fnmA4.bssp"
#ERROR : Can't open dsspfile "1f60A3.bssp"
#ERROR : Can't open dsspfile "1s1mA2.bssp"
#ERROR : Can't open dsspfile "1n0uA5.bssp"
#ERROR : Can't open dsspfile "1n0uA4.bssp"
#ERROR : Can't open dsspfile "1nriA.bssp"
#ERROR : Can't open dsspfile "1aipA3.bssp"
#ERROR : Can't open dsspfile "1wdtA2.bssp"
#ERROR : Can't open dsspfile "1p9qC3.bssp"
#ERROR : Can't open dsspfile "1q4rA.bssp"
#ERROR : Can't open dsspfile "1upsA2.bssp"
#ERROR : Can't open dsspfile "1darA3.bssp"
#ERROR : Can't open dsspfile "1o9nA.bssp"
#ERROR : Can't open dsspfile "1vi7A2.bssp"
#ERROR : Can't open dsspfile "1g7rA4.bssp"
#ERROR : Can't open dsspfile "1h65A.bssp"
#ERROR : Can't open dsspfile "1g7rA1.bssp"
#ERROR : Can't open dsspfile "1eniA.bssp"
#ERROR : Can't open dsspfile "1vfgA2.bssp"
#ERROR : Can't open dsspfile "2hgjF1.bssp"
#ERROR : Can't open dsspfile "1c82A1.bssp"
#ERROR : Can't open dsspfile "2g40A1.bssp"
#ERROR : Can't open dsspfile "1n0uA1.bssp"
#ERROR : Can't open dsspfile "2bv3A4.bssp"
#ERROR : Can't open dsspfile "1r5bA1.bssp"
#ERROR : Can't open dsspfile "1bm8A.bssp"
#ERROR : Can't open dsspfile "1darA1.bssp"
#ERROR : Can't open dsspfile "1wb1A1.bssp"
#ERROR : Can't open dsspfile "1puiA.bssp"
#ERROR : Can't open dsspfile "1wdtA1.bssp"
#ERROR : Can't open dsspfile "1lnzA2.bssp"
#ERROR : Can't open dsspfile "1g7rA2.bssp"
#ERROR : Can't open dsspfile "1aipA1.bssp"
#ERROR : Can't open dsspfile "1zunB1.bssp"
#ERROR : Can't open dsspfile "1kjzA1.bssp"
#ERROR : Can't open dsspfile "2cxxA1.bssp"
#ERROR : Can't open dsspfile "2fh5B1.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "1nrjB.bssp"
#ERROR : Can't open dsspfile "1eg7A.bssp"
#ERROR : Can't open dsspfile "1d1nA.bssp"
#ERROR : Can't open dsspfile "1xzpA2.bssp"
#ERROR : Can't open dsspfile "2q22A1.bssp"
#ERROR : Can't open dsspfile "1egaA1.bssp"
#ERROR : Can't open dsspfile "1sulA.bssp"

## Summary of PDB Search
:729
    9e-49  34%  1n0uA2 [c.37.1.8] ELONGATION FACTOR 2 A:3 -- 343
    5e-42  31%  1n0uA3 [d.14.1.1] ELONGATION FACTOR 2 A:561 -- 725
    1e-29  40%  1darA2 [c.37.1.8] ELONGATION FACTOR G A:1 -- 282
    2e-21  33%  1darA4 [d.58.11.1] ELONGATION FACTOR G A:600 -- 689
    3e-19  38%  1fnmA4 [d.58.11.1] ELONGATION FACTOR G A:404 -- 482
    3e-19  24%  1f60A3 [c.37.1.8] ELONGATION FACTOR EEF1A A:2 -- 240
    1e-17  15%  1s1mA2 [c.37.1.10] CTP SYNTHASE A:1 -- 266
    2e-17  29%  1n0uA5 [d.58.11.1] ELONGATION FACTOR 2 A:726 -- 842
    3e-16  40%  1n0uA4 [d.58.11.1] ELONGATION FACTOR 2 A:482 -- 560
    2e-15   7%  1nriA  [c.80.1.3] HYPOTHETICAL PROTEIN HI0754
    2e-15  30%  1aipA3 [c.37.1.8] ELONGATION FACTOR TU A:9 -- 212
    4e-15  24%  1wdtA2 [c.37.1.8] ELONGATION FACTOR G HOMOLOG A:8 -- 274
    3e-14  16%  1p9qC3 [d.58.11.3] HYPOTHETICAL PROTEIN AF0491 C:162 -- 234
    8e-14  14%  1q4rA  [d.58.4.4] PROTEIN AT3G17210
    1e-13  12%  1upsA2 [b.42.2.3] GLCNAC-ALPHA-1,4-GAL-RELEASING ENDO-BETA- A:290
    2e-13  22%  1darA3 [d.14.1.1] ELONGATION FACTOR G A:476 -- 599
    2e-13  12%  1o9nA  [c.117.1.1] MALONAMIDASE E2
    2e-13   9%  1vi7A2 [d.58.11.2] HYPOTHETICAL PROTEIN YIGZ A:138 -- 208
    4e-11  22%  1g7rA4 [c.37.1.8] TRANSLATION INITIATION FACTOR IF2/EIF5B A:1 --
    4e-11   9%  1h65A  [c.37.1.8] CHLOROPLAST OUTER ENVELOPE PROTEIN OEP34
    9e-11  20%  1g7rA1 [b.43.3.1] TRANSLATION INITIATION FACTOR IF2/EIF5B A:228 --
    1e-10  12%  1eniA  [a.18.1.1] ENDONUCLEASE V
    1e-10   5%  1vfgA2 [d.218.1.4] POLY A POLYMERASE A:1 -- 136
    2e-10  12%  2hgjF1 [c.22.1.1] 50S RIBOSOMAL PROTEIN L4 F:3 -- 208
    2e-10  11%  1c82A1 [a.102.3.2] HYALURONATE LYASE A:171 -- 540
    3e-10   9%  2g40A1 [c.124.1.7] CONSERVED HYPOTHETICAL PROTEIN A:38 -- 212
    4e-10  28%  1n0uA1 [b.43.3.1] ELONGATION FACTOR 2 A:344 -- 481
    5e-10  37%  2bv3A4 [d.58.11.1] ELONGATION FACTOR G A:404 -- 478
    8e-10  10%  1r5bA1 [b.43.3.1] EUKARYOTIC PEPTIDE CHAIN RELEASE FACTOR GTP-
    8e-10   9%  1bm8A  [d.34.1.1] TRANSCRIPTION FACTOR MBP1
    1e-09  30%  1darA1 [b.43.3.1] ELONGATION FACTOR G A:283 -- 400
    1e-09  19%  1wb1A1 [b.43.3.1] TRANSLATION ELONGATION FACTOR SELB A:180 -- 271
    3e-09  12%  1puiA  [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGB
    4e-09  24%  1wdtA1 [b.43.3.1] ELONGATION FACTOR G HOMOLOG A:275 -- 377
    5e-09  11%  1lnzA2 [c.37.1.8] SPO0B-ASSOCIATED GTP-BINDING PROTEIN A:158 -- 342
    4e-08  12%  1g7rA2 [b.43.3.1] TRANSLATION INITIATION FACTOR IF2/EIF5B A:460 --
    5e-08  19%  1aipA1 [b.43.3.1] ELONGATION FACTOR TU A:213 -- 312
    6e-08  20%  1zunB1 [b.43.3.1] SULFATE ADENYLATE TRANSFERASE, SUBUNIT B:238 --
    4e-07  16%  1kjzA1 [b.43.3.1] EIF2GAMMA A:201 -- 321
    5e-07  10%  2cxxA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGB A:2 -- 185
    8e-07  16%  2fh5B1 [c.37.1.8] SIGNAL RECOGNITION PARTICLE RECEPTOR BETA B:63 --
    3e-06  10%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
    4e-06  26%  1nrjB  [c.37.1.8] SIGNAL RECOGNITION PARTICLE RECEPTOR BETA
    5e-06  10%  1eg7A  [c.37.1.10] FORMYLTETRAHYDROFOLATE SYNTHETASE
    8e-06  14%  1d1nA  [b.43.3.1] INITIATION FACTOR 2
    2e-05  11%  1xzpA2 [c.37.1.8] PROBABLE TRNA MODIFICATION GTPASE TRME A:212 --
    7e-05  14%  2q22A1 [d.365.1.1] UNCHARACTERIZED PROTEIN A:8 -- 138
    9e-05  15%  1egaA1 [c.37.1.8] PROTEIN (GTP-BINDING PROTEIN ERA) A:4 -- 182
    1e-04   8%  1sulA  [c.37.1.8] GTP-BINDING PROTEIN YSXC
:729

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxKKIVQECERLMDEPDNIRNIAIAAHVDHGKTTLSDNLLAGAGMISQDTAGEQLAMDTKEDEQERGI
1n0uA2          -------VDQMRSLMDKVTNVRNMSVIAHVDHGKSTLTDSLVQRAGIISAGITIKSTAISLYSEMSDEDV
1n0uA3          ----------------------------------------------------------------------
1darA2          ------------KVEYDLKRLRNIGIAAHIDAGKTTTTERILYYTGRAAVTTCFWK--------------
1darA4          ----------------------------------------------------------------------
1fnmA4          ----------------------------------------------------------------------
1f60A3          -------------------SHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFWVLDKLKAERERGI
1s1mA2          ----------------------------------------------------------------------
1n0uA5          ----------------------------------------------------------------------
1n0uA4          ----------------------------------------------------------------------
1nriA           --------------NEEDKLVPLASCLPQISLAVEQIVQAFQQGGRLIYIGAGTSGRLGVLDASECPPTF
1aipA3          ---------------------VNVGTIGHVDHGKTTLT-------AALTYVTAA-------------ENP
1wdtA2          --------------------IRTVALVGHAGSGKTTLTEALLYKTGAKERRGRVEETTTDYTPEAKLHRT
1p9qC3          ----------------------------------------------------------------------
1q4rA           -------------LLASFKDGVSPEKIEELIKGYANLVNLIEPXKAFHWG--------KDVSIENLHQGY
1upsA2          ----------------------NNYLIRNRQTGKFLY---------------------IEENNDKVSYGI
1darA3          ----------------------------------------------------------------------
1o9nA           -------------------------------------------GSSSGSAAAVGAGMIPLALGTQTGGSV
1vi7A2          ----------------------------------------------------------------------
1g7rA4          ----------------------------------TTLLDHI-RGSAVASQHIGATEIPXDVIEGI-----
1h65A           ------------------APATQTKLLELLGNLKQEDVNSLVXGKGGVGKSSTVNSIIERVVSISPFQSE
1g7rA1          ----------------------------------------------------------------------
1eniA           ----------------------------------------------------------------------
1vfgA2          ----------------------RDILLGKEVWDVDFVVEGNAAKELARRHGVNVHPFPEFGTAHLKIGKL
2hgjF1          -------------------HLLWEVVRRRGTASTKTRGEVAYSGRKIWPQKH------TGRARHGDIGAP
1c82A1          -----------------------------------------------------------DTYTDRLDDWN
2g40A1          ----------------------------------------------------------------------
1n0uA1          ----------------------------------------------------------------------
2bv3A4          ----------------------------------------------------------------------
1r5bA1          ----------------------------------------------------------------------
1bm8A           ----------------------------------------------------------------------
1darA1          ----------------------------------------------------------------------
1wb1A1          ----------------------------------------------------------------------
1puiA           --------------------VMSAPDIRHLPSDTGIEVA-------FAGRSNAGKSSALNTLTNQQLINL
1wdtA1          ----------------------------------------------------------------------
1lnzA2          --------------------LADVGLVGFPSVGKSTLLSVVSSAKPKIADYHFTTLVPNLGXVETDDGRS
1g7rA2          ----------------------------------------------------------------------
1aipA1          ----------------------------------------------------------------------
1zunB1          ----------------------------------------------------------------------
1kjzA1          ----------------------------------------------------------------------
2cxxA1          -----------------------IIFAGRSNVGKSTLIYRLTGKKVRRGKRPGVTRKIIEIENHKIIDXP
2fh5B1          ---------------------RAVLFVGLCDSGKTLLFVRLLTGQYRDTQTSITDSSAIYKVNNNRGNSL
1ni3A1          -------------QWGRPGNNLKTGIVGXPNVGKSTFFRAITKSVLGNPANYATIDPEEAKVAVPDERFD
1nrjB           -------------------YQPSIIIAGPQNSGKTSLLTLLTT--------------------DSVRPTV
1eg7A           ----------------------------------------------------------GFGADLGAEKFY
1d1nA           ----------------------------------------------------------------------
1xzpA2          ----------------------RMVIVGKPNVGKSTL----------LNRLLNEDRAIVTDIPGTTRDVI
2q22A1          ----------------------------------------------------------------------
1egaA1          ----------------DKSYCGFIAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRHRIVGIHTEGAYQ
1sulA           ----EIVISAVKPEQYPEGGLPEIALAGRSNVGKSSFINSLINRKNLAQTLNFYIINDELH---------


                         .         .         *         .         .         .         .:140
query           TIDAANVSMTHEYEDTNHLINLIDTPGHVDFGGDVTRAMRXXXXXXXXXXXXXXXMPQTETVLRQALREG
1n0uA2          K------EIKQKTDGNSFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTIEGVCVQTETVLRQALGER
1n0uA3          ----------------------------------------------------------------------
1darA2          ----------------DHRINIIDTPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYK
1darA4          ----------------------------------------------------------------------
1fnmA4          ----------------------------------------------------------------------
1f60A3          TIDIAL----WKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGIEHALLAFTLG
1s1mA2          ----------------------------------------------------------------------
1n0uA5          ----------------------------------------------------------------------
1n0uA4          ----------------------------------------------------------------------
1nriA           GVSTEXVKGIIAGGECAIRHPVEGAEDNTKAVLNDLQSIHFSKNDVLVGIAASGRTPYVIAGLQYAKSLG
1aipA3          TAHV-------EYETAKRHYSHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVG
1wdtA2          TVRTGVA----PLLFRGHRVFLLDAPGYGDFVGEIRGALEAADAALVAVSAEAGVQVGTERAWTVAERLG
1p9qC3          ----------------------------------------------------------------------
1q4rA           THI-----FESTFESKEAVAEYIAHPAHVEFATIFLGSLD------------------------------
1upsA2          TLKNEKNAKWSKNNETGEYLNIENQTGYIEH-GKVPKTWWSAQWSEVPVDGYTRFVNRWKPNMSIHTESY
1darA3          ----------------------------------------------------------------------
1o9nA           IRPAAYCGTAAI----KPSFRMLPTVGVKCYSWALDTFGARAEDLARGLLAMTGRSEFSGIVPAKAPRIG
1vi7A2          ----------------------------------------------------------------------
1g7rA4          ---CGDFLKKFSIRETLPGLFFIDTPGAFTT--LRKRGGALADLAILIVDINEGFKPQTQEALNILRXYR
1h65A           GPRPVXVSRSRA----GFTLNIIDTPGLIEGLNIIKSFLLDKTIDVLLYVDRLDAYRVDNLITDSFGKGI
1g7rA1          ----------------------------------------------------------------------
1eniA           -------------------INLTLVSELADQHLMAEYRELPRVFGAVRKHVANGKRVRDFKISPTFILGA
1vfgA2          KLEFATARRETVEP-----ASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKD----------
2hgjF1          IFVGGGVVF-----GPKPRDYSYTLPKKVRKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAG
1c82A1          GIIAGNQY--YDSKNDQMALNQELEGKVADS-------LSSISSQADRIYLWEKFSNYKTSANLTATYRK
2g40A1          ----------------------------------------------------------------------
1n0uA1          ----------------------------------------------------------------------
2bv3A4          ----------------------------------------------------------------------
1r5bA1          ----------------------------------------------------------------------
1bm8A           ----------------------------------------------------------------------
1darA1          ----------------------------------------------------------------------
1wb1A1          ----------------------------------------------------------------------
1puiA           FEVADGK----RLVDLPGYG--EMKRKWQRALGEYLEKRQ------------------------------
1wdtA1          ----------------------------------------------------------------------
1lnzA2          FV---XADLPGLIEGAHQGVGLGHQFLRHIERTRVIVHVIDXSGLEGRDPYDDYLTINQELSEYNLRLTE
1g7rA2          ----------------------------------------------------------------------
1aipA1          ----------------------------------------------------------------------
1zunB1          ----------------------------------------------------------------------
1kjzA1          ----------------------------------------------------------------------
2cxxA1          GFGFXXGLPKEVQERIKDEIVHFIEDNAKNIDVAVLVVDGKAAPEIIKRWEKRGEIPIDVEFYQFLRELD
2fh5B1          TLIDLPGHESLRFQLLDRFKSSARAVVFVVDSAAFQREV-----------KDVAEFLYQVLIDSMALKNS
1ni3A1          WLCEAYKPKSRVPAFLTVFDIAGLTKGASTGVGLGNAFLSHVRAVDAIYQVVRAFDDAEIIHVEGDVDPI
1nrjB           VSQEPLS----AADYDGSGVTLVDFPGHVKL---------------------------------------
1eg7A           DVKCRYAGFKPDATVIVA----------TVRALKMHGGVPKSDLATENLEALREGFANLEKHIENIGKFG
1d1nA           ----------------------------------------------------------------------
1xzpA2          SEEIVIRGILFRIVDTAGVRSETNDLVERLGIERTLQEIEKADIVLFVLDASSPLDEEDRKILERIKNKR
2q22A1          ----------------------------------------------------------------------
1egaA1          AI-----------YVDTPGLHMEEKRAINRLMNKAASSSIGDVELVIFVVEGTRWTPDDEMVLNKLREGK
1sulA           --------FVDVPGYGFAKVSKSEREAWGRMIETYITTREELKAVVQIVDLRHAPSNDDVQMYEFLKYYG


                         +         .         .         .         .         *         .:210
query           VKPALFINKVDRLISELQEGPQEMQERLMSVIADVNELIRGMAENMDDIPEDWTVSVEDGTVGFGSALYK
1n0uA2          IKPVVVINKVDRALLELQVSKEDLYQTFARTVESVNVIVSTYA---DEVLGDVQVYPARGTVAFGSGLHG
1n0uA3          ----------------------------------------------------------------------
1darA2          VPRIAFANKMDKTGADLWLVIRTMQERL------------------------------------------
1darA4          ----------------------------------------------------------------------
1fnmA4          ----------------------------------------------------------------------
1f60A3          VRQIVAVNKMDS--------VKWDESRFQEIVKETSNFIKKVGYNPKTVP-FVPISGWNG----------
1s1mA2          ----------------------------------------------------------------------
1n0uA5          ----------------------------------------------------------------------
1n0uA4          ----------------------------------------------------------------------
1nriA           ALTISIASNPKSEXAEIADIAIETIVG-------------------------------------------
1aipA3          VPYVVFMNKVDM---------VDDPELLDLVEMEVRDLLNQYEFPGDEVP--------------------
1wdtA2          LPRMVVVTKLDK----------------------------------------------------------
1p9qC3          ----------------------------------------------------------------------
1q4rA           ----------------------------------------------------------------------
1upsA2          VPNTYWTSQWQLIPVE------------------------------------------------------
1darA3          ----------------------------------------------------------------------
1o9nA           VVRQEFAGAVEPAAEQGLQAAIKAAERAGASVQAID----------------------------------
1vi7A2          ----------------------------------------------------------------------
1g7rA4          TPFVVAANKIDRI---------------------------------------------------------
1h65A           WNKIVALTHAQFSYDEFFSKRSEALLQVVRSGASLKKDAQASDIPVVLIENSGRCNKNDSDEKVLPNGIA
1g7rA1          ----------------------------------------------------------------------
1eniA           GHVTFFYDKLEFLRKRQIELIAECLKRGF-----------------------------------------
1vfgA2          ----------------------------------------------------------------------
2hgjF1          LDGSESVLLVTG-----NELVRRAARNLPWVVTLAPEGLNVYDIVRTERL--------------------
1c82A1          LEEMAVTNPSSRYYQD--------ETVVRTVRDSMEWMHKHVYNSEKSIVGNWWDYEIGTPRAINNTLSL
2g40A1          ----------------------------------------------------------------------
1n0uA1          ----------------------------------------------------------------------
2bv3A4          ----------------------------------------------------------------------
1r5bA1          ----------------------------------------------------------------------
1bm8A           ----------------------------------------------------------------------
1darA1          ----------------------------------------------------------------------
1wb1A1          ----------------------------------------------------------------------
1puiA           ----------------------------------------------------------------------
1wdtA1          ----------------------------------------------------------------------
1lnzA2          RPQIIVANKXDXPEAAENLEAFKEKLTDYPVFPGLRELLFEVANQLENTPEFPLYDEEE-----------
1g7rA2          ----------------------------------------------------------------------
1aipA1          ----------------------------------------------------------------------
1zunB1          ----------------------------------------------------------------------
1kjzA1          ----------------------------------------------------------------------
2cxxA1          IPTIVAVNKLDKIKNVQEVINFLAEKFEVPLSEIDKVFIPISADNIERL---------------------
2fh5B1          PSLLIACNKQDI----------------------------------------------------------
1ni3A1          RDLSIIVDELLIKDAEFVEKHLEGLRKI------------------------------------------
1nrjB           ----------------------------------------------------------------------
1eg7A           VPAVVAINAFPTDTEAELNLLYELCAKAGAEVALGLELARKVLQTLESRPSNFHVLYNLDLSIKDKIAKI
1d1nA           ----------------------------------------------------------------------
1xzpA2          YL--VVINKVD-VVEKINEEEIKNKLGT------------------------------------------
2q22A1          ----------------------------------------------------------------------
1egaA1          APVILAVNKVDNVDLLPHLQFLASQMNFLDIVTIAAIVRKHLPEATHHFPE-------------------
1sulA           IPVIVIATKADKIPKGKWDKHAKVVRQTLNIDPED-ELILFSSETKKGKDE-------------------


                         .         .         .         +         .         .         .:280
query           WGVSMPSMQRTGMDFGDIMDLEQNDKRDELHERTPLSDVVLDMVCEHFPNPVDAQPRRVPRIWRGDAESE
1n0uA2          WAFTIRQFKKFGVDKAKMMDRLWGDNKDTDAEGKPLEMFILDPIFRLFTAIMNFKKDEIPVLL-------
1n0uA3          ----------------------------------------------------------------------
1darA2          ----------------------------------------------------------------------
1darA4          ----------------------------------------------------------------------
1fnmA4          ----------------------------------------------------------------------
1f60A3          ----------------------------------------------------------------------
1s1mA2          ----------------------------------------LDPYINVTMSPIQHGEVFVT-----EDGAE
1n0uA5          ----------------------------------------------------------------------
1n0uA4          ----------------------------------------------------------------------
1nriA           ----------------------------------------------------------------------
1aipA3          ----------------------------------------------------------------------
1wdtA2          ----------------------------------------------------------------------
1p9qC3          ----------------------------------------------------------------------
1q4rA           ----------------------------------------------------------------------
1upsA2          ----------------------------------------------------------------------
1darA3          ----------------------------------------------------------------------
1o9nA           ----------------------------------------------------------------------
1vi7A2          ----------------------------------------------------------------------
1g7rA4          ----------------------------------------------------------------------
1h65A           WI--------------------------------------------------------------------
1g7rA1          ----------------------------------------------------------------------
1eniA           ----------------------------------------------------------------------
1vfgA2          ----------------------------------------------------------------------
2hgjF1          ----------------------------------------------------------------------
1c82A1          MKEYFS----------------------------------------------------------------
2g40A1          ----------------------------------------------------------------------
1n0uA1          -------------------------------------------------SPVTAQAYRAEQLYEGPADDA
2bv3A4          ----------------------------------------------------------------------
1r5bA1          ----------------------------------------------------------------------
1bm8A           ----------------------------------------------------------------------
1darA1          ----------------------------------------------------------------------
1wb1A1          ----------------------------------------------------------------------
1puiA           ----------------------------------------------------------------------
1wdtA1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1g7rA2          ----------------------------------------------------------------------
1aipA1          ----------------------------------------------------------------------
1zunB1          ----------------------------------------------------------------------
1kjzA1          ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1nrjB           ----------------------------------------------------------------------
1eg7A           AGADGVNYTAEADKAIQRYESLGYGNLPVVMAKTQYSFSDDMTKLGRPRNFTITVREVRLSAGGRLIVPI
1d1nA           ----------------------------------------------------------------------
1xzpA2          ----------------------------------------------------------------------
2q22A1          ------------------PILKPSEKRRALILITKLSDYQILGICADADEGLLAXKTYSHALGYEVPDLP
1egaA1          ----------------------------------------------------------------------
1sulA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LADTMRMVNEDGEVVFMVTDISMDPHAGEIATGRVFSGTLEKGQELYVSGTAGKNRIQSVGLFMGSEREE
1n0uA2          ----------------------------------------------------------------------
1n0uA3          ----------------------------------------------------------------------
1darA2          ----------------------------------------------------------------------
1darA4          ----------------------------------------------------------------------
1fnmA4          ----------------------------------------------------------------------
1f60A3          ----------------------------------------------------------------------
1s1mA2          TDL-----DLGHYERFIRTK---MSRRNNFTTGRIYSDVLRKE------------RRGDYLGATVQVIPH
1n0uA5          ----------------------------------------------------------------------
1n0uA4          ----------------------------------------------------------------------
1nriA           ----------------------------------------------------------------------
1aipA3          ----------------------------------------------------------------------
1wdtA2          ----------------------------------------------------------------------
1p9qC3          ----------------------------------------------------------------------
1q4rA           ----------------------------------------------------------------------
1upsA2          ----------------------------------------------------------------------
1darA3          ----------------------------------------------------------------------
1o9nA           ----------------------------------------------------------------------
1vi7A2          ----------------------------------------------------------------------
1g7rA4          ----------------------------------------------------------------------
1h65A           ----------------------------------------------------------------------
1g7rA1          ---------EDSPARGTILEVKEETGLGXTIDAVIYDGILRKDDTIAXXTSKDSTRIRSLLKPRPLKFQK
1eniA           ----------------------------------------------------------------------
1vfgA2          ----------------------------------------------------------------------
2hgjF1          ----------------------------------------------------------------------
1c82A1          ----------------------------------------------------------------------
2g40A1          -------------------------------PGAIAKALGNARRVIVPAGIPAPWLTVGMDVLRDEPPLS
1n0uA1          NCIAIKNCDPKADLMLYVSKMVPTSDKGRYAFGRVFAGTVKSGQKVRIQGPLFIKAIQRVVLMMGRFVEP
2bv3A4          ----------------------------------------------------------------------
1r5bA1          --------KVNAPFIMPIASKYKDLGTI--LEGKIEAGSIKKNSNVLVMPINQTLEVTAIYDEADEEISS
1bm8A           ----------------------------------------------------------------------
1darA1          --------DPNGPLAALAFKIMADPYVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHANHREE
1wb1A1          --------NTESYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGDELKVLPINMSTKVRSIQYFKESVMEA
1puiA           ----------------------------------------------------------------------
1wdtA1          --------FGDGPPLAKVFKVQVDPFMGQVAYLRLYRGRLKPGDSLQSEAG--QVRLPHLYVPMGKDLLE
1lnzA2          ----------------------------------------------------------------------
1g7rA2          ----------------LIPKLVFRQSKPAIGGVEVLTGVIRQGYPLXNDDGETVGTVESXQDKGENLKSA
1aipA1          --------DVDKPFLMPVEDVFTITGRGTVATGRIERGKVKVGDEVEIVGLAPETRVTGVEMHRKTLQEG
1zunB1          --------RNYTDLRFPVQYVNRPNLNFRGFAGTLASGIVHKGDEIVVLPSGKSSRVKSIVTF----EGE
1kjzA1          -------------VLRSFDVNKPGKLVGGVLDGSIVQGKLKVGDEIEIRPGIKYEPITTEIVSLQAGGQF
2cxxA1          ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1nrjB           ----------------------------------------------------------------------
1eg7A           TGAIMTMPGLPKRPAACN--IDID-ADGVI----------------------------------------
1d1nA           ---------------AEVRQTFKVSKVGTIAGCYVTDGKITRDSKVRLIRQGIVVYEGEIDSLK-RYKDD
1xzpA2          ----------------------------------------------------------------------
2q22A1          VVEGPVYIKLNGKNGLCYLDSYAGHHRGVLVSCQSYYEGGINEXYGH-----------------------
1egaA1          ----------------------------------------------------------------------
1sulA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VDRVPAGNIASVTGLRDAIAGSTVSSVEMTPFESIEHISEPVITKSVEAQNMDDLPKLIETLQQVAKEDP
1n0uA2          ----------------------------------------------------------------------
1n0uA3          ----------------------------------------------------------------------
1darA2          ----------------------------------------------------------------------
1darA4          ----------------------------------------------------------------------
1fnmA4          -------------------------------------VPEPVIDVAIEPKTKADQEKLSQALARLAEEDP
1f60A3          ----------------------------------------------------------------------
1s1mA2          ITNAIKERVLEGGEGHDVVIGGTVGDIESLPFLFMHLTLVPYMAASGEVKTKPHSVKELLSIGIQPDILI
1n0uA5          ----------------------------------------------------------------------
1n0uA4          ----------------------------------------PVVQVAVEVKNANDLPKLVEGLKRLSKSDP
1nriA           ----------------------------------------------------------------------
1aipA3          ----------------------------------------------------------------------
1wdtA2          ----------------------------------------------------------------------
1p9qC3          ----------------------------------------------------------------------
1q4rA           ----------------------------------------------------------------------
1upsA2          ----------------------------------------------------------------------
1darA3          ----------------------------------------------------------------------
1o9nA           ----------------------------------------------------------------------
1vi7A2          ----------------------------------------------------------------------
1g7rA4          ----------------------------------------------------------------------
1h65A           ----------------------------------------------------------------------
1g7rA1          VDEVVAAAGIKIVAIDDVXAGSPLRVV-------------------------------------------
1eniA           ----------------------------------------------------------------------
1vfgA2          ----------------------------------------------------------------------
2hgjF1          ----------------------------------------------------------------------
1c82A1          ----------------------------------------------------------------------
2g40A1          HAELDRADAVLTGCAVAISETGTIILDHRADQGRRALSLIPDFHICVVDQIVQTVREGVEAVAA-SVREG
1n0uA1          IDDCPAGNIIGLVGIDFLLKTGTLTTSEAHNMKVM-----------------------------------
2bv3A4          -------------------------------------------------------------IDVAIEPSP
1r5bA1          SICGDQVRLRVRGDDSDVQTGYVLTSTK------------------------------------------
1bm8A           ----------------------------------------------------------------------
1darA1          VEELKAGDLGAVVGLKETITGDTLVGED------------------------------------------
1wb1A1          KAGDRVGMAIQGVDAKQIYRGXILTSKD------------------------------------------
1puiA           ----------------------------------------------------------------------
1wdtA1          VEEAEAGFVLGVPKAEGLHRGMVLWQGEKPESEEV-----------------------------------
1lnzA2          ----------------------------------------------------------------------
1g7rA2          SRGQKVAAIKDAVYGKTIHEGDTLYVDI--PENHYHILKEQLLT--------------------------
1aipA1          IAGDNVGVLLRGVSREEVERGQVLAKPGSIT---------------------------------------
1zunB1          LEQAGPGQAVTLTDEIDISRGDLLVHADNVP---------------------------------------
1kjzA1          VEEAYPGGLVGVGTKLDPY---------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1nrjB           ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1d1nA           VREVAQGYELTIKNFNDIKEGDVIEAYVM-----------------------------------------
1xzpA2          ----------------------------------------------------------------------
2q22A1          ----------------------------------------------------------------------
1egaA1          ----------------------------------------------------------------------
1sulA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           TIQIEINEDTGEHLISGQGELHLEVITQRIRDNQGIPVITGEPIVVFREQPQEASREVEGQSPNRHNKFY
1n0uA2          ----------------------------------------------------------------------
1n0uA3          --------------------------------------------VAYRETVESESQTALSKSPNKHNRIY
1darA2          ----------------------------------------------------------------------
1darA4          ----------------------------------------------------------------------
1fnmA4          TFRVSTHPETGQTIISGMGELHLEIIVDRLKREFKVDANVGKPQV-------------------------
1f60A3          ----------------------------------------------------------------------
1s1mA2          CRSDRAVPANERAKIALFCNVPEKAVISLKD----VDSIYKIPGLLKSQ---------------------
1n0uA5          ----------------------------------------------------------------------
1n0uA4          CVLTY-MSESGEHIVAGTGELHLEICLQDLEHDAGVPLKISPPV--------------------------
1nriA           ----------------------------------------------------------------------
1aipA3          ----------------------------------------------------------------------
1wdtA2          ----------------------------------------------------------------------
1p9qC3          ----------------------------------------------------------------------
1q4rA           ----------------------------------------------------------------------
1upsA2          ----------------------------------------------------------------------
1darA3          ----------------------------------------GKPQVAYRETITKPVDIRQTGGRGQYGHVK
1o9nA           ----------------------------------------------------------------------
1vi7A2          ----------------------------------------------------------------------
1g7rA4          ----------------------------------------------------------------------
1h65A           ----------------------------------------------------------------------
1g7rA1          ----------------------------------------------------------------------
1eniA           ----------------------------------------------------------------------
1vfgA2          ----------------------------------------------------------------------
2hgjF1          ----------------------------------------------------------------------
1c82A1          ----------------------------------------------------------------------
2g40A1          RPLTWLSGGSGVH---GPRRLQVIVV--------------------------------------------
1n0uA1          ----------------------------------------------------------------------
2bv3A4          TFSVSTHPETGSTIISGMGELSLEII--------------------------------------------
1r5bA1          ----------------------------------------------------------------------
1bm8A           --QIYSARYSGVDVYEFI---HSTGSIMKRKKDDWVNAKAANFAKAKRTRILEKEVEKVQGGFGKYQGTW
1darA1          ----------------------------------------------------------------------
1wb1A1          ----------------------------------------------------------------------
1puiA           ----------------------------------------------------------------------
1wdtA1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1g7rA2          ----------------------------------------------------------------------
1aipA1          ----------------------------------------------------------------------
1zunB1          ----------------------------------------------------------------------
1kjzA1          ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1nrjB           ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1d1nA           ----------------------------------------------------------------------
1xzpA2          ----------------------------------------------------------------------
2q22A1          ----------------------------------------------------------------------
1egaA1          ----------------------------------------------------------------------
1sulA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           LTVEPMAQEIVDAIQLGEVSMDMPELERREALQEAGMDKDTSQNVEDIHRTNILIDDTKGIQHLNETMEL
1n0uA2          ----------------------------------------------------------------------
1n0uA3          LKAEPIDEEVSLAIENGIINRDDFKARARIMADDYGWDVTDARKIPDGNGPNLVIDQTKAVQYLHEIKDS
1darA2          ----------------------------------------------------------------------
1darA4          ----------------------------------------------------------------------
1fnmA4          ----------------------------------------------------------------------
1f60A3          ----------------------------------------------------------------------
1s1mA2          ----------------------------------------------------------------------
1n0uA5          ----------------------------------------------------------------------
1n0uA4          ----------------------------------------------------------------------
1nriA           ----------------------------------------------------------------------
1aipA3          ----------------------------------------------------------------------
1wdtA2          ----------------------------------------------------------------------
1p9qC3          ----------------------------------------------------------------------
1q4rA           ----------------------------------------------------------------------
1upsA2          ----------------------------------------------------------------------
1darA3          IKVEPLPRGSG----------------------------------------FEFVNAIVGGVIPKEYIPA
1o9nA           ----------------------------------------------------------------------
1vi7A2          ----------------------------------------------------------------------
1g7rA4          ----------------------------------------------------------------------
1h65A           ----------------------------------------------------------------------
1g7rA1          ----------------------------------------------------------------------
1eniA           ----------------------------------------------------------------------
1vfgA2          ----------------------------------------------------------------------
2hgjF1          ----------------------------------------------------------------------
1c82A1          ----------------------------------------------------------------------
2g40A1          ----------------------------------------------------------------------
1n0uA1          ----------------------------------------------------------------------
2bv3A4          ----------------------------------------------------------------------
1r5bA1          ----------------------------------------------------------------------
1bm8A           VPLNIAKQLAEKFSVYDQLK--------------------------------------------------
1darA1          ----------------------------------------------------------------------
1wb1A1          ----------------------------------------------------------------------
1puiA           ----------------------------------------------------------------------
1wdtA1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1g7rA2          ----------------------------------------------------------------------
1aipA1          ----------------------------------------------------------------------
1zunB1          ----------------------------------------------------------------------
1kjzA1          ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1nrjB           ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1d1nA           ----------------------------------------------------------------------
1xzpA2          ----------------------------------------------------------------------
2q22A1          ----------------------------------------------------------------------
1egaA1          ----------------------------------------------------------------------
1sulA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           VLEGLQEALDDGPLAAEPVQGSLFRLHDAKLHEDTIHRGPAQVIPAVRNAVHRSLIDGEVRLLEPIQDVR
1n0uA2          ----------------------------------------------------------------------
1n0uA3          VVAAFQWATKEGPIFGEEMRSVRVNILDVTLHADAIHRGGGQIIPTMRRATYAGFLLADPKI--------
1darA2          ----------------------------------------------------------------------
1darA4          -------------------------------------------------------------ILEPIMRVE
1fnmA4          ----------------------------------------------------------------------
1f60A3          ----------------------------------------------------------------------
1s1mA2          ----------------------------------------------------------------------
1n0uA5          ---------------------------------------------------------------EPVFLVE
1n0uA4          ----------------------------------------------------------------------
1nriA           ----------------------------------------------------------------------
1aipA3          ----------------------------------------------------------------------
1wdtA2          ----------------------------------------------------------------------
1p9qC3          -----------------------------------------------------------------EMEIA
1q4rA           ----------------------------------------------------------------------
1upsA2          ----------------------------------------------------------------------
1darA3          VQKGIEEAMQSGPLIGFPVVDIKVTLYDGSYHEVDSSEMAFKI--AGSMAIKEAV---------------
1o9nA           ----------------------------------------------------------------------
1vi7A2          ----------------------------------------------------------------PLTEYT
1g7rA4          ----------------------------------------------------------------------
1h65A           ----------------------------------------------------------------------
1g7rA1          ----------------------------------------------------------------------
1eniA           ----------------------------------------------------------------------
1vfgA2          ----------------------------------------------------------------------
2hgjF1          ----------------------------------------------------------------------
1c82A1          ----------------------------------------------------------------------
2g40A1          ----------------------------------------------------------------------
1n0uA1          ----------------------------------------------------------------------
2bv3A4          ----------------------------------------------------------------------
1r5bA1          ----------------------------------------------------------------------
1bm8A           ----------------------------------------------------------------------
1darA1          ----------------------------------------------------------------------
1wb1A1          ----------------------------------------------------------------------
1puiA           ----------------------------------------------------------------------
1wdtA1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1g7rA2          ----------------------------------------------------------------------
1aipA1          ----------------------------------------------------------------------
1zunB1          ----------------------------------------------------------------------
1kjzA1          ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1nrjB           ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1d1nA           ----------------------------------------------------------------------
1xzpA2          ----------------------------------------------------------------------
2q22A1          ----------------------------------------------------------------------
1egaA1          ----------------------------------------------------------------------
1sulA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           IDVPSEHMGAASGEIQGRRGRVDDMYQEGDLMVVEGIAPVEEMIGFSSDIRSATEGRASWNTENAGFRVL
1n0uA2          ----------------------------------------------------------------------
1n0uA3          ----------------------------------------------------------------------
1darA2          ----------------------------------------------------------------------
1darA4          VTTPEEYMGDVIGDLNARRGQILGMEPRGNAQVIRAFVPLAEMFGYATDLRSKTQGRGSFVMFFDHYQEV
1fnmA4          ----------------------------------------------------------------------
1f60A3          ----------------------------------------------------------------------
1s1mA2          ----------------------------------------------------------------------
1n0uA5          IQCPEQAVGGIYSVLNKKRGQVVSEEQTPL-FTVKAYLPVNESFGFTGELRQATGGQAFPQMVFDHWSTL
1n0uA4          ----------------------------------------------------------------------
1nriA           ----------------------------------------------------------------------
1aipA3          ----------------------------------------------------------------------
1wdtA2          ----------------------------------------------------------------------
1p9qC3          IKIPPEHTGRAISALYNFGGVTREEWQRDGSWICVMRIPSGMYGDLMDLLGKVAKGEALTKVL-------
1q4rA           ----------------------------------------------------------------------
1upsA2          ----------------------------------------------------------------------
1darA3          ----------------------------------------------------------------------
1o9nA           ----------------------------------------------------------------------
1vi7A2          LQCEYHQLTGIEALLGQCDGKIINS-DYQAFVLLRVALPAAKVAEFSAKLADFSRGSLQLLAIE------
1g7rA4          ----------------------------------------------------------------------
1h65A           ----------------------------------------------------------------------
1g7rA1          ----------------------------------------------------------------------
1eniA           ----------------------------------------------------------------------
1vfgA2          ----------------------------------------------------------------------
2hgjF1          ----------------------------------------------------------------------
1c82A1          ----------------------------------------------------------------------
2g40A1          ----------------------------------------------------------------------
1n0uA1          ----------------------------------------------------------------------
2bv3A4          ----------------------------------------------------------------------
1r5bA1          ----------------------------------------------------------------------
1bm8A           ----------------------------------------------------------------------
1darA1          ----------------------------------------------------------------------
1wb1A1          ----------------------------------------------------------------------
1puiA           ----------------------------------------------------------------------
1wdtA1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1g7rA2          ----------------------------------------------------------------------
1aipA1          ----------------------------------------------------------------------
1zunB1          ----------------------------------------------------------------------
1kjzA1          ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1nrjB           ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1d1nA           ----------------------------------------------------------------------
1xzpA2          ----------------------------------------------------------------------
2q22A1          ----------------------------------------------------------------------
1egaA1          ----------------------------------------------------------------------
1sulA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           VDNLQREKIMEIRERKGMKxxxxxxxxxx
1n0uA2          -----------------------------
1n0uA3          -----------------------------
1darA2          -----------------------------
1darA4          PKQVQEK----------------------
1fnmA4          -----------------------------
1f60A3          -----------------------------
1s1mA2          -----------------------------
1n0uA5          GSDPLGEIVLAARKRHGMK----------
1n0uA4          -----------------------------
1nriA           -----------------------------
1aipA3          -----------------------------
1wdtA2          -----------------------------
1p9qC3          -----------------------------
1q4rA           -----------------------------
1upsA2          -----------------------------
1darA3          -----------------------------
1o9nA           -----------------------------
1vi7A2          -----------------------------
1g7rA4          -----------------------------
1h65A           -----------------------------
1g7rA1          -----------------------------
1eniA           -----------------------------
1vfgA2          -----------------------------
2hgjF1          -----------------------------
1c82A1          -----------------------------
2g40A1          -----------------------------
1n0uA1          -----------------------------
2bv3A4          -----------------------------
1r5bA1          -----------------------------
1bm8A           -----------------------------
1darA1          -----------------------------
1wb1A1          -----------------------------
1puiA           -----------------------------
1wdtA1          -----------------------------
1lnzA2          -----------------------------
1g7rA2          -----------------------------
1aipA1          -----------------------------
1zunB1          -----------------------------
1kjzA1          -----------------------------
2cxxA1          -----------------------------
2fh5B1          -----------------------------
1ni3A1          -----------------------------
1nrjB           -----------------------------
1eg7A           -----------------------------
1d1nA           -----------------------------
1xzpA2          -----------------------------
2q22A1          -----------------------------
1egaA1          -----------------------------
1sulA           -----------------------------