[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for hlac0:ACM57250.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1dj0A.bssp"
#ERROR : Can't open dsspfile "1e7uA1.bssp"

## Summary of PDB Search
:293
    6e-41  32%  1dj0A  [d.265.1.1] PSEUDOURIDINE SYNTHASE I
    7e-04  19%  1e7uA1 [a.118.1.6] PHOSPHATIDYLINOSITOL 3-KINASE CATALYTIC SUBUNIT
:293

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxAFRVAYDGREYAGFQRQPHATTVEGTLLRALAKHGILDRGDGPTHATPPGYAAAGRTDAGV
1dj0A           ---------ALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ----------VANEPITVFCAGRTDAGV
1e7uA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SAVAQTVAFEAPDWLTPRAFNGHLPGSVRVWAAADVPAGFHATHDAVRRTYRYHLYAPARVEETDHDHAV
1dj0A           HGTGQVVHFETTALRKDAAWNANLPGDIAVRWVKTVPDDFHARFSATARRYRYIIYAVLSKGVTHFYEPL
1e7uA1          ----------------------------------------------------HPIALP-KHRPTDRVRAE


                         +         .         .         .         .         *         .:210
query           DDGRVRDALARLSGEQDFHNLTSDETGTVRDLTTTATREGDILVVEVSAGGFPXXXXXXXXXXXXXXGRG
1dj0A           DAERMHRAAQCLLGENDFTSFRCQSRTPWRNVMINVTRHGPYVVVDIKANAFVHHMVRNIVGSLMEVGAH
1e7uA1          MPNQLRKQLEAIIATDPLNPLTAED---------------------------------------------


                         .         .         .         +         .         .         .:280
query           TADPSLIDRLLASEPISGEFGIGPAPPEPLVLWDVSYEGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dj0A           NQPESWIAELLAAK--DRTLAAATAKAEGLYLVAVDYPD-------------------------------
1e7uA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxx
1dj0A           -------------
1e7uA1          -------------