[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for hlac0:ACM57204.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2nvwA2.bssp"
#ERROR : Can't open dsspfile "2nvwA1.bssp"
#ERROR : Can't open dsspfile "1evjA2.bssp"
#ERROR : Can't open dsspfile "1gcuA1.bssp"
#ERROR : Can't open dsspfile "1zh8A1.bssp"
#ERROR : Can't open dsspfile "1ydwA1.bssp"
#ERROR : Can't open dsspfile "1ydwA2.bssp"
#ERROR : Can't open dsspfile "1zh8A2.bssp"
#ERROR : Can't open dsspfile "1xeaA2.bssp"
#ERROR : Can't open dsspfile "1vliA2.bssp"
#ERROR : Can't open dsspfile "1dapA1.bssp"
#ERROR : Can't open dsspfile "1xneA.bssp"
#ERROR : Can't open dsspfile "1gsoA2.bssp"
#ERROR : Can't open dsspfile "1xeaA1.bssp"
#ERROR : Can't open dsspfile "1qkiA1.bssp"
#ERROR : Can't open dsspfile "1xcbA2.bssp"
#ERROR : Can't open dsspfile "1cqiA1.bssp"
#ERROR : Can't open dsspfile "1ebfA1.bssp"
#ERROR : Can't open dsspfile "1evjA1.bssp"
#ERROR : Can't open dsspfile "1omoA.bssp"
#ERROR : Can't open dsspfile "1nvmB1.bssp"
#ERROR : Can't open dsspfile "1tltA1.bssp"
#ERROR : Can't open dsspfile "1iukA.bssp"
#ERROR : Can't open dsspfile "1e0dA1.bssp"
#ERROR : Can't open dsspfile "2d59A1.bssp"
#ERROR : Can't open dsspfile "1ftrA2.bssp"

## Summary of PDB Search
:377
    6e-24  22%  2nvwA2 [d.81.1.5] GALACTOSE/LACTOSE METABOLISM REGULATORY PROTEIN
    3e-22  12%  2nvwA1 [c.2.1.3] GALACTOSE/LACTOSE METABOLISM REGULATORY PROTEIN
    7e-22  26%  1evjA2 [d.81.1.5] GLUCOSE-FRUCTOSE OXIDOREDUCTASE A:161 -- 322
    7e-22  15%  1gcuA1 [c.2.1.3] BILIVERDIN REDUCTASE A A:1 -- 128 A:247 -- 292
    3e-21  19%  1zh8A1 [c.2.1.3] OXIDOREDUCTASE A:4 -- 131 A:276 -- 328
    2e-18  16%  1ydwA1 [c.2.1.3] AX110P-LIKE PROTEIN A:6 -- 133 A:305 -- 360
    2e-18  20%  1ydwA2 [d.81.1.5] AX110P-LIKE PROTEIN A:134 -- 304
    1e-17  24%  1zh8A2 [d.81.1.5] OXIDOREDUCTASE A:132 -- 275
    5e-16  13%  1xeaA2 [d.81.1.5] OXIDOREDUCTASE, GFO/IDH/MOCA FAMILY A:123 -- 266
    2e-15   9%  1vliA2 [c.1.10.6] SPORE COAT POLYSACCHARIDE BIOSYNTHESIS PROTEIN
    5e-14  14%  1dapA1 [c.2.1.3] DIAMINOPIMELIC ACID DEHYDROGENASE A:1 -- 118 A:269
    2e-12   8%  1xneA  [b.122.1.6] HYPOTHETICAL PROTEIN PF0469
    3e-12  13%  1gsoA2 [c.30.1.1] PROTEIN (GLYCINAMIDE RIBONUCLEOTIDE SYNTHETASE)
    4e-11  18%  1xeaA1 [c.2.1.3] OXIDOREDUCTASE, GFO/IDH/MOCA FAMILY A:2 -- 122
    2e-09  16%  1qkiA1 [c.2.1.3] GLUCOSE-6-PHOSPHATE 1-DEHYDROGENASE A:12 -- 199
    3e-09  11%  1xcbA2 [c.2.1.12] REDOX-SENSING TRANSCRIPTIONAL REPRESSOR REX A:78
    4e-09  10%  1cqiA1 [c.2.1.8] PROTEIN (SUCCINYL-COA SYNTHETASE ALPHA CHAIN) A:1
    1e-08  11%  1ebfA1 [c.2.1.3] HOMOSERINE DEHYDROGENASE A:2 -- 150 A:341 -- 359
    1e-08  14%  1evjA1 [c.2.1.3] GLUCOSE-FRUCTOSE OXIDOREDUCTASE A:30 -- 160 A:323
    1e-08  10%  1omoA  [c.2.1.13] ALANINE DEHYDROGENASE
    3e-08  18%  1nvmB1 [c.2.1.3] ACETALDEHYDE DEHYDROGENASE (ACYLATING) B:1 -- 131
    9e-08  17%  1tltA1 [c.2.1.3] PUTATIVE OXIDOREDUCTASE (VIRULENCE FACTOR MVIM A:5
    8e-07  14%  1iukA  [c.2.1.8] HYPOTHETICAL PROTEIN TT1466
    1e-06  13%  1e0dA1 [c.5.1.1] UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
    1e-05  13%  2d59A1 [c.2.1.8] HYPOTHETICAL PROTEIN PH1109 A:4 -- 142
    5e-04  22%  1ftrA2 [d.58.33.1] FORMYLMETHANOFURAN\:TETRAHYDROMETHANOPTERIN
:377

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTQQPLRIGVLGYRFMGKAHANALARLPMFFPDAPDIERHTLVGRXXXXXXXXXXRFGFSHTATDWEDSL
2nvwA2          ----------------------------------------------------------------------
2nvwA1          ---RPIRVGFVGLTSGKSWVAKTHFL--AIQQLSSQFQIVALYNPTLKSSLQTIEQLQLKHGFDSLESFA
1evjA2          ----------------------------------------------------------------------
1gcuA1          MDAEPKRKFVGRAGSVRLRDLKDPRSAAFLNLIGFVSRREL--------------GSLDEVRQISLEDAL
1zh8A1          ---RKIRLGIVGCGIAAREHLPALKNLSHLF------EITAVTSRTRSHAEEFAKXVGNPAVFDSYEELL
1ydwA1          -----IRIGVXGCADIARKVSRAIHLAPNATISG--VASRSLEKAKAFATANNYPESTKIHGSYESLLED
1ydwA2          ----------------------------------------------------------------------
1zh8A2          ----------------------------------------------------------------------
1xeaA2          ----------------------------------------------------------------------
1vliA2          -------------------------------------------------------EKQVIFLSTVCDEGS
1dapA1          ----NIRVAIVGYGNLGRSVEKLIAKQPDMDLVGRRATLDTKTP---------------VFDVADVDKHA
1xneA           ----------------------------------------------------------------------
1gsoA2          ---EFMKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNA---GTALEPALQNVAIGVTDIPALLDFAQN
1xeaA1          -----LKIAXIGLGDIAQKAYLPVLA-------QWPDIELVLCTRNPKVLGTLATRYRVSATCTDYRDLQ
1qkiA1          ----PENTFIVGYARSRLTVADIRKQSEPFFKATPEEKLK--LEDFFARNSYVAGQYDDAASYQRLNSHM
1xcbA2          ---RKWGLCIVGXGRLGSALADYPG-------FGESFELRGFFDVDPEKVGRPVRGGVIEHVDLLPQRVP
1cqiA1          LIDKNTKVICQGFTSQGTFHSEQAIAYGT-----------KMVG-GVTPGKGGTTHLGLPVF-NTVREAV
1ebfA1          ---------------------------------------------------------------DLIAHLK
1evjA1          ---RRFGYAIVGLGKYALNQILPGFAGCQHSRIEALVDGNAEKAKIVAAEYGVDPRKIYDYSNFDKIAKD
1omoA           --KNSSVFGFIGCGTQAYFQLEALRRVFD-------IGEVKAYDVREKAAKKFVSYCEDRGASVQPAEEA
1nvmB1          MNQ-KLKVAIIGSGNIGTDLMIKVLR------NAKYLEMGAMVGIDAASDGLARAQMGVTTTYAGVEGLI
1tltA1          -----LRIGVVGLGGIAQKAWLPVLAAASDWTLQGAWSPTR--------AKALPICESWRIPYADSLSSL
1iukA           ---QAKTIAVLGAHKDPSRPAHYVPRY------LREQGYRVLPVNPRFQGEELFGEEAVAS----LLDLK
1e0dA1          ------NVVIIGLGLTGLSCVDFFLARGV--------TPRVMDTRMTPPGLDKLPEAVERHTGSLNDEWL
2d59A1          ---RYKKIALVGASPKPERDANIVMKYLLEH------------GYDVYPVNPKYEEVLGRKCYPSVLDIP
1ftrA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DEVDVFYNLGPNHVHAEPSIAALEAGVPVLCEKPLAPTLXXXXXXXXXXXXXXXXXXXXFNYRFIPAIRY
2nvwA2          -----------------------------------------------------------------PYIVR
2nvwA1          QYKDMIVVSVKVPEHYEVVKNILEHSSQNLVEWALAASVQQAEELYSISQQRANLQTIILQGRYNSVVGN
1evjA2          -----------------------------------------------------------------PMNRA
1gcuA1          REIDVAYICSESSSHEDYIRQFLQAGKHVLVEYPMTLSFAAAQELWELAAQKGRVLHEEHVELLKNIFLK
1zh8A1          ELVDAVDLTLPVELNLPFIEKALRKGVHVICEKPISTDVETGKKVVELSEKSEKTVYIAENFRENSEFED
1ydwA1          PEIDALYVPLPTSLHVEWAIKAAEKGKHILLEKPVAXNVTEFDKIVDACEANGVQIXDGTXWVHPQEACX
1ydwA2          -----------------------------------------------------------------PRTAL
1zh8A2          -----------------------------------------------------------------PAFWK
1xeaA2          --------------------------------------------------------------RHIPLYNQ
1vliA2          ADPSAFKIASYEINHLPLLKYVARLNRPXIFSTAGAEISDVHEAWRTIRAEGNNQIAIXHCVAKYPAPPE
1dapA1          DDVDVLFLCMGSATDIPEQAPKFAQFACTVDTYDNHRDHRQVMNEAATAAGNVALVSTGRNPDFIAFGRA
1xneA           --------------------------------------------------------------YRLYLKDE
1gsoA2          EKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQL-------------------------------
1xeaA1          YGVDAVXIHAATDVHSTLAAFFLHLGIPTFVDKPLAASAQECENLYELAEKHHQPLYVGFN-GFDAXVQD
1qkiA1          QANRLFYLALPPTVYEAVTKNIHESCMSIIVEKPFGRDL-------------------------------
1xcbA2          GRIEIALLTVPREAAQKAADLLVAAGIKILNFAPVVLEV-------------------------------
1cqiA1          AGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPT-------------------------------
1ebfA1          TKPVILVDNTSSAYIAGFYTKFVENGISIATKKAFSSDL-------------------------------
1evjA1          PKIDAVYIILPNSLHAEFAIRAFKAGKHVMCEKPMATSVADCQRMIDAAKAANKKLMIGYRCHYNQFSAQ
1omoA           SRCDVLVTTTPSRKPVV-KAEWVEEGTHINAIGADGPGKQELDVEILKKAKIVVDDLEQ--AKHGGEINV
1nvmB1          KLPDFVFDATSASAHVQNEALQAKPGIRLIDLTPAA----------------------------------
1tltA1          ASCDAVFVHSSTASHFDVVSTLLNAGVHVCVDKPLAENLRDAERLVELAARKKLTLMVGFNRRFFVGCAR
1iukA           EPVDILDVFRPPSALMDHLPEVLALRPGLVWLQSGIRH--------------------------------
1e0dA1          MAADLIVASPGIALAHPSLSAAADAGIEIV----------------------------------------
2d59A1          DKIEVVDLFVKPKLTMEYVEQAIKKGAKVVWFQYNTYNR-------------------------------
1ftrA2          EGVKCVYEIVINGLNEEAVKEAMRVGIEAACQQPGV----------------------------------


                         +         .         .         .         .         *         .:210
query           AKGLIEDGELGEIRQVRGRYLQDWLVDPEAPWAWRMDADTAGSGALGDLGAHTLDLADFLVGDEVGEIDR
2nvwA2          AKELISEGCIGDINSIEISGNGGWYERPMRSPEYLYDIESGV-NLISNSFGHTIDVLQYITG---SYFQK
2nvwA1          ILRIYESIADYHFLKFDKQGFRFEGFPDAIILHRLIDAVFRSDKEEKTLDVSKIMI--------------
1evjA2          AVKLIRENQLGKLGMVTTDN-SDVMDQNDPAQQWRLRRELAGGGSLMDIGIYGLNGTRYLLGEEPIEVRA
1gcuA1          DQDIFVQKLLDQVSAEDLAA-----------EKKRIM---HCLGLASDIQKLC-----------------
1zh8A1          FYQVVAEGKPNDL---------------------------------------------------------
1ydwA1          VREFARLVYWPSITQLVVDAVKESVDKNYQQISL------------------------------------
1ydwA2          LKEFLSDSEFGQLKTVQSCFSFAGD-EDFLKNDIRVKPGLDGLGALGDAGWYAIRATLLANNFE--LPKT
1zh8A2          AKELVESGAIGDPVFXNWQIWVGDENNKYVHTDWRKKPKHVG-GFLSDGGVHHAAAXRLI----LGEIEW
1xeaA2          HLSELAQQECGALRSLRWE------------KHRHALPGDIR-TFVFDDFIHPLDSVNLSRQ---CNLDD
1vliA2          YSNLSVIPXLAAAFPEAVIGFSDH----SEHPTEAPCAAVRLGAKLIEKHFTIDKNLPGADHSFALNPDE
1dapA1          AHRMKQQGQSGAFTVLEVAPYLL---SPENLDDLI-----------------------------------
1xneA           YLEMVKSGKRIEVRVAYPQL------KDIKRGDKIIFNDLIP-AEVVEVKKYETFRQVLREE----PIDK
1gsoA2          ----------------------------------------------------------------------
1xeaA1          WLQVAAAGKLPTHIIERNLA--SHQLAEAICQQIT-----------------------------------
1qkiA1          ----------------------------------------------------------------------
1xcbA2          ----------------------------------------------------------------------
1cqiA1          ----------------------------------------------------------------------
1ebfA1          ----------------------------------------------------------------------
1evjA1          LDHLAEAVINNKPVRSPGEEGMQD----VRLIQAIYEAARTGRPVNTDW---------------------
1omoA           A---VSKGVIGVEDVHAT--IGEVI---AGLKDGRESDEEITIFDSTGLAIQDVAVAKVVYE--------
1nvmB1          ----------------------------------------------------------------------
1tltA1          HIECVQNQTVPQTAGEQAVL-----AQRIVDKIWRDAM--------------------------------
1iukA           ----------------------------------------------------------------------
1e0dA1          ----------------------------------------------------------------------
2d59A1          ----------------------------------------------------------------------
1ftrA2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VSGHLQTFVDERPVYDEAGDVEEYRDVTVDDAYTAQVAYESGAMGSFEATRFAEGHKNDHAIEIHGSKGS
2nvwA2          INAMISNNIPTQFLLDGKRTK-ETISKTCPDHLLFQGILENGKVPVSCSFKGGKKLTKNLVIDIHGTKGD
2nvwA1          ----------------------------------------------------------------------
1evjA2          YT---------------YSDPNDERFVEVEDRIIWQMRFRSGALSHGASSYSTTTTSR---FSVQGDKAV
1gcuA1          ----------------------------------------------------------------------
1zh8A1          ----------------------------------------------------------------------
1ydwA1          ----------------------------------------------------------------------
1ydwA2          VTAFPGAVLNEAGVILSC---------------GASLSWEDGRTATIYCSF---LANLTXEITAIGTKGT
1zh8A2          ISAVAKDLSPLLGGXDFL---------------SSIFEFENGTVGNYTISY---SLKGNERFEITGTKGK
1xeaA2          LHLTYH--------------------XSEGLLARLDVQWQTGDTLLHASXNRQ-FGITTEHVTASYDNVA
1vliA2          LKEXVDGI---RKTEAELKQGIT-----------------------------------------------
1dapA1          ----------------------------------------------------------------------
1xneA           IFPDKPSFEKA-----------------LKRFHNMYPKWKEYRYGVLAIKFRVLGRDKE-----------
1gsoA2          ----------------------------------------------------------------------
1xeaA1          ----------------------------------------------------------------------
1qkiA1          ----------------------------------------------------------------------
1xcbA2          ----------------------------------------------------------------------
1cqiA1          ----------------------------------------------------------------------
1ebfA1          ----------------------------------------------------------------------
1evjA1          ----------------------------------------------------------------------
1omoA           ----------------------------------------------------------------------
1nvmB1          ----------------------------------------------------------------------
1tltA1          ----------------------------------------------------------------------
1iukA           ----------------------------------------------------------------------
1e0dA1          ----------------------------------------------------------------------
2d59A1          ----------------------------------------------------------------------
1ftrA2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LKFSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2nvwA2          LKI-------------------------------------------------------------------
2nvwA1          ----------------------------------------------------------------------
1evjA2          LLMD------------------------------------------------------------------
1gcuA1          ----------------------------------------------------------------------
1zh8A1          ----------------------------------------------------------------------
1ydwA1          ----------------------------------------------------------------------
1ydwA2          LRV-------------------------------------------------------------------
1zh8A2          ISI-------------------------------------------------------------------
1xeaA2          YLF-------------------------------------------------------------------
1vliA2          ----------------------------------------------------------------------
1dapA1          ----------------------------------------------------------------------
1xneA           ----------------------------------------------------------------------
1gsoA2          ----------------------------------------------------------------------
1xeaA1          ----------------------------------------------------------------------
1qkiA1          ----------------------------------------------------------------------
1xcbA2          ----------------------------------------------------------------------
1cqiA1          ----------------------------------------------------------------------
1ebfA1          ----------------------------------------------------------------------
1evjA1          ----------------------------------------------------------------------
1omoA           ----------------------------------------------------------------------
1nvmB1          ----------------------------------------------------------------------
1tltA1          ----------------------------------------------------------------------
1iukA           ----------------------------------------------------------------------
1e0dA1          ----------------------------------------------------------------------
2d59A1          ----------------------------------------------------------------------
1ftrA2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxx
2nvwA2          ---------------------------
2nvwA1          ---------------------------
1evjA2          ---------------------------
1gcuA1          ---------------------------
1zh8A1          ---------------------------
1ydwA1          ---------------------------
1ydwA2          ---------------------------
1zh8A2          ---------------------------
1xeaA2          ---------------------------
1vliA2          ---------------------------
1dapA1          ---------------------------
1xneA           ---------------------------
1gsoA2          ---------------------------
1xeaA1          ---------------------------
1qkiA1          ---------------------------
1xcbA2          ---------------------------
1cqiA1          ---------------------------
1ebfA1          ---------------------------
1evjA1          ---------------------------
1omoA           ---------------------------
1nvmB1          ---------------------------
1tltA1          ---------------------------
1iukA           ---------------------------
1e0dA1          ---------------------------
2d59A1          ---------------------------
1ftrA2          ---------------------------