[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for hlac0:ACM57205.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1xp3A1.bssp"
#ERROR : Can't open dsspfile "1i60A.bssp"
#ERROR : Can't open dsspfile "2g0wA1.bssp"
#ERROR : Can't open dsspfile "1qtwA.bssp"
#ERROR : Can't open dsspfile "1a0cA.bssp"
#ERROR : Can't open dsspfile "1bhwA.bssp"
#ERROR : Can't open dsspfile "1k77A.bssp"

## Summary of PDB Search
:323
    8e-18  13%  1xp3A1 [c.1.15.1] ENDONUCLEASE IV A:2 -- 298
    8e-13  19%  1i60A  [c.1.15.4] IOLI PROTEIN
    6e-10  17%  2g0wA1 [c.1.15.4] LMO2234 PROTEIN A:10 -- 284
    8e-10  11%  1qtwA  [c.1.15.1] ENDONUCLEASE IV
    1e-09  10%  1a0cA  [c.1.15.3] XYLOSE ISOMERASE
    1e-09  11%  1bhwA  [c.1.15.3] XYLOSE ISOMERASE
    2e-06  20%  1k77A  [c.1.15.5] HYPOTHETICAL PROTEIN YGBM
:323

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDIGVLTVPLGGESIDDAVAYLDDIGVDAVELGVGGWPSEDHVDREAILDDDAAQAELRELLDEHGLRIS
1xp3A1          LKIGSHVSMSGKKMLLAASEEAVSYGATTFMIYTGAPQNTRRKP-----IEELNIEAGRKHMEQNGIEIH
1i60A           --------------------------------------------------KDHSLDDLAEYFQTHHIKPL
2g0wA1          ITISSYTLGTEV-SFPKRVKVAAENGFDGIGLRA-----ENYVDA---LAAGLTDEDXLRILDEHNXKVT
1qtwA           --------------------------------------------------TTQTIDEFKAACEKYHYTSA
1a0cA           -------------RVEAAFEFFDKINAPYFCFHDRDIAPEGDTLRETNKNLDTIVAMIKDYLKTSKTKVL
1bhwA           -------------DPVEAVHKLAEIGAYGITFHDDDLVPFGSDAQ----TRDGIIAGFKKALDETGLIVP
1k77A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ALATHNNPLHPXXXXXXXXXXXXXXXXXXXDQLDVGTVTCFSGLPAGAPGDSTPNWITAPWPSEHADAHE
1xp3A1          APYIINVGNTTKPETFQLGVDFLRMEIERTSALGVAKQIVLHPGAHVGAGAD------------------
1i60A           ALNALVFFNNRDEKGHNEIITEFKGXXETCKTLGVKYVVAVPLVTEQKIVKE------------------
2g0wA1          EVEYITQWGTAEDRTAEQQKKEQTTFHXAR-LFGVKHINC--------------------GLLEKIPEEQ
1qtwA           QILPHINLGHPVTEALEKSRDAFIDEMQRCEQLGLSLLNFHPGS----------------HLMQISEEDC
1a0cA           WGTANLFSNPRFVHGASTSCNADVFAYSAAQVKKALEITKELGGENYVF------WGGREGYETLLNTDM
1bhwA           MVTTNLFTHPVFKDGGFTSNDRSVRRYAIRKVLRQMDLGAELGAKTLVLWGGREGAEYDSA------KDV
1k77A           ----------------------------------------------------------------PAGEDA


                         +         .         .         .         .         *         .:210
query           YQWDEVAIPYWTDLAKHADHHGVDVAIEMHPNMLVYEPTGMLALREATNERIGANFDPSHLYWQGIDVIE
1xp3A1          -AGIQQIIKGLNEVLTPD--QTVNIALETMGTECGRSFEEIAKIIDGVKEKLSVCFDTCHTHDAGYDIVN
1i60A           -EIKKSSVDVLTELSDIAEPYGVKIALEFHPQCTVNTFEQAYEINTVNRDNVGLVLDSFHFHAXGSNIES
2g0wA1          I------IVALGELCDRA--EELIIGLEFXPYSGVADLQAAWRVAEACGDNAQLICDTWHWARANQTAES
1qtwA           LARIAESINIALDKTQGVTAVIENTAGQGSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRT
1a0cA           EFELDNFARFLHMAVDYAKEIGFEGQFLIEPKPYDFDVANVLAFLRKYDKYFKVNIEANHATLAFHDFQH
1bhwA           SAALDRYREALNLLAQYSEDRGYGLRFAIEPDILLPTAGHAIAFVQELEELFGINPETGNEQMSNLNFTQ
1k77A           ERYRAVFIDNIRYAADRFAPHGKRILVEAKPHYLFSSQYQALAIVEEVADNVFIQLDTFHAQKVDGNLTH


                         .         .         .         +         .         .         .:280
query           AIRFLGDHDAIHHFHAKDTKVYDANARVKGVLDTTSYTDESDRSWLFRSIGYGHDESHWKDVVSTLRMVG
1xp3A1          NFDGVLNE--FDKIVGID--------RLQVLHINDSKNVRGAGKDRHENIGFGHIG--YKALHHIVHHPQ
1i60A           LKQADGKK--IFIYHIDDTEDFPIG-----------FLTDEDRVWP------GQGAIDLDAHLSALKEIG
2g0wA1          IKNVPADR--IVSIQLCDVH--------ETPYKELREESLHDRLAP------GEGYGDTVGFAKILKEHG
1qtwA           PAECE--KTFADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHS--------LGEGNIGHDAFRWIMQDDR
1a0cA           ELRYARINGVLGSIDANTGDMLLGWDT--DQFPTDIRMTTLAMYEVIKMGGFDKGGLNFDAKVRRASFEP
1bhwA           GIAQALWHKKLFHIDLNGQHGPKFDQDLVFGHGDLLNAFSLVDLLENGPDGAPAYDGPRHFDYKPSRTED
1k77A           LIRDYAGK--YAHVQIAG---------------------LPDRHEP------DDGEINYPWLFRLFDEVG


                         .         *         .         .         .         .         +:350
query           YEGALSIEHEDSLTSSREGLEKAVDVLDRAVFETQPGDAYWAE
1xp3A1          LTHVPKILEGEDKKDKKPPYKLEIEMLKNGTF-----------
1i60A           FSDVVSVELFTAEEAIQTAKKTTVDVVSK--------------
2g0wA1          VNPRVGVEVISDSXAALKVYNATKKVLDEAWPEISP-------
1qtwA           FDGIPLILETINPDIWAEEIAWLKAQQTEK-------------
1a0cA           EDLFLGHIAG---------------------------------
1bhwA           YDGV--WESAKANIRMYLLLKERAKAFRADPEVQEALAASKVA
1k77A           YQGWIGCEY-KPRGLTEEGLG----------------------