[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for huge0:KIAA1520

[Show Plain Result]

#ERROR : Can't open dsspfile "3g60A.bssp"
#ERROR : Can't open dsspfile "3g5uA.bssp"
#ERROR : Can't open dsspfile "2hydA.bssp"
#ERROR : Can't open dsspfile "2ixfC.bssp"
#ERROR : Can't open dsspfile "2ixfA.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "2ixeA.bssp"
#ERROR : Can't open dsspfile "1jj7A.bssp"
#ERROR : Can't open dsspfile "2ixgA.bssp"
#ERROR : Can't open dsspfile "1pf4A.bssp"
#ERROR : Can't open dsspfile "2ixfD.bssp"
#ERROR : Can't open dsspfile "2ixeD.bssp"
#ERROR : Can't open dsspfile "1mt0A.bssp"
#ERROR : Can't open dsspfile "2ff7A.bssp"
#ERROR : Can't open dsspfile "2fgkA.bssp"
#ERROR : Can't open dsspfile "2ffbA.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "1xefA.bssp"
#ERROR : Can't open dsspfile "2ffaA.bssp"
#ERROR : Can't open dsspfile "1z2rA.bssp"
#ERROR : Can't open dsspfile "2ghiA.bssp"
#ERROR : Can't open dsspfile "1mv5D.bssp"
#ERROR : Can't open dsspfile "1mv5A.bssp"
#ERROR : Can't open dsspfile "2ghiC.bssp"
#ERROR : Can't open dsspfile "2ghiB.bssp"
#ERROR : Can't open dsspfile "2ghiD.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "2yyzA.bssp"
#ERROR : Can't open dsspfile "2it1B.bssp"
#ERROR : Can't open dsspfile "2it1A.bssp"
#ERROR : Can't open dsspfile "1l2tB.bssp"
#ERROR : Can't open dsspfile "1l2tA.bssp"
#ERROR : Can't open dsspfile "2yz2B.bssp"
#ERROR : Can't open dsspfile "2yz2A.bssp"
#ERROR : Can't open dsspfile "1f3oA.bssp"
#ERROR : Can't open dsspfile "1q12A.bssp"
#ERROR : Can't open dsspfile "3fh6A.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "2r6gB.bssp"
#ERROR : Can't open dsspfile "2r6gA.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "2pcjA.bssp"
#ERROR : Can't open dsspfile "2oukB.bssp"
#ERROR : Can't open dsspfile "2oljA.bssp"
#ERROR : Can't open dsspfile "3gfoA.bssp"
#ERROR : Can't open dsspfile "3fvqB.bssp"
#ERROR : Can't open dsspfile "3fvqA.bssp"
#ERROR : Can't open dsspfile "2onkA.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1g9xA.bssp"
#ERROR : Can't open dsspfile "1r0zC.bssp"
#ERROR : Can't open dsspfile "1r0zB.bssp"
#ERROR : Can't open dsspfile "1r0zA.bssp"
#ERROR : Can't open dsspfile "1gajA.bssp"
#ERROR : Can't open dsspfile "1r10A.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1r0wC.bssp"
#ERROR : Can't open dsspfile "1q3hB.bssp"
#ERROR : Can't open dsspfile "1r0xB.bssp"
#ERROR : Can't open dsspfile "1r0xA.bssp"
#ERROR : Can't open dsspfile "1q3hD.bssp"
#ERROR : Can't open dsspfile "1q3hC.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "1r0zD.bssp"
#ERROR : Can't open dsspfile "1r0xD.bssp"
#ERROR : Can't open dsspfile "1r0xC.bssp"
#ERROR : Can't open dsspfile "1r0wB.bssp"
#ERROR : Can't open dsspfile "1r0wA.bssp"
#ERROR : Can't open dsspfile "1g291.bssp"
#ERROR : Can't open dsspfile "2pzgA.bssp"
#ERROR : Can't open dsspfile "2pzeB.bssp"
#ERROR : Can't open dsspfile "2pzeA.bssp"
#ERROR : Can't open dsspfile "1xfaA.bssp"
#ERROR : Can't open dsspfile "1xf9B.bssp"
#ERROR : Can't open dsspfile "1xf9A.bssp"
#ERROR : Can't open dsspfile "1xf9D.bssp"
#ERROR : Can't open dsspfile "1xf9C.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "1oxvA.bssp"
#ERROR : Can't open dsspfile "1oxsC.bssp"
#ERROR : Can't open dsspfile "1xmiE.bssp"
#ERROR : Can't open dsspfile "1xmiC.bssp"
#ERROR : Can't open dsspfile "1xmiA.bssp"
#ERROR : Can't open dsspfile "2pzfB.bssp"
#ERROR : Can't open dsspfile "2pzfA.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "2pzgB.bssp"
#ERROR : Can't open dsspfile "1xmjA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1xmiD.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "1xmiB.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1v43A.bssp"
#ERROR : Can't open dsspfile "2ihyB.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "1z47B.bssp"
#ERROR : Can't open dsspfile "1z47A.bssp"
#ERROR : Can't open dsspfile "2ihyA.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "2nq2D.bssp"
#ERROR : Can't open dsspfile "2nq2C.bssp"
#ERROR : Can't open dsspfile "2zu0C.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1yqtA.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "2qi9C.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "2vf8B.bssp"
#ERROR : Can't open dsspfile "2vf8A.bssp"
#ERROR : Can't open dsspfile "2vf7C.bssp"
#ERROR : Can't open dsspfile "2vf7B.bssp"
#ERROR : Can't open dsspfile "2vf7A.bssp"
#ERROR : Can't open dsspfile "2r6fB.bssp"
#ERROR : Can't open dsspfile "2r6fA.bssp"
#ERROR : Can't open dsspfile "2ix3A.bssp"
#ERROR : Can't open dsspfile "2iwhB.bssp"
#ERROR : Can't open dsspfile "1oxxK.bssp"
#ERROR : Can't open dsspfile "2ix8A.bssp"
#ERROR : Can't open dsspfile "2iw3B.bssp"
#ERROR : Can't open dsspfile "2iw3A.bssp"

## Summary of PDB Search
:810
    3e-88  36%  3g60A  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    3e-88  36%  3g5uA  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    8e-83  35%  2hydA  [x.x.x] ABC TRANSPORTER HOMOLOG
    1e-69  52%  2ixfC  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-69  52%  2ixfA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-68  30%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    2e-68  51%  2ixeA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    4e-68  52%  1jj7A  [c.37.1] PEPTIDE TRANSPORTER TAP1
    5e-67  51%  2ixgA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    8e-67  34%  1pf4A  [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA
    1e-66  51%  2ixfD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    3e-62  51%  2ixeD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    6e-57  49%  1mt0A  [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN
    6e-57  49%  2ff7A  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-56  48%  2fgkA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-56  48%  2ffbA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-56  48%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    9e-56  48%  1xefA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    9e-56  48%  2ffaA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    4e-53  30%  1z2rA  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    1e-49  39%  2ghiA  [x.x.x] TRANSPORT PROTEIN
    1e-47  41%  1mv5D  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    1e-47  41%  1mv5A  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    8e-44  39%  2ghiC  [x.x.x] TRANSPORT PROTEIN
    5e-43  38%  2ghiB  [x.x.x] TRANSPORT PROTEIN
    3e-39  40%  2ghiD  [x.x.x] TRANSPORT PROTEIN
    5e-25  33%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    2e-22  35%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    6e-20  36%  2yyzA  [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN
    1e-19  35%  2it1B  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    1e-19  35%  2it1A  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    2e-19  31%  1l2tB  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-19  31%  1l2tA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    4e-19  33%  2yz2B  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    4e-19  33%  2yz2A  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-18  33%  1f3oA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-18  31%  1q12A  [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING
    2e-18  31%  3fh6A  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-18  31%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-18  31%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-18  34%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    4e-18  30%  2r6gB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-18  30%  2r6gA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    7e-18  31%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-17  30%  2pcjA  [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN
    5e-17  32%  2oukB  [x.x.x] PROTEIN ARTP
    5e-17  32%  2oljA  [x.x.x] AMINO ACID ABC TRANSPORTER
    6e-17  32%  3gfoA  [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1
    6e-17  30%  3fvqB  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    6e-17  30%  3fvqA  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    8e-17  32%  2onkA  [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING
    5e-16  28%  1g6hA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    9e-16  28%  1g9xA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    1e-15  27%  1r0zC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-15  27%  1r0zB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-15  27%  1r0zA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-15  28%  1gajA  [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID
    3e-15  26%  1r10A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-15  26%  1q3hA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-15  26%  1r0wC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-14  26%  1q3hB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-14  26%  1r0xB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-14  26%  1r0xA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-14  26%  1q3hD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-14  26%  1q3hC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-14  33%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-14  27%  1r0zD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-14  27%  1r0xD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-14  27%  1r0xC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-14  27%  1r0wB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-14  27%  1r0wA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-14  30%  1g291  [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK
    6e-14  27%  2pzgA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-14  27%  2pzeB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-14  27%  2pzeA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-14  26%  1xfaA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-14  26%  1xf9B  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-14  26%  1xf9A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-13  27%  1xf9D  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-13  27%  1xf9C  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-13  25%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-13  30%  1oxvA  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    5e-13  30%  1oxsC  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    7e-13  26%  1xmiE  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-13  26%  1xmiC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-13  26%  1xmiA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-13  26%  2pzfB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-13  26%  2pzfA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-12  31%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    4e-12  25%  2pzgB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-11  25%  1xmjA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-11  31%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    4e-11  25%  1xmiD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-11  24%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-11  25%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-10  26%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  24%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-10  26%  1xmiB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-10  27%  1vplA  [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN
    3e-10  26%  1v43A  [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT
    3e-10  32%  2ihyB  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    3e-10  29%  2d2fA  [x.x.x] SUFC PROTEIN
    4e-10  25%  1z47B  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    4e-10  25%  1z47A  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    4e-10  31%  2ihyA  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    4e-10  29%  2d2eA  [x.x.x] SUFC PROTEIN
    5e-10  32%  2nq2D  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    9e-10  31%  2nq2C  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-09  30%  2zu0C  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-09  30%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    4e-09  25%  1sgwA  [c.37.1] PUTATIVE ABC TRANSPORTER
    6e-09  35%  1yqtA  [x.x.x] RNASE L INHIBITOR
    6e-09  29%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    8e-09  25%  1ji0A  [c.37.1] ABC TRANSPORTER
    2e-08  30%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    5e-08  29%  1l7vC  [c.37.1] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    7e-08  29%  2qi9C  [x.x.x] VITAMIN B12 IMPORT ATP-BINDING PROTEIN BTUD
    7e-08  29%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    3e-07  30%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-07  29%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-06  33%  2vf8B  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    2e-06  33%  2vf8A  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    2e-06  33%  2vf7C  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    2e-06  33%  2vf7B  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    2e-06  33%  2vf7A  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    2e-06  33%  2r6fB  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    2e-06  33%  2r6fA  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    2e-05  56%  2ix3A  [x.x.x] ELONGATION FACTOR 3
    2e-05  56%  2iwhB  [x.x.x] ELONGATION FACTOR 3A
    2e-05  24%  1oxxK  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    3e-04  47%  2ix8A  [x.x.x] ELONGATION FACTOR 3A
    3e-04  47%  2iw3B  [x.x.x] ELONGATION FACTOR 3A
    3e-04  47%  2iw3A  [x.x.x] ELONGATION FACTOR 3A
:810

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3g60A           ----------------------------------------------------------------------
3g5uA           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3g60A           ----------------------------------------------------------------------
3g5uA           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3g60A           ----------------------------------------------------------------------
3g5uA           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxTLQKLLSYTKPDVAFLVAASFFLIVAALGETFLPYYTGRAIDGIVIQKSMDQFSTAVVIVCLLA
3g60A           ----------------------------------------------------------------------
3g5uA           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
3b60A           ------TFRRLWPTIAPFKAGLIVAGIALILNAASDTFMLSLLKPLLDDGFGKTDRSVLLWMPLVVIGLM
2ixeA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
1pf4A           ------TFKRLWTYIRLYKAGLVVSTIALVINAAADTYMISLLKPLLD----EGFGNAESNFLRILPFMI
2ixfD           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
1z2rA           ------TFRRLWPTIAPFKAGLIVAGIALILNAASDTFMLSLLKPLLDDGFGKTDRSVLLWMPLVVIGLM
2ghiA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IGSSFAAGIRGGIFTLIFARLNIRLRNCLFRSLVSQETSFFDENRTGDLISRLTSDTTMVSDLVSQNINV
3g60A           ------AYIQVSFWCLAAGRQIHKIRQKFFHAIMNQEIGWFDVHDVGELNTRLTDDVSKINEGIGDKIGM
3g5uA           ------AYIQVSFWCLAAGRQIHKIRQKFFHAIMNQEIGWFDVHDVGELNTRLTDDVSKINEGIGDKIGM
2hydA           ------------------------IRKKLYNHLQALSARFYANNQVGQVISRVINDVEQTKDFILTGLMN
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
3b60A           ILRGITSYISSYCISWVSGKVVMTMRRRLFGHMMGMPVAFFDKQSTGTLLSRITYDSEQVASSSSGALIT
2ixeA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
1pf4A           LGLMFVRGLSGSSYCLSWVSGNVQMRRRLFNHFMHMPVRFFDQESTGGLLSRITYDSEQVAGATSRALVS
2ixfD           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
1z2rA           ILRGITSYISSYCISWVSGKVVMTMRRRLFGHMMGMPVAFFDKQSTGTLLSRITYDSEQVASSSSGALIT
2ghiA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           FLRNTVKVTGVVVFMFSLSWQLSLVTFMGFPIIMMVSNIYGKYYKRLSKEVQNALARASNTAEETISAMK
3g60A           FFQAMAXXXXXXXXXXXXXWKLTLVILAISPVLGLSAGIWAKILSSFTDKELHAYAKAGAVAEEVLAAIR
3g5uA           FFQAMAXXXXXXXXXXXXXWKLTLVILAISPVLGLSAGIWAKILSSFTDKELHAYAKAGAVAEEVLAAIR
2hydA           IWLDCITIIIALSIMFFLDVKLTLAALFIFPFYILTVYVFFGRLRKLTRERSQALAEVQGFLHERVQGIS
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
3b60A           VVREGASIIGLFIMMFYYSWQLSIILVVLAPIVSIAIRVVSKRFRSISKNMQNTMGQVTTSAEQMLKGHK
2ixeA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
1pf4A           IVREGASIIGLLTLMFWNSWQLSLVLIVVAPVVAFAISFVSKRF----RKISRNMQTAMGHRQQT---MK
2ixfD           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
1z2rA           VVREGASIIGLFIMMFYYSWQLSIILVVLAPIVSIAIRVVSKRFRSISKNMQNTMGQVTTSAER-LQGMK
2ghiA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           TVRSFANEEEEAEVYLRKLQQVYKLNRKEAAAYMYYVWGSGLTLLVVQVSILYYGGHLVISGQMTSGNLI
3g60A           TVIAFGGQKKELERYNNNLEEAKRLGIKKAITANISMGAAFLLIYASYALAFWYGTSLVISKEYSIGQVL
3g5uA           TVIAFGGQKKELERYNNNLEEAKRLGIKKAITANISMGAAFLLIYASYALAFWYGTSLVISKEYSIGQVL
2hydA           VVKSFAIEDNEAKNFDKKNTNFLTRALKHTRWNAYSFAAINTVTDIGPIIVIGVGAYLAISGSITVGTLA
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
3b60A           EVLIFGGQEVETKRF-------DKVSNKMRLQGMKMVSASSISDPIIQLIVLYAASFPSVMDSLTAGTIT
2ixeA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
1pf4A           LVSAQSIADPVIQMIXXXXXXXXXXXXXXDS----------------------------IRAELTPGTFT
2ixfD           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
1z2rA           MVSASSISDP-----------IIQLIASLALAF-----------------VLYAASFPSVMDSLTAGTIT
2ghiA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           AFIIYEFVLGDCMESVGSVYSGLMQGVGAAEKVFEFIDRQPTMVHDGSLAPDHLEGRVDFENVTFTYRTR
3g60A           SVLIGAFSVGQASPNI----EAFANARGAAYEVFKIIDNKPSIFSKSGHKPDNIQGNLEFKNIHFSYPSR
3g5uA           SVLIGAFSVGQASPNI----EAFANARGAAYEVFKIIDNKPSIFSKSGHKPDNIQGNLEFKNIHFSYPSR
2hydA           AFVGYELLFGPLRRLVAS-FTTLTQSFASMDRVFQLIDEDYDIKNGVGAQPIEIQGRIDIDHVSFQYNDN
2ixfC           ----------------------------------------------GSLAPLNMKGLVKFQDVSFAYPNH
2ixfA           ----------------------------------------------GSLAPLNMKGLVKFQDVSFAYPNH
3b60A           VVFSSMIALMRPLKSLTNVNAQFQRGMAACQTLFAILDSEQEK-DEGKRVIDRATGDLEFRNVTFTYPGR
2ixeA           ----------------------------------------------GSLAPLNMKGLVKFQDVSFAYPNH
1jj7A           ----------------------------------------------GLLTPLHLEGLVQFQDVSFAYPNR
2ixgA           ----------------------------------------------GSLAPLNMKGLVKFQDVSFAYPNH
1pf4A           VVFSAMFGLMRPLKALTSVTSEFQRGMAACQTLFGLMDLE-TERDNGKYEAERVNGEVDVKDVTFTYQGK
2ixfD           ----------------------------------------------GSLAPLNMKGLVKFQDVSFAYPNH
2ixeD           ----------------------------------------------GSLAPLNMKGLVKFQDVSFAYPNH
1mt0A           ---------------------------------------------------------ITFRNIRFRYKPD
2ff7A           ---------------------------------------------------------ITFRNIRFRYKPD
2fgkA           ---------------------------------------------------------ITFRNIRFRYKPD
2ffbA           ---------------------------------------------------------ITFRNIRFRYKPD
3b5jA           ---------------------------------------------------------ITFRNIRFRYKPD
1xefA           ---------------------------------------------------------ITFRNIRFRYKPD
2ffaA           ---------------------------------------------------------ITFRNIRFRYKPD
1z2rA           VVFSSMIALMRPLKSLTNVNAQFQRGMAA-----------------------------EFRNVTFTYPGR
2ghiA           ---------------------------------------------------------IEFSDVNFSYPKQ
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiC           ---------------------------------------------------------IEFSDVNFSYPKQ
2ghiB           ---------------------------------------------------------IEFSDVNFSYPKQ
2ghiD           ---------------------------------------------------------IEFSDVNFSYH--
2cbzA           ---------------------------------------------------------ITVRNATFTW-AR
3dhwC           ---------------------------------------------------------IKLSNITKVFHQG
2yyzA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
1l2tB           ---------------------------------------------------------IKLKNVTKTYKMG
1l2tA           ---------------------------------------------------------IKLKNVTKTYKMG
2yz2B           --------------------------------------------------------RIEVVNVSHIFHTP
2yz2A           --------------------------------------------------------RIEVVNVSHIFHTP
1f3oA           ---------------------------------------------------------IKLKNVTKTYKGE
1q12A           ---------------------------------------------------------VQLQNVTKAWG--
3fh6A           ---------------------------------------------------------VQLQNVTKAWG--
2awoA           ---------------------------------------------------------VQLQNVTKAWG--
2awnB           ---------------------------------------------------------VQLQNVTKAWG--
3d31A           ----------------------------------------------------------------------
2r6gB           ---------------------------------------------------------VQLQNVTKAWG--
2r6gA           ---------------------------------------------------------VQLQNVTKAWG--
2awoC           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
3gfoA           ------------------------------------------------------------------YNYS
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------DENNVSFSHLCL
1r0zB           ----------------------------------------------------------DENNVSFSHLCL
1r0zA           ----------------------------------------------------------DENNVSFSHLCL
1gajA           ----------------------------------------------------------------------
1r10A           ------------------------------------------------------------EKVSFSHLCL
1q3hA           ------------------------------------------------------------EKVSFSHLCL
1r0wC           ------------------------------------------------------------EKVQFSHLCL
1q3hB           --------------------------------------------------------------VSFSHLCL
1r0xB           ------------------------------------------------------EGFGELLEKSFSHLCL
1r0xA           ------------------------------------------------------EGFGELLEKSFSHLCL
1q3hD           ------------------------------------------------------EGFGELLEKVFSHLCL
1q3hC           ------------------------------------------------------EGFGELLEKVFSHLCL
2awnC           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2pzgA           ---------------------------------------------------------VVMENVT-AFWEE
2pzeB           ---------------------------------------------------------VVMENVT-AFWEE
2pzeA           ---------------------------------------------------------VVMENVT-AFWEE
1xfaA           ------------------------------------------------------EGFGELLEKSFSHLCL
1xf9B           ------------------------------------------------------EGFGELLEKSFSHLCL
1xf9A           ------------------------------------------------------EGFGELLEKSFSHLCL
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
2bboA           ---------------------------------------------------------VVMENVTAFWEEG
1oxvA           --------------------------------------------------------RIIVKNVSKVFK-K
1oxsC           --------------------------------------------------------RIIVKNVSKVFK-K
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ---------------------------------------------------------VVMENVT-AFWEE
2pzfA           ---------------------------------------------------------VVMENVTAFWGGT
2d62A           ----------------------------------------------------------------------
2pzgB           ---------------------------------------------------------VVMENVT-AFWEE
1xmjA           ---------------------------------------------------------VVMENVTAFWET-
1b0uA           ----------------------------------------------------------------------
1xmiD           -------------------------------------------------------GELFEDSLSFSNFSL
2bbtB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ---------------------------------------------------------VVMENVTAFW---
2bbsA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1v43A           ---------------------------------------------------------VKLENLTKRFG--
2ihyB           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2nq2D           ------------------------------------------------------------ENLGFYY---
2nq2C           ------------------------------------------------------------ENLGFYYQAE
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2awnA           ---------------------------------------------------------VQLQNVTKAWG--
2d3wC           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
1oxxK           --------------------------------------------------------RIIVKNVSKVFK-K
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           PHTQVLQNVSFSLSPGKVTALVGPSGSGKSSCVNILENFYPLEGGRVLLDGKPISAYDHKYLHRVISLVS
3g60A           KEVQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQDIRTINVRYLREIIGVVS
3g5uA           KEVQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQDIRTINVRYLREIIGVVS
2hydA           -EAPILKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDFLTGSLRNQIGLVQ
2ixfC           PNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAVG
2ixfA           PNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAVG
3b60A           -EVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREYTLASLRNQVALVS
2ixeA           PNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAVG
1jj7A           PDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVG
2ixgA           PNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAVG
1pf4A           -EKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDVRDYKLTNLRRHFALVS
2ixfD           PNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAVG
2ixeD           PNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAVG
1mt0A           SPV-ILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVL
2ff7A           SPV-ILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVL
2fgkA           SPV-ILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVL
2ffbA           SPV-ILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVL
3b5jA           SPV-ILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVL
1xefA           SPV-ILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVL
2ffaA           SPV-ILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVL
1z2rA           -EVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREYTLASLRNQVALVS
2ghiA           TNHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAEGD-IKIGGKNVNKYNRNSIRSIIGIVP
1mv5D           ---QILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPIDNISLENWRSQIGFVS
1mv5A           ---QILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPIDNISLENWRSQIGFVS
2ghiC           TNHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAEGD-IKIGGKNVNKYNRNSIRSIIGIVP
2ghiB           TNHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAEGD-IKIGGKNVNKYNRNSIRSIIGIVP
2ghiD           ---RTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAEGD-IKIGGKNVNKYNRNSIRSIIGIVP
2cbzA           SDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGS-------------VAYVP
3dhwC           TRTQALNNVSLHVPAGQIYGVIGASGAGKSTCVNLLER--PTEGS-VLVDGQELTTLSESELRRQIGMIF
2yyzA           ---KAVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSGEIYFDDVLVNDIPPKY--REVGMVF
2it1B           -----LNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTELPPK--DRNVGLVF
2it1A           -----LNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTELPPK--DRNVGLVF
1l2tB           EEIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTNDLDDDELTKIIGFVF
1l2tA           EEIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTNDLDDDELTKIIGFVF
2yz2B           LEKKALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGERKKGYE---IRRNIGIAF
2yz2A           LEKKALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGERKKGYE---IRRNIGIAF
1f3oA           EIIYALKNVNLNIKEGEFVS-IGPSGSGKST-LNIIGCLDKPTEGEVYIDNIKTNDLDDDELTKIIGFVF
1q12A           -EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMN--DTPPAERGVGMVF
3fh6A           -EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMN--DTPPAERGVGMVF
2awoA           -EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMN--DTPPAERGVGMVF
2awnB           -EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMN--DTPPAERGVGMVF
3d31A           -----LDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGKDVT--DLSPEKHDIAFVY
2r6gB           -EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMN--DTPPAERGVGMVF
2r6gA           -EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMN--DTPPAERGVGMVF
2awoC           ----VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMN--DTPPAERGVGMVA
2pcjA           ---EILKGISLSVKKGEFVSIIGASGSGKSTLLYILGLLDAPTEGKVFLEGKEVDYTNEKELNRKLGFVF
2oukB           ---EVLKGINVHIREGEVVVVIGPSGSGKSTCLNLLEDFXXXXXXXXXXNLKAKDTNLNK-VREEVGMVF
2oljA           ---EVLKGINVHIREGEVVVVIGPSGSGKSTCLNLLEDFXXXXXXXXXXNLKAKDTNLNK-VREEVGMVF
3gfoA           DGTHALKGINMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSSGRILFDNKPID-YSRKKLRESIGIVF
3fvqB           -NTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTIFSKNTNVRERRLGYLV
3fvqA           -NTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTIFSKNTNVRERRLGYLV
2onkA           -------NVDFEMGRD-YCVLLGPTGAGKSVFLELIAGIVKPDRGEVRLNGADITPLPPE--RRGIGFVP
1g6hA           ---KALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEELYHYGIVRTFQ
1g9xA           ---KALDGVSISVCKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEELYHYGIVRTFQ
1r0zC           VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCS
1r0zB           VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCS
1r0zA           VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCS
1gajA           ---KALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEELYHYGIVRTFQ
1r10A           VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCS
1q3hA           VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCS
1r0wC           VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCS
1q3hB           VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCS
1r0xB           VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCS
1r0xA           VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCS
1q3hD           VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCS
1q3hC           VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCS
2awnC           ----VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLG-------------------------VGMVF
1r0zD           ----VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCS
1r0xD           ----VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCS
1r0xC           ----VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCS
1r0wB           ----VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCS
1r0wA           ----VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCS
1g291           -----VREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIGDKLVADPEKGIFDRDIAMVF
2pzgA           GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCS
2pzeB           GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCS
2pzeA           GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCS
1xfaA           VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCS
1xf9B           VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCS
1xf9A           VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCS
1xf9D           ----VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCS
1xf9C           ----VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCS
2bboA           LGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCS
1oxvA           GKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVDRKIGMVF
1oxsC           GKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVDRKIGMVF
1xmiE           --TPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCS
1xmiC           --TPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCS
1xmiA           --TPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCS
2pzfB           GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCS
2pzfA           P---VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCS
2d62A           -----VKDLSLEIKDGEFLVLLGPSGCGKTTTLRIAGLEEPTRGQIYIEDNLVADPEKGVFVERDVA-VF
2pzgB           GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCS
1xmjA           ---PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCS
1b0uA           ---EVLKGVSLQARAGDVXXXXXXXXXXKSTCINFLEK--PSEGA-IIVNGQNINLVRDKLLRTRLTMVF
1xmiD           LGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCS
2bbtB           -NTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCS
2bbtA           --TPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCS
2bbsB           ----VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCS
2bbsA           --TPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCS
1xmiB           --TPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCS
1vplA           -----------------------PNGAGKTTTLRIISTLIKPSSGIVTVFGKNVVEEPHE-VRKLISYLP
1v43A           -NFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYLPPK--DRNISMVF
2ihyB           ----ILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFGKPGKGYSAETVRQHIGFVS
2d2fA           ----ILKGVNLVVPKGEVHALMGPNGAGKSTLGKILDPEYTVERGEILLDGENIELSPDERARKGLFLAF
1z47B           -----VRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRVT--DLPPQKRNVGLVF
1z47A           -----VRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRVT--DLPPQKRNVGLVF
2ihyA           ----ILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFGKP--GYSAETVRQHIGFVS
2d2eA           ----ILKGVNLVVPKGEVHALMGPNGAGKSTLGKILDPEYTVERGEILLDGENIELSPDERARKGLFLAF
2nq2D           ---QAFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHPIQG--------KIEVYQS------IGFVP
2nq2C           NF--LFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHPIQG--------KIEVYQS------IGFVP
2zu0C           ----ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLREDYEVTGGTVEFKGKDLLALSEDRAGEGIFMAF
2d3wA           ----ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLREDYEVTGGTVEFKGKDLLALSEDRAGEGIFMAF
1sgwA           ----VLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPITKVKGKIFFLPEEIIV
1yqtA           ------------IKKGEVIGIVGPNGIGKTTFVKLAGVEEPTEGK---IEWDLTVAYKPQY---------
3bk7A           ---------------GEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKVEWD--LTVAYKPQY----IKAEY
1ji0A           -----IKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDITNKPAHVINRGIALVP
2d3wB           ----ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLREDYEVTGGTVEFKGKDLLALSEDRAGEGIFMAF
1l7vC           --------LSGEVRAGEILHLVGPNGAGKST---LLARAGTSGKGSIQFAGQPLEAWSKLALHRAY-LSQ
2qi9C           --------LSGEVRAGEILHLVGPNGAGKST---LLARAGTSGKGSIQFAGQPLEAWSKLALHRAY-LSQ
2d3wD           ----ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLREDYEVTGGTVEFKGKDLLALSEDRAGEGIFMAF
2awnA           -EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMN--DTPPAERGVGMVF
2d3wC           ----ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLREDYEVTGGTVEFKGKDLLALSEDRAGEGIFMAF
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
1oxxK           GKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVDRKIGMVF
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           QEPVLFARSITDNISYGLPTVPFEMVVEAAQKANAHGFIMELQDGYSTETGEKGAQLSGGQKQRVAMARA
3g60A           QEPVLFATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFDTLVGERGAQLSGGQKQRIAIARA
3g5uA           QEPVLFATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFDTLVGERGAQLSGGQKQRIAIARA
2hydA           QDNILFSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSGGQKQRLSIARI
2ixfC           QEPLLFGRSFRENIAYGLTRTPMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQLSGGQRQAVALARA
2ixfA           QEPLLFGRSFRENIAYGLTRTPMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQLSGGQRQAVALARA
3b60A           QNVHLFNDTVANNIAYATEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGVLLSXXXXXXXXXXXX
2ixeA           QEPLLFGRSFRENIAYGLTRTPMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQLSGGQRQAVALARA
1jj7A           QEPQVFGRSLQENIAYGLTQKPMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARA
2ixgA           QEPLLFGRSFRENIAYGLTRTPMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQLAVGQRQAVALARA
1pf4A           QNVHLFNDTIANNIAYAAEEYTREQIEQAARQAHAMEFIENMPQGLDTVIGENGTSLSGGQRQRVAIARA
2ixfD           Q--LLFGRSFRENIAYGLTRTPMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQLSGGQRQAVALARA
2ixeD           --PLLFGRSFRENIAYGLTRTPMEEITAVAMESGAHDFISGFPQGYDTE-----VQLSGGQRQAVALARA
1mt0A           QDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARA
2ff7A           QDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARA
2fgkA           QDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARA
2ffbA           QDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARA
3b5jA           QDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARA
1xefA           QDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARA
2ffaA           QDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARA
1z2rA           QNVHLFNDTVANNIAYATEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGVLLSXXXXXXXXXXXX
2ghiA           QDTILFNETIKYNILYGKLDATDEEVIKATKSAQLYDFIEALPKKWDTIVGNKGMKLSGGERQRIAIARC
1mv5D           QDSAIMAGTIRENLTYGLEDYTDEDLWQVLDLAFARSFVENMPDQLNTEVGERGVKISGGQRQRLAIARA
1mv5A           QDSAIMAGTIRENLTYGLEDYTDEDLWQVLDLAFARSFVENMPDQLNTEVGERGVKISGGQRQRLAIARA
2ghiC           QDTILFNETIKYNILYGKLDAT-EEVIKATKSAQLYDFIEALPKKWDTIVG--GMKL--GERQRIAIARC
2ghiB           QDTILFNETIKYNILYGKLDATDEEVIKATKSAQLYDFIEALPKKWDTIVGNK-MKLSGGERQRIAIARC
2ghiD           QDTILFNETIKYNILYGKLDATDEEVIKATKSAQLYDFIEALPKKWDTIV------LSGGERQRIAIARC
2cbzA           QQAWIQNDSLRENILFGLEEPYYRSVIQACALLPD---LEILPSGDRTEIGEKGVNLSGGQKQRVSLARA
3dhwC           QHNLLSSRTVFGNVA-----LPLEL--DNTPKDEVKRRVTELLSGLGDKHDSYPSNLSGGQKQRVAIARA
2yyzA           QNYALYPHTVFENIAFPLRARRIKRVVEIARKL----LIDNLLD-------RKPTQLSGGQQQRVALARA
2it1B           QNWALYPHTVYKNIAFPLELAPREEIDKKVREVAKMLHIDKLLNRYPW-------QLSGGQQQRVAIARA
2it1A           QNWALYPHTVYKNIAFPLELAPREEIDKKVREVAKMLHIDKLLNRYPW-------QLSGGQQQRVAIARA
1l2tB           QQPLLTA---LENVE--LPLIKYRGAMSGEERRKRALECLKMAELEERFANHKPNQLSGGQQQRVAIARA
1l2tA           QQPLLTA---LENVE--LPLIKYRGAMSGEERRKRALECLKMAELEERFANHKPNQLSGGQQQRVAIARA
2yz2B           QYPEFFAERVFDEVAFAVKNFPDRDPVPLVKKAME--FVGLDFDSFKDRVP---FFLSGGEKRRVAIASV
2yz2A           QYPEFFAERVFDEVAFAVKNFPDRDPVPLVKKAME--FVGLDFDSFKDRVP---FFLSGGEKRRVAIASV
1f3oA           QQPLLTA---LENVELPLIFKYRGASGEERRKRALECLKAELEERFANH---KPNQLSGGQQQRVAIARA
1q12A           QSYALYPHSVAENMSFGLKLAGAKKEV-INQRVNQVAEVLQL----AHLLDRKPKALSGGQRQRVAIGRT
3fh6A           QSYALYPHSVAENMSFGLKLAGAKKEV-INQRVNQVAEVLQL----AHLLDRKPKALSGGQRQRVAIGRT
2awoA           QSYALYPHSVAENMSFGLKLAGAKKEV-INQRVNQVAEVLQL----AHLLDRKPKALSGGQRQRVAIGRT
2awnB           QSYALYPHSVAENMSFGLKLAGAKKEV-INQRVNQVAEVLQL----AHLLDRKPKALSGGQRQRVAIGRT
3d31A           QNYSLFPHNVKKNLEFGMRMKKIKRVLDTARDLK----IEHLLD-------RNPLTLSGGEQQRVALARA
2r6gB           QSYALYPHSVAENMSFGLKLAGAKKEV-INQRVNQVAEVLQL----AHLLDRKPKALSGGQRQRVAIGRT
2r6gA           QSYALYPHSVAENMSFGLKLAGAKKEV-INQRVNQVAEVLQL----AHLLDRKPKALSGGQRQRVAIGRT
2awoC           LYPHL---SVAENMSFGLKLAGAKKEV-INQRVNQVAEVLQL----AHLLDRKPKALSGGQRQRVAIGRT
2pcjA           QFHYLIPETALENV-----IVPMLKMGKPKKEAKERGEYLLSELGLGDKLSRKPYELSGGEQQRVAIARA
2oukB           QRFNLFPHTVLNNITLA------PMKVRKWPREKAEAKAMELLDGLKDKAHAYPDSLSGGQAQRVAIARA
2oljA           QRFNLFPHTVLNNITLA------PMKVRKWPREKAEAKAMELLDGLKDKAHAYPDSLSGGQAQRVAIARA
3gfoA           QDPQLFSASVYQDVSFGAVNLPEDEIRKRVDNALKRTGIEHLKD-------KPTHCLSFGQKKRVAIAGV
3fvqB           QEGVLFPHTVYRNIAYGLGNGK----GRTAQERQRIEAMLEL-TGISELAGRYPHELSGGXXXXXXXXXX
3fvqA           QEGVLFPHTVYRNIAYGLGNGK----GRTAQERQRIEAMLEL-TGISELAGRYPHELSGGXXXXXXXXXX
2onkA           QDYALFPHSVYRNIAYGLXXXXXXXXXXXXXXMAEKLGIAHLLD-------RKPARLSGGERQRVALARA
1g6hA           TPQPLKEMTVLENLLIGLNSLFYKKWIEMVEKAFKILEFLKLSHLYDRKAGE----LSGGQMKLVEIGRA
1g9xA           TPQPLKEMTVLENLLIGLNSLFYKKWIEMVEKAFKILEFLKLSHLYDRKAGE----LSGGQMKLVEIGRA
1r0zC           QFSWIMPGTIKENIIFGVSEYRYKSVVKACQLQQD---ITKFAEQDNTVLGEGGVTLSGGQRARISLARA
1r0zB           QFSWIMPGTIKENIIFGVSEYRYKSVVKACQLQQD---ITKFAEQDNTVLGEGGVTLSGGQRARISLARA
1r0zA           QFSWIMPGTIKENIIFGVSEYRYKSVVKACQLQQD---ITKFAEQDNTVLGEGGVTLSGGQRARISLARA
1gajA           TPQPLKEMTVLENLLIGLNSLFYKKWIEMVEKAFKILEFLKLSHLYDRKAGE----LSGGQMKLVEIGRA
1r10A           QFSWIMPGTIKENIIFGVSEYRYKSVVKACQLQQD---ITKFAEQDNTVLGEGGVTLSGGQRARISLARA
1q3hA           QFSWIMPGTIKENIIFGVSEYRYKSVVKACQLQQD---ITKFAEQDNTVLGEGGVTLSGGQRARISLARA
1r0wC           QFSWIMPGTIKENIIFGVSEYRYKSVVKACQLQQD---ITKFAEQDNTVLGEGGVTLSGGQRARISLARA
1q3hB           QFSWIMPGTIKENIIFGVSEYRYKSVVKACQLQQD---ITKFAEQDNTVLGEGGVTLSGGQRARISLARA
1r0xB           QFSWIMPGTIKENIIFGVSEYRYKSVVKACQLQQD---ITKFAEQDNTVLGEGGVTLSGGQRARISLARA
1r0xA           QFSWIMPGTIKENIIFGVSEYRYKSVVKACQLQQD---ITKFAEQDNTVLGEGGVTLSGGQRARISLARA
1q3hD           QFSWIMPGTIKENIIFGVSEYRYKSVVKACQLQQD---ITKFAEQDNTVLGEGGVTLSGGQRARISLARA
1q3hC           QFSWIMPGTIKENIIFGVSEYRYKSVVKACQLQQD---ITKFAEQDNTVLGEGGVTLSGGQRARISLARA
2awnC           QSYALYPHSVAENMSFGLKLAGAKKEV-INQRVNQVAEVLQL----AHLLDRKPKALSGGQRQRVAIGRT
1r0zD           QFSWIMPGTIKENIIFGVSEYRYKSVVKACQLQQD---ITKFAEQDNTVLGEGGVTLSGGQRARISLARA
1r0xD           QFSWIMPGTIKENIIFGVSEYRYKSVVKACQLQQD---ITKFAEQDNTVLGEGGVTLSGGQRARISLARA
1r0xC           QFSWIMPGTIKENIIFGVSEYRYKSVVKACQLQQD---ITKFAEQDNTVLGEGGVTLSGGQRARISLARA
1r0wB           QFSWIMPGTIKENIIFGVSEYRYKSVVKACQLQQD---ITKFAEQDNTVLGEGGVTLSGGQRARISLARA
1r0wA           QFSWIMPGTIKENIIFGVSEYRYKSVVKACQLQQD---ITKFAEQDNTVLGEGGVTLSGGQRARISLARA
1g291           QSYALYPHTVYDNIAFPLKLVPRQEIDQRVRE------VAELL-GLTELLNRKPRELSGGQRQRVALGRA
2pzgA           QFSWIMPGTIKENIIFGVSEYRYRSVIKACQLEED---ISKFAEKDNIVLGEGGITLSGGQRARISLARA
2pzeB           QFSWIMPGTIKENIIFGVSEYRYRSVIKACQLEED---ISKFAEKDNIVLGEGGITLSGGQRARISLARA
2pzeA           QFSWIMPGTIKENIIFGVSEYRYRSVIKACQLEED---ISKFAEKDNIVLGEGGITLSGGQRARISLARA
1xfaA           QFSWIMPGTIKENIIRGVSEYRYKSVVKACQLQQD---ITKFAEQDNTVLGEGGVTLSGGQRARISLARA
1xf9B           QFSWIMPGTIKENIISGVSEYRYKSVVKACQLQQD---ITKFAEQDNTVLGEGGVTLSGGQRARISLARA
1xf9A           QFSWIMPGTIKENIISGVSEYRYKSVVKACQLQQD---ITKFAEQDNTVLGEGGVTLSGGQRARISLARA
1xf9D           QFSWIMPGTIKENIISGVSEYRYKSVVKACQLQQD---ITKFAEQDNTVLGEGGVTLSGGQRARISLARA
1xf9C           QFSWIMPGTIKENIISGVSEYRYKSVVKACQLQQD---ITKFAEQDNTVLGEGGVTLSGGQRARISLARA
2bboA           QFSWIMPGTIKENIIFGVDEYRYRSVIKACQLEED---ISKFAEKDNIVLGEGGITLSEGQQAKISLARA
1oxvA           QTWALYPNTAFENIAFPLTNMKMKRVEEVAKILDIHHVLNHFP-----------RELSGGQQQRVALARA
1oxsC           QTWALYPNTAFENIAFPLTNMKMKRVEEVAKILDIHHVLNHFP-----------RELSGGQQQRVALARA
1xmiE           QFSWIMPGTIKENIIAGVSEYRYRSVIKACQLEED---ISKFAEKDNIVLGEGGITLSGGQRARISLARA
1xmiC           QFSWIMPGTIKENIIAGVSEYRYRSVIKACQLEED---ISKFAEKDNIVLGEGGITLSGGQRARISLARA
1xmiA           QFSWIMPGTIKENIIAGVSEYRYRSVIKACQLEED---ISKFAEKDNIVLGEGGITLSGGQRARISLARA
2pzfB           QFSWIMPGTIKENIGVSYDEYRYRSVIKACQLEED---ISKFAEKDNIVLGEGGITLSGGQRARISLARA
2pzfA           QFSWIMPGTIKENIGVSYDEYRYRSVIKACQLEED---ISKFAEKDNIVLGEGGITLSGGQRARISLARA
2d62A           QSYALYPHTVYDNIAFPLKLVPKQEIDKRVRE------VAEL--GLTELLNRKPRELSGGQRQRVALGRA
2pzgB           QFSWIMPGTIKENIIFGVSEYRYRSVIKACQLEE------DISKFAEKDNIVLGITLSGGQRARISLARA
1xmjA           QFSWIMPGTIKENIGVSYDEYRYRSVIKACQLEED---ISKFAEKDNIVLGEGGITLSEGQQAKISLARA
1b0uA           QHFNLWSHTVLENVM----EAPIQVLGLSKHDARERALKYLAKVGIDERAGKYPVHLSGGQQQRVSIARA
1xmiD           QFSWIMPGTIKENIIAGVSEYRYRSVIKACQLEED---ISKFAEKDNIVLGE--ITLSGGQRARISLARA
2bbtB           QNSWIMPGTIKENIGVSYDEYRYRSVIKACQLEE------DISKFAEKDNIVLGITLSGGQRARISLARA
2bbtA           QNSWIMPGTIKENIGVSYDEYRYRSVIKACQLEED---ISKFAEKDNIVLG--GITLSGGQRARISLARA
2bbsB           QNSWIMPGTIKENIGVSYDEYRYRSVIKACQLEED---ISKFAEKDNIVLG--GITLSGGQRARISLARA
2bbsA           QNSWIMPGTIKENIGVSYDEYRYRSVIKACQ-------LEEDISKFAEKDNIVLITLSGGQRARISLARA
1xmiB           QFSWIMPGTIKENIIAGVSEYRYRSVIKACQ----------LEEDISKIV----LTLSGGQRARISLARA
1vplA           EEAGAYRNM------QGIEYLRFVAGFYASSSSEIEEMVERATEGLGEKIKDRVSTYSKGMVRKLLIARA
1v43A           QHMTVY-----ENIAFPLKKFPKDEIDKRVRWAAELLQIEELLNRYP-------AQLSGGXXXXXXXXXX
2ihyB           -------HSLLEKFQEGERVI--DVVISGAFK--SIGVYQDIDDEIRNEVGSAKAQLSTGEKQRV-IARA
2d2fA           QYPVVPGVTIANFLRLALQALGREVVAEFWTKVKKALELLDWDESYLSRYLNEG--FSGGEKKRNEILQL
1z47B           QNYALFQHTVYDNVSFGLRE---KRVPKDEMDARVRELLRFMRESYANRFPH---ELSGGXXXXXXXXXX
1z47A           QNYALFQHTVYDNVSFGLRE---KRVPKDEMDARVRELLRFMRESYANRFPH---ELSGGXXXXXXXXXX
2ihyA           HEKFQEGERVIDVVISG--AIDDEIRNEAHQLLKLVG---------SAKAQQYIGYLSTGEKQRV-IARA
2d2eA           QYPVVPGVTIANFLRLALQALGREVVAEFWTKVKKALELLDWDESYLSR------YLNEGEKKRNEILQL
2nq2D           QSP--FAYSVLDIVLMGRSTH-----INTFAKPKSHDYQVAMQANLTHLAKREFTSLSGGQRQLILIARA
2nq2C           QSP--FAYSVLDIVLMGRSTH-----INTFAKPKSHDYQVAMQANLTHLAKREFTSLSGGQRQLILIARA
2zu0C           QYPVFFLQTALNAVSYGQETLDRFDFQDLMEEKIA---LLKMPEDLLTRSVNVG--FSGGEKKRNDILQM
2d3wA           QYPVFFLQTALNAVSYGQETLDRFDFQDLMEEKIA---LLKMPEDLLTRSVNVG--FSGGEKKRNDILQM
1sgwA           PRKI----SVEDYLKYGV-------------KVNKNEIMDALESVEVLDLKKKLGELSQGTIRRVQLAST
1yqtA           -------------IKADYEGTVYELLSKIASKLNSNFYKTELLDLYDREVNE----LSGGELQRVAIAAT
3bk7A           EGTVYELLSKIDSSKLNSNFYKTELLKPLG--------IIDLYD-------RNVEDLSGGELQRVAIAAT
1ji0A           EGRRIFPETVYENLG-------------AYNRKDKEGIKRDLEWIFSERLKQLGGTLSGGE-QQLAIGRA
2d3wB           QYPVFFLQTALNAVSYGQETLDRFDFQDLMEEKIA---LLKMPEDLLTRSVNVG--FSGGEKKRNDILQM
1l7vC           QQTPPFATPVWHYLTL------HQHDKTRTELLNDVAGALALDD----KLGRSTNQLSGGEWQRVRLAAV
2qi9C           QQTPPFATPVWHYLTL------HQHDKTRTELLNDVAGALALDD----KLGRSTNQLSGGEWQRVRLAAV
2d3wD           QYPVFFLQTALNAVSYGQETLDRFDFQDLMEEKIA---LLKMPEDLLTRSVNVG--FSGGEKKRNDILQM
2awnA           Q-------------SYALEVIN--------QRVNQVAEVL-------------------------AIGRT
2d3wC           QYPVFFLQTALNAVSYGQETLDRFDFQDLMEEKIA---LLKMPEDLLTRSVNVG--FSGGEKKRNDILQM
2vf8B           --------------------------------------------------GQPATELSGGEAQRIKLATE
2vf8A           --------------------------------------------------GQPATELSGGEAQRIKLATE
2vf7C           --------------------------------------------------GQPATELSGGEAQRIKLATE
2vf7B           --------------------------------------------------GQPATELSGGEAQRIKLATE
2vf7A           --------------------------------------------------GQPATELSGGEAQRIKLATE
2r6fB           --------------------------------------------GLGYKLGQPATTLSGGEAQRVKLAAE
2r6fA           --------------------------------------------GLGYKLGQPATTLSGGEAQRVKLAAE
2ix3A           --------------------------------------------------------LSGGWKMKLALARA
2iwhB           --------------------------------------------------------LSGGWKMKLALARA
1oxxK           QTWALYPNTAFENIAFPLTNMKMKRVEEVAKILDIHHVLNHFP-----------RELSGXXXXXXXXXXX
2ix8A           -----------------------------------------IEFGFTDEIAPISA-LSGGWK-KLALARA
2iw3B           -----------------------------------------IEFGFTDEIAPISA-LSGGWK-KLALARA
2iw3A           -----------------------------------------IEFGFTDEIAPISA-LSGGWK-KLALARA


                         .         .         .         .         +         .         .:770
query           LVRNPPVLILDEATSALDAESEYLIQQAIHGNLQKHTVLIIAHRLSTVEHAHLIVVLDKGRVVQQGTHQQ
3g60A           LVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFDGGVIVEQGNHDE
3g5uA           LVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFDGGVIVEQGNHDE
2hydA           FLNNPPILILDEATSALDLESESIIQEALDVLSKDRTTLIVAHRLSTITHADKIVVIENGHIVETGTHRE
2ixfC           LIRKPRLLILDQATSALDAGNQLRVQRLLYESPESRTVLLITHQLSLAERAHHILFLKEGSVCEQGTHLQ
2ixfA           LIRKPRLLILDQATSALDAGNQLRVQRLLYESPESRTVLLITHQLSLAERAHHILFLKEGSVCEQGTHLQ
3b60A           XXXDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLSTIEQAXXXXXXXXXXXXXRGTHSE
2ixeA           LIRKPRLLILDNATSALDAGNQLRVQRLLYESPESRTVLLITQQLSLAERAHHILFLKEGSVCEQGTHLQ
1jj7A           LIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQ
2ixgA           LIRKPRLLILDNATSALDAGNQLRVQRLLYESPESRTVLLITQQLSLAERAHHILFLKEGSVCEQGTHLQ
1pf4A           LLRDAPVLILDEATSALDTESERAIQAALDELQKNKTVLVIAHRLSTIEQADEILVVDEGEIIERGRH--
2ixfD           LIRKPRLLILDQATSALDAGNQLRVQRLLYESPESRTVLLITHQLSLAERAHHILFLKEGSVCEQGTHLQ
2ixeD           LIRKPRLLILDNATSALDAGNQLRVQRLLYESPESRTVLLITQQLSLAERAHHILFLKEGSVCEQGTHLQ
1mt0A           LVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHK-
2ff7A           LVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHK-
2fgkA           LVNNPKILIFDQATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHK-
2ffbA           LVNNPKILIFDQATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHK-
3b5jA           LVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHK-
1xefA           LVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAARLSTVKNADRIIVMEKGKIVEQGKHK-
2ffaA           LVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAARLSTVKNADRIIVMEKGKIVEQGKHK-
1z2rA           XXXDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLSTIEQAXXXXXXXXXXXXXRGTH--
2ghiA           LLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRKNRTLIIIAHRLSTISSAESIILLNKGKIVEKGTHKD
1mv5D           FLRNPKILMLDEATASLDSESESMVQKALDSLMKGRTTLVIAHRLSTIVDADKIYFIEKGQITGSGKHNE
1mv5A           FLRNPKILMLDEATASLDSESESMVQKALDSLMKGRTTLVIAHRLSTIVDADKIYFIEKGQITGSGKHNE
2ghiC           LLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRKNRTLIIIAHRLSTISSAESIILLNKGKIVEKGTHKD
2ghiB           LLKDPKIVIFDEATS--DSKTEYLFQKAVEDLRKNRTLIIIAHR--TISSAESIILLNKGKIVEKGTHKD
2ghiD           LLKDPKIVIFD------DSKTEYLFQKAVEDN---RTLIIIAHRLSTISSAESIILLNKGKIVEKGTHKD
2cbzA           VYSNADIYLFDDPLSAVDAHGKHIFENVIKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQE
3dhwC           LASNPKVLLCDEATSALDPATTRSILELLKDINRRLTILLITHEMDVVKRCDCVAVISNGELIEQDTVSE
2yyzA           LVKQPKVLLFDEPLSNLDANLRMIMRAEIK-HLQQESVYVTHDQAEAMTMASRIAVFNQGKLVQYGTPDE
2it1B           LVKEPEVLLLDEPLSNLDALLRLEVRAELK-RLQKETVYVTHDQAEALAMADRIAVIREGEILQVGTPDE
2it1A           LVKEPEVLLLDEPLSNLDALLRLEVRAELK-RLQKETVYVTHDQAEALAMADRIAVIREGEILQVGTPDE
1l2tB           LANNPPIILADQPTGALDSKTGEKIMQLLKNEEDGKTVVVVTHDINVARFGERIIYLKDGEVERE-----
1l2tA           LANNPPIILADQPTGALDSKTGEKIMQLLKNEEDGKTVVVVTHDINVARFGERIIYLKDGEVERE-----
2yz2B           IVHEPDILILDEPLVGLDREGKTLLRIVEKWKTLGKTVILISHDIETVNHVDRVVVLEKGKKVFDGTRME
2yz2A           IVHEPDILILDEPLVGLDREGKTLLRIVEKWKTLGKTVILISHDIETVNHVDRVVVLEKGKKVFDGTRME
1f3oA           LANNPPIILADEPTGALDSKTGEKIQLLKKLNEEDKTVVVVTHDINVARFGERIIYLKDGEVERE-----
1q12A           LVAEPSVFLLDEPLSNLDAALRVQMRSRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLE
3fh6A           LVAEPSVFLLDEPLSNLDAALRVQMRSRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLE
2awoA           LVAEPSVFLLDEPLSNLDAALRVQMRSRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLE
2awnB           LVAEPSVFLLDEPLSNLDAALRVQMRSRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLE
3d31A           LVTNPKILLLDEPLSALDPRTQENARESVLHKKNKLTVLHITHDQTEARMADRIAVVMDGKLIQVGKPEE
2r6gB           LVAEPSVFLLDQPLSNLDAALRVQMRSRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLE
2r6gA           LVAEPSVFLLDQPLSNLDAALRVQMRSRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLE
2awoC           LVAEPSVFLLDEPLSNLDAALRVQMRSRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLE
2pcjA           LANEPILLFADEPTGNLDANTKRVMDIFLKINEGGTSIVMVTHERELAELTHRTLEMKDGKVVGEIT---
2oukB           LAMEPKIMLFDEPTSALDPEGEVLSVMKQLAN-EGMTMVVVTHEMGFAEVGDRVLFMDGGYIIEEGKPED
2oljA           LAMEPKIMLFDEPTSALDPEGEVLSVMKQLAN-EGMTMVVVTHEMGFAEVGDRVLFMDGGYIIEEGKPED
3gfoA           LVMEPKVLILDEPTAGLDPMGVSEIMKLL-VEMQKELGXXXXXXXXXXXXVPLVFVMKEGRVILQGNPKE
3fvqB           XXPDPELILLDEPFSALDEQLRRQIREDMIAALRKSAVFVSHDREEALQYADRIAVMKQGRILQTASPHE
3fvqA           XXPDPELILLDEPFSALDEQLRRQIREDMIAALRKSAVFVSHDREEALQYADRIAVMKQGRILQTASPHE
2onkA           LVIQPRLLLLDEPLSAVDLKTKGVLMEELRFVQREFDVPILHVTHDLIEAAMLVAVMLNGRIVEKGKLKE
1g6hA           LMTNPKMIVMDEPIAGVPGLAHDIFNHVLELKAKGITFLIIEHRLDIVNYIDHLYVMFNGQIIAEGRGEE
1g9xA           LMTNPKMIVMDEPIAGVPGLAHDIFNHVLELKAKGITFLIIEHRLDIVNYIDHLYVMFNGQIIAEGRGEE
1r0zC           VYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSE
1r0zB           VYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSE
1r0zA           VYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSE
1gajA           LMTNPKMIVMDQPIAGVPGLAHDIFNHVLELKAKGITFLIIEHRLDIVNYIDHLYVMFNGQIIAEGRGEE
1r10A           VYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSE
1q3hA           VYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSE
1r0wC           VYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSE
1q3hB           VYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSE
1r0xB           VYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSE
1r0xA           VYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSE
1q3hD           VYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSE
1q3hC           VYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSE
2awnC           LVAEPSVFLLDEPLSNLDAALRVQMRSRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLE
1r0zD           VYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSE
1r0xD           VYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSE
1r0xC           VYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSE
1r0wB           VYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSE
1r0wA           VYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSE
1g291           IVRKPQVFLMDEPLSNLDAKLRVRMRAELK-KLQRQTTIYVTH-----DQVEAMTMGDRIAVMNRGVLQQ
2pzgA           VYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSE
2pzeB           VYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSE
2pzeA           VYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSE
1xfaA           VYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSE
1xf9B           VYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSE
1xf9A           VYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSE
1xf9D           VYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSE
1xf9C           VYKDADLYLLDSPFGYLDVTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSE
2bboA           VYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSE
1oxvA           LVKDPSLLLLDEPFSNLDADSARALVKEVQSRLGV-TLLVVSH---------------------------
1oxsC           LVKDPSLLLLDEPFSNLDADSARALVKEVQSRLGV-TLLVVSH---------------------------
1xmiE           VYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSE
1xmiC           VYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSE
1xmiA           VYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSE
2pzfB           VYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSE
2pzfA           VYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSE
2d62A           IIRRPKV-FLDEPLSNLDAKLR--VKRAELKKLQRQTTIYVTH--DQVEATGDRIAVNKGELQQVGTPDE
2pzgB           VYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSE
1xmjA           VYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSE
1b0uA           LAMEPDVLLFDEPTSALDPEGEVLMQQLAE---EGKTMVVVTHEMGFARHSSHVIFLHQGKIEEEGDPEQ
1xmiD           VYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSE
2bbtB           VYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSE
2bbtA           VYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSE
2bbsB           VYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSE
2bbsA           VYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSE
1xmiB           VYKDADLYLLDSPFGYLDVLTEEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSE
1vplA           LMVNPRLAILDEPTSGLDVEVRKILKQASQEGL---TILVSSHNMLEVEFCDRIALIHNGTIVETGTVEE
1v43A           XXXEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKTTIYVTHDQVEAMTMGDRIAVMNRGQLLQIGS---
2ihyB           L-GQPQVLILDEPAAGLDAREXXXXXXXXXXXXYPTLAIYVTHFIEEIANFSKILLLKDGQSIQQGAVED
2d2fA           LVLEPTYAVLDETDSGLDIDALKVVARGVNARGPNFGALVITHRILNYIQPDKVHVMMDGRVVATG----
1z47B           XXXXXXXXXFDEPFAAIDTQIRRELRRQVHDEMGVTSVFVTHDQEEALEVADRVLVLHEGNVEQFGTPEE
1z47A           XXXXXXXXXFDEPFAAIDTQIRRELRRQVHDEMGVTSVFVTHDQEEALEVADRVLVLHEGNVEQFGTPEE
2ihyA           L-GQPQVLILDEPAAGLDAREXXXXXXXXXXXXYPTLAIYVTHFIEEIANFSKILLLKDGQSIQQGAVED
2d2eA           LVLEPTYAVLDETDSGLDIDALKVVARGVNARGPNFGALVITHRILNYIQPDKVHVMMDGRVVATG----
2nq2D           IASECKLILLDEPTSALDLANQDIVLSLLLAQSQNMTVVFTTHQPNQV----------------------
2nq2C           IASECKLILLDEPTSALDLANQDIVLSLLLAQSQNMTVVFTTHQPNQV----------------------
2zu0C           AVLEPELCILDESDSGLDIDALKVVADGVNSLRDKRSFIIVTHRILDYIKPDYVHVLYQGRIVKSGDFKQ
2d3wA           AVLEPELCILDESDSGLDIDALKVVADGVNSLRDKRSFIIVTHRILDYIKPDYVHVLYQGRIVKSGDFKQ
1sgwA           LLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEKGIVIISSR--------------------------
1yqtA           LLRDADIYLLDEPSAYLDVEQRLAVSRAIHLEKNEKTALVVEH---------------------------
3bk7A           LLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLMEKNTALVVEHDVLMIDYVSDRLIVFEG---EPGRHGR
1ji0A           LSRPK---LLDEPSLGLAPILVSEVFEVIQKINQEGTTILLVEQLGALKVAHYGYVLETGQIVLEGKASE
2d3wB           AVLEPELCILDESDS-LDIDALKVVADGVNSLRDKRSFIIVTHRILDYIKPDYVHVLYQGRIVKSGDFKQ
1l7vC           VLQITPLLLLDEPNS-LDVAQQSALDKILSALCQQGLAIVSSHDLNTLRHAHRAWLL-KGGKLASGRREE
2qi9C           VLQITPLLLLDEPNS-LDVAQQSALDKILSALSQQGLAIVSSHDLNTLRHAHRAWLL-KGGKLASGRREE
2d3wD           AVLEPELCILDE-SDGLDIDALKVVADGVNSLRDKRSFIIVTHRILDYIKPDYVHVLYQGRIVKSGDFKQ
2awnA           LVAEPSVFLLDEPLSNLDAALRVQMRSRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLE
2d3wC           AVLEPELCILDESD---DIDALKVVADGVNSLRDKRSFIIVTHRILDYIKPDYVHVLYQGRIVKSGDFKQ
2vf8B           LRRSGTVYVLDEPTTGLPADVERLQRQLVKLVDAGNTVIAVEHKMQVVAASDWVLDIDGGRLVAQGTPAE
2vf8A           LRRSGTVYVLDEPTTGLPADVERLQRQLVKLVDAGNTVIAVEHKMQVVAASDWVLDIDGGRLVAQGTPAE
2vf7C           LRRSGTVYVLDEPTTGLPADVERLQRQLVKLVDAGNTVIAVEHKMQVVAASDWVLDIDGGRLVAQGTPAE
2vf7B           LRRSGTVYVLDEPTTGLPADVERLQRQLVKLVDAGNTVIAVEHKMQVVAASDWVLDIDGGRLVAQGTPAE
2vf7A           LRRSGTVYVLDEPTTGLPADVERLQRQLVKLVDAGNTVIAVEHKMQVVAASDWVLDIDGGRLVAQGTPAE
2r6fB           LHRRSTLYILDEPTTGLHVDDIARLLDVLHRLVDNDTVLVIEHNLDVIKTADYIIDLGPGQIVAVGTPEE
2r6fA           LHRRSTLYILDEPTTGLHVDDIARLLDVLHRLVDNDTVLVIEHNLDVIKTADYIIDLGPGQIVAVGTPEE
2ix3A           VLRNADILLLDEPTNHLD----------------------------------------------------
2iwhB           VLRNADILLLDEPTNHLD----------------------------------------------------
1oxxK           XXKDPSLLLLDEPFSNLDADSARALVKEVQSRLGV-TLLVVSH---------------------------
2ix8A           VLRNADILLLDEPTNHLD----------------------------------------------------
2iw3B           VLRNADILLLDEPTNHLD----------------------------------------------------
2iw3A           VLRNADILLLDEPTNHLD----------------------------------------------------


                         .         .         *         .         .         .         .:840
query           LLAQGGLYAKLVQRQMLGLQPAADFTAGxxxxxxxxxxxx
3g60A           LMREKGIYFKLVMTQTL-----------------------
3g5uA           LMREKGIYFKLVMTQTL-----------------------
2hydA           LIAKQGAYEHLYSIQNL-----------------------
2ixfC           LMERGGCYRSMVE---------------------------
2ixfA           LMERGGCYRSMVE---------------------------
3b60A           LLAQHGVYAQLHKMQ-------------------------
2ixeA           LMERGGCYRSMVE---------------------------
1jj7A           LMEKKGCYWAMVQ---------------------------
2ixgA           LMERGGCYRSMVE---------------------------
1pf4A           ----------------------------------------
2ixfD           LMERGGCYRSMVE---------------------------
2ixeD           LMERGGCYRSMVE---------------------------
1mt0A           ----------------------------------------
2ff7A           ----------------------------------------
2fgkA           ----------------------------------------
2ffbA           ----------------------------------------
3b5jA           ----------------------------------------
1xefA           ----------------------------------------
2ffaA           ----------------------------------------
1z2rA           ----------------------------------------
2ghiA           LLKLNGEYAEMWNMQ-------------------------
1mv5D           LVATHPLYAKYVSEQL------------------------
1mv5A           LVATHPLYAKYVSEQL------------------------
2ghiC           LLKLNGEYAEMWNMQ-------------------------
2ghiB           LLKLNGEYAEMWNMQ-------------------------
2ghiD           LLKLNGEYAEMWNMQ-------------------------
2cbzA           LLARDGAFAEFLR---------------------------
3dhwC           VFS-------------------------------------
2yyzA           V---------------------------------------
2it1B           V---------------------------------------
2it1A           V---------------------------------------
1l2tB           ----------------------------------------
1l2tA           ----------------------------------------
2yz2B           FL--------------------------------------
2yz2A           FL--------------------------------------
1f3oA           ----------------------------------------
1q12A           L---------------------------------------
3fh6A           L---------------------------------------
2awoA           L---------------------------------------
2awnB           L---------------------------------------
3d31A           I---------------------------------------
2r6gB           L---------------------------------------
2r6gA           L---------------------------------------
2awoC           L---------------------------------------
2pcjA           ----------------------------------------
2oukB           L---------------------------------------
2oljA           L---------------------------------------
3gfoA           VFAEKEVIRKV-----------------------------
3fvqB           LYRQ------------------------------------
3fvqA           LYRQ------------------------------------
2onkA           LFAKNGEVAEFLSARNLLLK--------------------
1g6hA           ----------------------------------------
1g9xA           ----------------------------------------
1r0zC           L---------------------------------------
1r0zB           L---------------------------------------
1r0zA           L---------------------------------------
1gajA           ----------------------------------------
1r10A           L---------------------------------------
1q3hA           L---------------------------------------
1r0wC           L---------------------------------------
1q3hB           L---------------------------------------
1r0xB           L---------------------------------------
1r0xA           L---------------------------------------
1q3hD           L---------------------------------------
1q3hC           L---------------------------------------
2awnC           L---------------------------------------
1r0zD           L---------------------------------------
1r0xD           L---------------------------------------
1r0xC           L---------------------------------------
1r0wB           L---------------------------------------
1r0wA           L---------------------------------------
1g291           VGSPDEVYDK----------PANTFVAG------------
2pzgA           L---------------------------------------
2pzeB           L---------------------------------------
2pzeA           L---------------------------------------
1xfaA           L---------------------------------------
1xf9B           L---------------------------------------
1xf9A           L---------------------------------------
1xf9D           L---------------------------------------
1xf9C           L---------------------------------------
2bboA           L---------------------------------------
1oxvA           ----------------------------------------
1oxsC           ----------------------------------------
1xmiE           L---------------------------------------
1xmiC           L---------------------------------------
1xmiA           L---------------------------------------
2pzfB           L---------------------------------------
2pzfA           L---------------------------------------
2d62A           V---------------------------------------
2pzgB           L---------------------------------------
1xmjA           L---------------------------------------
1b0uA           V---------------------------------------
1xmiD           L---------------------------------------
2bbtB           L---------------------------------------
2bbtA           L---------------------------------------
2bbsB           L---------------------------------------
2bbsA           L---------------------------------------
1xmiB           L---------------------------------------
1vplA           L---------------------------------------
1v43A           ----------------------------------------
2ihyB           IL--------------------------------------
2d2fA           ----------------------------------------
1z47B           VYEKPG----------------------------------
1z47A           VYEKPG----------------------------------
2ihyA           IL--------------------------------------
2d2eA           ----------------------------------------
2nq2D           ----------------------------------------
2nq2C           ----------------------------------------
2zu0C           LEEQG-----------------------------------
2d3wA           LEEQG-----------------------------------
1sgwA           ----------------------------------------
1yqtA           ----------------------------------------
3bk7A           ALPPMGM---------------------------------
1ji0A           LL--------------------------------------
2d3wB           LEEQG-----------------------------------
1l7vC           VLTPPNL---------------------------------
2qi9C           VLTPPNL---------------------------------
2d3wD           LEEQG-----------------------------------
2awnA           L---------------------------------------
2d3wC           LEEQG-----------------------------------
2vf8B           VAQAAG----------------------------------
2vf8A           VAQAAG----------------------------------
2vf7C           VAQAAG----------------------------------
2vf7B           VAQAAG----------------------------------
2vf7A           VAQAAG----------------------------------
2r6fB           V---------------------------------------
2r6fA           V---------------------------------------
2ix3A           ----------------------------------------
2iwhB           ----------------------------------------
1oxxK           ----------------------------------------
2ix8A           ----------------------------------------
2iw3B           ----------------------------------------
2iw3A           ----------------------------------------