[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for hlac0:ACM56606.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2ahoB2.bssp"
#ERROR : Can't open dsspfile "1jjgA.bssp"
#ERROR : Can't open dsspfile "1wi5A.bssp"
#ERROR : Can't open dsspfile "2ja9A1.bssp"
#ERROR : Can't open dsspfile "1sroA.bssp"
#ERROR : Can't open dsspfile "2oceA4.bssp"
#ERROR : Can't open dsspfile "2ba0A1.bssp"
#ERROR : Can't open dsspfile "1go3E1.bssp"
#ERROR : Can't open dsspfile "2ahoB3.bssp"
#ERROR : Can't open dsspfile "1q8kA2.bssp"
#ERROR : Can't open dsspfile "1luzA.bssp"
#ERROR : Can't open dsspfile "2nn6H1.bssp"
#ERROR : Can't open dsspfile "1y14B1.bssp"
#ERROR : Can't open dsspfile "2nn6I1.bssp"
#ERROR : Can't open dsspfile "2id0A1.bssp"
#ERROR : Can't open dsspfile "1hr0W.bssp"
#ERROR : Can't open dsspfile "1hh2P1.bssp"
#ERROR : Can't open dsspfile "1kl9A2.bssp"
#ERROR : Can't open dsspfile "1d7qA.bssp"
#ERROR : Can't open dsspfile "1t9hA1.bssp"
#ERROR : Can't open dsspfile "1bmfD1.bssp"
#ERROR : Can't open dsspfile "2ot2A1.bssp"
#ERROR : Can't open dsspfile "1k3rA1.bssp"
#ERROR : Can't open dsspfile "2ahoB1.bssp"

## Summary of PDB Search
:266
    5e-17  36%  2ahoB2 [b.40.4.5] TRANSLATION INITIATION FACTOR 2 ALPHA SUBUNIT
    2e-16  18%  1jjgA  [b.40.4.5] M156R
    6e-16  20%  1wi5A  [b.40.4.5] RRP5 PROTEIN HOMOLOG
    2e-15  16%  2ja9A1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP40 A:62 -- 151
    2e-15  44%  1sroA  [b.40.4.5] PNPASE
    2e-15  34%  2oceA4 [b.40.4.5] HYPOTHETICAL PROTEIN PA5201 A:637 -- 730
    3e-15  26%  2ba0A1 [b.40.4.5] ARCHEAL EXOSOME RNA BINDING PROTEIN RRP4 A:53
    4e-15  26%  1go3E1 [b.40.4.5] DNA-DIRECTED RNA POLYMERASE SUBUNIT E E:79 --
    2e-14  25%  2ahoB3 [d.58.51.1] TRANSLATION INITIATION FACTOR 2 ALPHA SUBUNIT
    2e-14  14%  1q8kA2 [d.58.51.1] EUKARYOTIC TRANSLATION INITIATION FACTOR 2 A:186
    6e-14  25%  1luzA  [b.40.4.5] PROTEIN K3
    7e-14  22%  2nn6H1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP4 H:73 -- 167
    2e-13  14%  1y14B1 [b.40.4.5] DNA-DIRECTED RNA POLYMERASE II 19 KDA B:81 --
    3e-13  17%  2nn6I1 [b.40.4.5] 3'-5' EXORIBONUCLEASE CSL4 HOMOLOG I:61 -- 185
    2e-12  10%  2id0A1 [b.40.4.5] EXORIBONUCLEASE 2 A:558 -- 644
    1e-11  19%  1hr0W  [b.40.4.5] TRANSLATION INITIATION FACTOR
    6e-11  14%  1hh2P1 [b.40.4.5] N UTILIZATION SUBSTANCE PROTEIN A P:127 -- 198
    6e-11  36%  1kl9A2 [b.40.4.5] EUKARYOTIC TRANSLATION INITIATION FACTOR 2 A:3
    6e-11  11%  1d7qA  [b.40.4.5] TRANSLATION INITIATION FACTOR 1A
    1e-10  11%  1t9hA1 [b.40.4.5] PROBABLE GTPASE ENGC A:1 -- 67
    7e-10  11%  1bmfD1 [a.69.1.1] BOVINE MITOCHONDRIAL F1-ATPASE D:358 -- 475
    7e-10  16%  2ot2A1 [b.40.14.1] HYDROGENASE ISOENZYMES FORMATION PROTEIN HYPC
    2e-07  20%  1k3rA1 [b.40.4.10] CONSERVED PROTEIN MT0001 A:93 -- 163
    3e-07  23%  2ahoB1 [a.60.14.1] TRANSLATION INITIATION FACTOR 2 ALPHA SUBUNIT
:266

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKYSGWPEPGELVVGDVDEIADFGVFVDLDEYEDKRGLCHISEVASGWIKNVRDHVREGQTVVAKVLDVD
2ahoB2          ------PSEGEILIATVKQVFDYGSYVSLDEYGGLQAFLPWSE-----VSNIRDVLKENRKVIVKVIRVD
1jjgA           ---SAMDLSPGSVHEGIVYFKDGIFKVRLLGYEGH--ECILLDYLNYRQDTLDRLKERGRVIKTRVVRAD
1wi5A           VLSAEALKPGMLLTGTVSSLEDHGYLVDIGVDGTRAFLPLLKAQEYIRQKNKGAKLKVGQYLNCIVEKVK
2ja9A1          ------PSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLS--YMAFPNASKKNRPTLQVGDLVYARVCTAE
1sroA           ------IEVGRVYTGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
2oceA4          ------LKPGMVLEGVVTNVTNFGAFVDIGVHQD--GLVHISALSEKFVKDPYEVVKAGDIVKVKVMEVD
2ba0A1          ------PSVGDVVIGIIREVAANGWAVDIY--SPYQAFLPVSENPEMKNKKPNEVLDIGDAIIAKVLNID
1go3E1          ------PEMYELIEGEVVDVVEFGSFVRLGPLD---GLIHVSQIMDDYVKETGKVLEIGDYVRARIVAIS
2ahoB3          ----------------------------------------------------------------------
1q8kA2          ----------------------------------------------------------------------
1luzA           ------PNAGDVIKGRV-YEKDYALYIYLFDYPHFEAILAESVKXHXDRYVEYRDKLVGKTVKVKVIRVD
2nn6H1          ------GEVGDIVVGRITEVQQKRWKVETNSRLD--SVLLLSSMNE---LAMRGFLQEGDLISAEVQAVF
1y14B1          ------PFKGEVVDGTVVSCSQHGFEVQVGPMK---VFVTKHLMPQDLYQSSEDVITIKSRIRVKIEGCI
2nn6I1          ------PDVGAIVTCKVSSINSRFAKVHILYVGSFRGTIRKEDVRATEKVEIYKSFRPGDIVLAKVISLG
2id0A1          -------GTDTRFAAEIVDISRGGXRVRLVDNG-AIAFIPAPFLHAVRDELVCSVYKVTDVIDVTIAEVR
1hr0W           -------KDTIRTEGVVTEALPNATFRVKLDSG-PEILAYIS----GKMRMHYIRILPGDRVVVEITPYD
1hh2P1          ------ELKGTVTTAEVIRVMGEWADIRIGKLE---TRLPKKEWIPG------EEIKAGDLVKVYIIDVV
1kl9A2          -----FPEVEDVVXVNVRSIAEXGAYVSLLEYNNIEGXILLSE------------LRIGRNECVVVIRVD
1d7qA           -------KEDGQEYAQVIKMLGNGRLEAMCFDGVK-RLCHIRGKLRKKVW-----INTSDIILVGLRDYQ
1t9hA1          -----------MPEGKIIKALSGFYYVLDESEDS--DKVIQCRG-RGIFRKNKITPLVGDYVVYQAENDK
1bmfD1          -----PFQVAEVFTGHLGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKL--------
2ot2A1          ------------VPGQIRTIDGNQAKVDVC---GIQRDVDLTLVGS---CDENGQPRVGQWVLVHVGFAM
1k3rA1          ------PVTGEYRQGLTVKRVKKGTLVDIGADKL--ALCR-------------EKLTVNRIMSFRVVRLG
2ahoB1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ESANQIDLSIKDVNEHQRKDKIQDWKNSQKADNWMLIALGEDVDDDRYTAVANALLVEFDSLYDAFEAAA
2ahoB2          RRKGTVDVSLK-----------------------------------------------------------
1jjgA           G--LYVDLR-------------------------------------------------------------
1wi5A           GNGGVVSLSVGHSEVSTAIATEQQSWNLNNLS--------------------------------------
2ja9A1          KE-LEAEIECFDS-TTGRDAGFGILE--------------------------------------------
1sroA           RQ-GRIRLSIKE----------------------------------------------------------
2oceA4          IPRNRVGLSMRMSDT-------------------------------------------------------
2ba0A1          PK-MKVTLTMKDRICRPIR---------------------------------------------------
1go3E1          LKASKIALTMRQPYLGKLEWIEEEKAKKQ-----------------------------------------
2ahoB3          ----------------------------------------------------------------------
1q8kA2          ----------------------------------------------------------------------
1luzA           YTKGYIDVNYKRXCRHQ-----------------------------------------------------
2nn6H1          S-DGAVSLHTRSLK--------------------------------------------------------
1y14B1          SQVSSIHAIGSIKED-------------------------------------------------------
2nn6I1          DAQSNYLLTTAENELGVVVAHSESGIQMVP----------------------------------------
2id0A1          XETRSIIARPV-----------------------------------------------------------
1hr0W           PTRGRIVYR-------------------------------------------------------------
1hh2P1          KTTKGPKILVS-----------------------------------------------------------
1kl9A2          KEKGYIDLSKR-----------------------------------------------------------
1d7qA           DNKADVILKYNADEARSLKAYGELPEHAKI----------------------------------------
1t9hA1          E--GYLMEIKE-----------------------------------------------------------
1bmfD1          ----------------------------------------------------------------------
2ot2A1          SNEAEARDTLDALQNMFDVEPDVG----------------------------------------------
1k3rA1          K---------------------------------------------------------------------
2ahoB1          ------------VTDDERRKKNLQWKKIQRLDKILELVSQKLKLSEKWEQVAWKLEAKYGDPITAIEKAV


                         +         .         .         .         .         *         .:210
query           ISGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVDVTGYVDLESTAPNGVDDVKAALEAAEGNGEVPDGVD
2ahoB2          ----------------------------------------------------------------------
1jjgA           ----------------------------------------------------------------------
1wi5A           ----------------------------------------------------------------------
2ja9A1          ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
2oceA4          ----------------------------------------------------------------------
2ba0A1          ----------------------------------------------------------------------
1go3E1          ----------------------------------------------------------------------
2ahoB3          --------------------------------VKMSGLITVRTNEPLGVEKIKEVISKALIEQDYESLLN
1q8kA2          --------------------------------VKIRADIEVACYGYEGIDAVKEALRAGLNCS--TENMP
1luzA           ----------------------------------------------------------------------
2nn6H1          ----------------------------------------------------------------------
1y14B1          ----------------------------------------------------------------------
2nn6I1          ----------------------------------------------------------------------
2id0A1          ----------------------------------------------------------------------
1hr0W           ----------------------------------------------------------------------
1hh2P1          ----------------------------------------------------------------------
1kl9A2          ----------------------------------------------------------------------
1d7qA           ----------------------------------------------------------------------
1t9hA1          ----------------------------------------------------------------------
1bmfD1          ----------------------------------------------------------------------
2ot2A1          ----------------------------------------------------------------------
1k3rA1          ----------------------------------------------------------------------
2ahoB1          KEG-------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LEVGYVGSPEYRIKVRAPNYKTAEDQLXXXXXXXXXXXXXXGGSGGFHRxxxxxxx
2ahoB2          --------------------------------------------------------
1jjgA           --------------------------------------------------------
1wi5A           --------------------------------------------------------
2ja9A1          --------------------------------------------------------
1sroA           --------------------------------------------------------
2oceA4          --------------------------------------------------------
2ba0A1          --------------------------------------------------------
1go3E1          --------------------------------------------------------
2ahoB3          IKIYTIGAPRYRVDVVGTNPKEASEAL-----------------------------
1q8kA2          IKINLIAPPRYVMTTTTLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQM-------
1luzA           --------------------------------------------------------
2nn6H1          --------------------------------------------------------
1y14B1          --------------------------------------------------------
2nn6I1          --------------------------------------------------------
2id0A1          --------------------------------------------------------
1hr0W           --------------------------------------------------------
1hh2P1          --------------------------------------------------------
1kl9A2          --------------------------------------------------------
1d7qA           --------------------------------------------------------
1t9hA1          --------------------------------------------------------
1bmfD1          --------------------------------------------------------
2ot2A1          --------------------------------------------------------
1k3rA1          --------------------------------------------------------
2ahoB1          --------------------------------------------------------