[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for huge0:KIAA0059

[Show Plain Result]


## Summary of Sequence Search
    1::724
   82::778       0.0 100%  778 aa  ABLM1_HUMAN RecName: Full=Actin-binding LIM protein 1;AltName:
   79::861       0.0  91%  861 aa  ABLM1_MOUSE RecName: Full=Actin-binding LIM protein 1;AltName:
    5::683       0.0  57%  683 aa  ABLM3_HUMAN RecName: Full=Actin-binding LIM protein 3;AltName:
    5::682       0.0  56%  682 aa  ABLM3_MOUSE RecName: Full=Actin-binding LIM protein 3;AltName:
    4::612     e-158  62%  612 aa  ABLM2_RAT RecName: Full=Actin-binding LIM protein 2;AltName:
    4::611     e-158  63%  611 aa  ABLM2_HUMAN RecName: Full=Actin-binding LIM protein 2;AltName:
    4::612     e-158  61%  612 aa  ABLM2_MOUSE RecName: Full=Actin-binding LIM protein 2;AltName:
   30::406     5e-56  47%  406 aa  DEMA_BOVIN RecName: Full=Dematin;AltName: Full=Erythrocyte membrane
   30::405     3e-54  47%  405 aa  DEMA_PONAB RecName: Full=Dematin;AltName: Full=Erythrocyte membrane
   30::405     3e-54  47%  405 aa  DEMA_HUMAN RecName: Full=Dematin;AltName: Full=Erythrocyte membrane
   30::405     8e-48  40%  405 aa  DEMA_MOUSE RecName: Full=Dematin;AltName: Full=Erythrocyte membrane
  166::389     9e-36  33%  413 aa  PXL1_CAEEL RecName: Full=Paxillin homolog 1;
  336::561     7e-31  32%  569 aa  PAXB_DICDI RecName: Full=Paxillin-B;
  358::571     3e-30  32%  591 aa  PAXI_PONAB RecName: Full=Paxillin;
  358::571     3e-30  32%  591 aa  PAXI_HUMAN RecName: Full=Paxillin;
  326::539     3e-30  32%  559 aa  PAXI_CHICK RecName: Full=Paxillin;
  353::566     3e-30  32%  586 aa  PAXI_RAT RecName: Full=Paxillin;
  358::571     3e-30  32%  591 aa  PAXI_MOUSE RecName: Full=Paxillin;
  148::365     3e-30  31%  386 aa  LPXN_HUMAN RecName: Full=Leupaxin;
  273::486     4e-30  32%  506 aa  TGFI1_XENLA RecName: Full=Transforming growth factor beta-1-induced
  148::365     2e-28  31%  386 aa  LPXN_MOUSE RecName: Full=Leupaxin;
   57::278     2e-27  33%  280 aa  FHL3_BOVIN RecName: Full=Four and a half LIM domains protein 3;    
   76::291     3e-27  34%  341 aa  LIMS2_HUMAN RecName: Full=LIM and senescent cell
   76::291     3e-27  34%  341 aa  LIMS2_BOVIN RecName: Full=LIM and senescent cell
  228::454     3e-27  30%  461 aa  TGFI1_HUMAN RecName: Full=Transforming growth factor beta-1-induced
  223::449     5e-27  30%  456 aa  TGFI1_BOVIN RecName: Full=Transforming growth factor beta-1-induced
   57::278     6e-27  33%  280 aa  FHL3_HUMAN RecName: Full=Four and a half LIM domains protein 3;    
   57::287     1e-26  33%  289 aa  FHL3_MOUSE RecName: Full=Four and a half LIM domains protein 3;    
   40::275     2e-26  29%  279 aa  FHL2_RAT RecName: Full=Four and a half LIM domains protein 2;      
   36::291     5e-26  38%  341 aa  LIMS2_MOUSE RecName: Full=LIM and senescent cell
   40::275     7e-26  29%  279 aa  FHL2_MOUSE RecName: Full=Four and a half LIM domains protein 2;    
   40::276     2e-25  31%  280 aa  FHL1_RAT RecName: Full=Four and a half LIM domains protein 1;      
   40::276     2e-25  31%  280 aa  FHL1_MOUSE RecName: Full=Four and a half LIM domains protein 1;    
   47::286     6e-25  36%  325 aa  LIMS1_MOUSE RecName: Full=LIM and senescent cell
   47::286     1e-24  35%  325 aa  LIMS1_HUMAN RecName: Full=LIM and senescent cell
   82::304     2e-24  31%  348 aa  UNC97_CAEEL RecName: Full=LIM domain-containing protein
   40::283     2e-24  30%  284 aa  FHL5_RAT RecName: Full=Four and a half LIM domains protein 5;      
   40::275     2e-24  30%  279 aa  FHL2_HUMAN RecName: Full=Four and a half LIM domains protein 2;    
   40::256     3e-24  31%  284 aa  FHL5_MOUSE RecName: Full=Four and a half LIM domains protein 5;    
  228::441     5e-24  30%  461 aa  TGFI1_RAT RecName: Full=Transforming growth factor beta-1-induced
   40::275     5e-24  31%  279 aa  FHL2_BOVIN RecName: Full=Four and a half LIM domains protein 2;    
   40::283     8e-24  29%  284 aa  FHL5_BOVIN RecName: Full=Four and a half LIM domains protein 5;    
  227::409     1e-23  35%  416 aa  PDLI7_CHICK RecName: Full=PDZ and LIM domain protein 7;AltName:
  282::441     3e-23  36%  457 aa  PDLI7_MOUSE RecName: Full=PDZ and LIM domain protein 7;AltName:
    8::123     3e-23  43%  662 aa  LIMK1_CHICK RecName: Full=LIM domain kinase 1;       
   40::283     3e-23  28%  284 aa  FHL5_HUMAN RecName: Full=Four and a half LIM domains protein 5;    
   40::274     4e-23  30%  284 aa  FHL5_MACFA RecName: Full=Four and a half LIM domains protein 5;    
  246::405     5e-23  36%  421 aa  PDLI7_XENLA RecName: Full=PDZ and LIM domain protein 7;
    1::124     5e-23  41%  642 aa  LIMK2_CHICK RecName: Full=LIM domain kinase 2;       
  282::441     1e-22  35%  457 aa  PDLI7_RAT RecName: Full=PDZ and LIM domain protein 7;AltName:
  249::408     1e-22  35%  424 aa  PDLI7_BOVIN RecName: Full=PDZ and LIM domain protein 7;
   81::295     2e-22  31%  329 aa  PIN2_CAEEL RecName: Full=LIM domain-containing protein pin-2;
  244::403     3e-22  36%  419 aa  PDLI7_DANRE RecName: Full=PDZ and LIM domain protein 7;
  405::584     4e-22  33%  591 aa  PDLI5_RAT RecName: Full=PDZ and LIM domain protein 5;AltName:
  282::441     6e-22  34%  457 aa  PDLI7_HUMAN RecName: Full=PDZ and LIM domain protein 7;AltName:
  415::574     7e-22  38%  591 aa  PDLI5_MOUSE RecName: Full=PDZ and LIM domain protein 5;AltName:
  420::579     7e-22  38%  596 aa  PDLI5_HUMAN RecName: Full=PDZ and LIM domain protein 5;AltName:
   26::123     1e-21  45%  615 aa  LIMK1_XENLA RecName: Full=LIM domain kinase 1;       
   40::231     1e-21  32%  323 aa  FHL1_HUMAN RecName: Full=Four and a half LIM domains protein 1;    
   25::122     3e-21  42%  647 aa  LIMK1_MOUSE RecName: Full=LIM domain kinase 1;       
   25::122     5e-21  42%  647 aa  LIMK1_HUMAN RecName: Full=LIM domain kinase 1;       
   25::122     2e-20  40%  647 aa  LIMK1_RAT RecName: Full=LIM domain kinase 1;         Short=LIMK-1; 
  551::720     2e-20  32%  727 aa  LDB3_HUMAN RecName: Full=LIM domain-binding protein 3;AltName:
  207::423     4e-20  30%  553 aa  LIMB_DICDI RecName: Full=LIM domain-containing protein B;AltName:
   12::142     5e-20  39%  638 aa  LIMK2_RAT RecName: Full=LIM domain kinase 2;         Short=LIMK-2; 
  439::607     7e-20  36%  648 aa  WTIP_DANRE RecName: Full=Wilms tumor protein 1-interacting protein
   12::142     7e-20  39%  638 aa  LIMK2_BOVIN RecName: Full=LIM domain kinase 2;       
   12::142     9e-20  39%  638 aa  LIMK2_HUMAN RecName: Full=LIM domain kinase 2;       
  547::716     9e-20  31%  723 aa  LDB3_MOUSE RecName: Full=LIM domain-binding protein 3;AltName:
   12::142     1e-19  39%  638 aa  LIMK2_MOUSE RecName: Full=LIM domain kinase 2;       
  364::558     2e-19  33%  564 aa  ZYX_MOUSE RecName: Full=Zyxin;
  384::566     3e-19  36%  572 aa  ZYX_HUMAN RecName: Full=Zyxin;AltName: Full=Zyxin-2;
  242::425     3e-19  29%  438 aa  YOCC_SCHPO RecName: Full=LIM domain-containing protein C4F6.12;
   16::163     3e-19  38%  390 aa  LHX4_MOUSE RecName: Full=LIM/homeobox protein Lhx4;       
   16::163     3e-19  38%  390 aa  LHX4_HUMAN RecName: Full=LIM/homeobox protein Lhx4;       
  228::441     5e-19  26%  461 aa  TGFI1_MOUSE RecName: Full=Transforming growth factor beta-1-induced
  188::366     6e-19  34%  375 aa  FBLI1_PONAB RecName: Full=Filamin-binding LIM protein 1;       
  191::369     6e-19  34%  378 aa  FBLI1_BOVIN RecName: Full=Filamin-binding LIM protein 1;       
  449::617     1e-18  32%  654 aa  WTIP_HUMAN RecName: Full=Wilms tumor protein 1-interacting protein;
  186::364     1e-18  35%  373 aa  FBLI1_HUMAN RecName: Full=Filamin-binding LIM protein 1;       
   49::136     1e-18  41% 1257 aa  LIMK1_DROME RecName: Full=LIM domain kinase 1;       
  481::649     2e-18  34%  690 aa  WTIP_XENLA RecName: Full=Wilms tumor protein 1-interacting protein
  185::366     2e-18  34%  375 aa  FBLI1_MOUSE RecName: Full=Filamin-binding LIM protein 1;       
  375::609     3e-18  33%  686 aa  LIMCH_DICDI RecName: Full=Calponin homology and LIM
  455::650     4e-18  32%  668 aa  LIMD1_MOUSE RecName: Full=LIM domain-containing protein 1;
  463::658     4e-18  32%  676 aa  LIMD1_HUMAN RecName: Full=LIM domain-containing protein 1;
    9::180     5e-18  32%  186 aa  Y6787_DICDI RecName: Full=LIM domain-containing protein
    3::106     5e-18  39%  406 aa  LHX1_SAIBB RecName: Full=LIM/homeobox protein Lhx1;       
    3::106     5e-18  39%  406 aa  LHX1_RAT RecName: Full=LIM/homeobox protein Lhx1;         Short=LIM
    3::106     5e-18  39%  406 aa  LHX1_PANTR RecName: Full=LIM/homeobox protein Lhx1;       
    3::106     5e-18  39%  406 aa  LHX1_MOUSE RecName: Full=LIM/homeobox protein Lhx1;       
    3::106     5e-18  39%  406 aa  LHX1_MESAU RecName: Full=LIM/homeobox protein Lhx1;       
    3::106     5e-18  39%  406 aa  LHX1_HUMAN RecName: Full=LIM/homeobox protein Lhx1;       
    3::106     5e-18  39%  405 aa  LHX1_DANRE RecName: Full=LIM/homeobox protein Lhx1;       
    3::106     5e-18  39%  406 aa  LHX1_CHICK RecName: Full=LIM/homeobox protein Lhx1;       
  193::361     7e-18  32%  398 aa  WTIP_MOUSE RecName: Full=Wilms tumor protein 1-interacting protein;
    3::106     7e-18  39%  403 aa  LHX1_XENLA RecName: Full=LIM/homeobox protein Lhx1;       
  428::617     1e-17  31%  632 aa  LPP_RAT RecName: Full=Lipoma-preferred partner homolog;
    3::125     1e-17  42%  145 aa  LMO3_PONAB RecName: Full=LIM domain only protein 3;
    3::125     1e-17  42%  145 aa  LMO3_MOUSE RecName: Full=LIM domain only protein 3;AltName:
    3::125     1e-17  42%  145 aa  LMO3_HUMAN RecName: Full=LIM domain only protein 3;AltName:
    3::125     1e-17  42%  145 aa  LMO3_BOVIN RecName: Full=LIM domain only protein 3;
    4::107     1e-17  38%  402 aa  LHX5_RAT RecName: Full=LIM/homeobox protein Lhx5;         Short=LIM
    4::107     1e-17  38%  402 aa  LHX5_MOUSE RecName: Full=LIM/homeobox protein Lhx5;       
    4::107     1e-17  38%  402 aa  LHX5_HUMAN RecName: Full=LIM/homeobox protein Lhx5;       
    4::107     1e-17  40%  399 aa  LHX5_DANRE RecName: Full=LIM/homeobox protein Lhx5;       
   14::133     2e-17  37%  363 aa  ISL3_ONCTS RecName: Full=Insulin gene enhancer protein ISL-3;      
    9::115     2e-17  40%  340 aa  ISL2B_ONCTS RecName: Full=Insulin gene enhancer protein ISL-2B;    
  409::598     2e-17  31%  613 aa  LPP_MOUSE RecName: Full=Lipoma-preferred partner homolog;
  348::516     2e-17  29%  548 aa  JUB_RAT RecName: Full=Protein ajuba;
  347::515     2e-17  29%  547 aa  JUB_MOUSE RecName: Full=Protein ajuba;
  338::506     2e-17  29%  538 aa  JUB_HUMAN RecName: Full=Protein ajuba;
   14::136     3e-17  41%  156 aa  LMO3_XENLA RecName: Full=LIM domain only protein 3;       
    3::125     3e-17  41%  145 aa  LMO3_DANRE RecName: Full=LIM domain only protein 3;
    3::107     3e-17  38%  402 aa  LHX5_XENLA RecName: Full=LIM/homeobox protein Lhx5;       
   14::133     3e-17  37%  360 aa  ISL2_RAT RecName: Full=Insulin gene enhancer protein ISL-2;        
   14::133     3e-17  37%  359 aa  ISL2_MOUSE RecName: Full=Insulin gene enhancer protein ISL-2;      
   14::133     3e-17  37%  359 aa  ISL2_HUMAN RecName: Full=Insulin gene enhancer protein ISL-2;      
   14::133     3e-17  37%  358 aa  ISL2A_ONCTS RecName: Full=Insulin gene enhancer protein ISL-2A;    
   24::136     6e-17  43%  156 aa  RBTN1_XENLA RecName: Full=Rhombotin-1;AltName: Full=LIM domain only
   24::136     6e-17  43%  156 aa  RBTN1_MOUSE RecName: Full=Rhombotin-1;AltName: Full=LIM domain only
   24::136     6e-17  43%  156 aa  RBTN1_HUMAN RecName: Full=Rhombotin-1;AltName: Full=LIM domain only
   23::135     6e-17  43%  155 aa  RBTN1_DANRE RecName: Full=Rhombotin-1;AltName: Full=LIM domain only
   13::125     6e-17  43%  145 aa  LMO3_RAT RecName: Full=LIM domain only protein 3;AltName:
    9::130     6e-17  38%  395 aa  LHX3_CHICK RecName: Full=LIM/homeobox protein Lhx3;       
   14::133     6e-17  37%  359 aa  ISL2A_DANRE RecName: Full=Insulin gene enhancer protein
    4::123     6e-17  36%  349 aa  ISL1_DANRE RecName: Full=Insulin gene enhancer protein isl-1;      
    4::123     6e-17  37%  349 aa  ISL1_CHICK RecName: Full=Insulin gene enhancer protein ISL-1;      
   28::130     9e-17  40%  398 aa  LHX3_DANRE RecName: Full=LIM/homeobox protein Lhx3;       
    4::123     9e-17  36%  349 aa  ISL1_RAT RecName: Full=Insulin gene enhancer protein ISL-1;        
    4::123     9e-17  36%  349 aa  ISL1_MOUSE RecName: Full=Insulin gene enhancer protein ISL-1;      
    4::123     9e-17  36%  349 aa  ISL1_MESAU RecName: Full=Insulin gene enhancer protein ISL-1;      
    4::123     9e-17  36%  349 aa  ISL1_HUMAN RecName: Full=Insulin gene enhancer protein ISL-1;      
   14::129     1e-16  37%  358 aa  ISL2B_DANRE RecName: Full=Insulin gene enhancer protein
   24::136     2e-16  42%  156 aa  RBTN1_BOVIN RecName: Full=Rhombotin-1;AltName: Full=LIM domain only
  400::589     2e-16  32%  604 aa  LPP_CHICK RecName: Full=Lipoma-preferred partner homolog;
   75::205     3e-16  35%  356 aa  LHX8_HUMAN RecName: Full=LIM/homeobox protein Lhx8;       
  408::597     4e-16  30%  612 aa  LPP_HUMAN RecName: Full=Lipoma-preferred partner;AltName: Full=LIM
  485::654     5e-16  32%  663 aa  ZYX_XENLA RecName: Full=Zyxin;
   96::226     5e-16  35%  367 aa  LHX8_MOUSE RecName: Full=LIM/homeobox protein Lhx8;       
   28::130     6e-16  39%  395 aa  LHX3_XENLA RecName: Full=LIM/homeobox protein Lhx3;       
   31::133     6e-16  40%  397 aa  LHX3_HUMAN RecName: Full=LIM/homeobox protein Lhx3;       
  496::665     8e-16  30%  674 aa  ZYX_XENTR RecName: Full=Zyxin;
  156::418     8e-16  32%  422 aa  TES_XENTR RecName: Full=Testin;
   62::173     8e-16  40%  388 aa  LHX9_RAT RecName: Full=LIM/homeobox protein Lhx9;         Short=LIM
   71::182     8e-16  40%  397 aa  LHX9_MOUSE RecName: Full=LIM/homeobox protein Lhx9;       
   71::182     8e-16  40%  397 aa  LHX9_HUMAN RecName: Full=LIM/homeobox protein Lhx9;       
   16::118     8e-16  40%  383 aa  LHX3_PIG RecName: Full=LIM/homeobox protein Lhx3;         Short=LIM
   34::136     8e-16  40%  400 aa  LHX3_MOUSE RecName: Full=LIM/homeobox protein Lhx3;       
   71::182     1e-15  40%  397 aa  LHX9_BOVIN RecName: Full=LIM/homeobox protein Lhx9;       
   53::164     1e-15  39%  406 aa  LHX2_MOUSE RecName: Full=LIM/homeobox protein Lhx2;       
   53::164     1e-15  39%  406 aa  LHX2_HUMAN RecName: Full=LIM/homeobox protein Lhx2;       
  336::534     1e-15  31%  542 aa  ZYX_CHICK RecName: Full=Zyxin;
   70::200     1e-15  34%  363 aa  LHX6_MOUSE RecName: Full=LIM/homeobox protein Lhx6;       
   70::200     1e-15  34%  363 aa  LHX6_HUMAN RecName: Full=LIM/homeobox protein Lhx6;       
  131::250     1e-15  38%  469 aa  APTE_DROME RecName: Full=Protein apterous;
   52::163     2e-15  39%  426 aa  LHX2_RAT RecName: Full=LIM/homeobox protein Lhx2;         Short=LIM
    5::57      2e-15  33% 1183 aa  LIMA_DICDI RecName: Full=LIM domain-containing protein A;
   32::163     3e-15  39%  377 aa  LHX9_ASTFA RecName: Full=LIM/homeobox protein Lhx9;       
  119::304     5e-15  31%  833 aa  PRIC1_XENTR RecName: Full=Prickle-like protein 1;
    8::96      5e-15  39%  319 aa  ISL2_CHICK RecName: Full=Insulin gene enhancer protein ISL-2;      
  276::434     9e-15  34%  916 aa  PRIC1_AEDAE RecName: Full=Protein prickle;
  119::304     1e-14  31%  832 aa  PRI1B_XENLA RecName: Full=Prickle-like protein 1-B;AltName:
    7::134     2e-14  42%  165 aa  LMO42_XENTR RecName: Full=LIM domain transcription factor
   33::136     2e-14  35%  377 aa  LMX1B_CHICK RecName: Full=LIM/homeobox protein LMX-1.2;       
   46::164     2e-14  37%  379 aa  LHX9_RANRU RecName: Full=LIM/homeobox protein Lhx9;       
  617::782     3e-14  32% 1299 aa  PRIC1_DROME RecName: Full=Protein prickle;AltName: Full=Protein
  119::304     3e-14  31%  835 aa  PRI1A_XENLA RecName: Full=Prickle-like protein 1-A;AltName:
   33::136     3e-14  34%  372 aa  LMX1B_MOUSE RecName: Full=LIM homeobox transcription factor
   23::126     3e-14  34%  369 aa  LMX1B_MESAU RecName: Full=LIM homeobox transcription factor
   33::136     3e-14  34%  379 aa  LMX1B_HUMAN RecName: Full=LIM homeobox transcription factor
    8::175     3e-14  27%  197 aa  LIMF_DICDI RecName: Full=LIM domain-containing protein F;
    7::134     3e-14  42%  165 aa  LMO4_MOUSE RecName: Full=LIM domain transcription factor
    7::134     3e-14  42%  165 aa  LMO4_HUMAN RecName: Full=LIM domain transcription factor
    7::134     3e-14  42%  165 aa  LMO4_BOVIN RecName: Full=LIM domain transcription factor
    6::137     3e-14  38%  171 aa  LMO4A_XENLA RecName: Full=LIM domain transcription factor
  650::815     4e-14  33% 1353 aa  PRIC1_DROPS RecName: Full=Protein prickle;
  244::450     4e-14  31%  795 aa  ESN_DROPS RecName: Full=Protein espinas;
  259::418     6e-14  33%  421 aa  TES_RABIT RecName: Full=Testin;
   33::154     6e-14  35%  382 aa  LMX1A_HUMAN RecName: Full=LIM homeobox transcription factor
  244::450     6e-14  31%  785 aa  ESN_DROME RecName: Full=Protein espinas;
  304::435     8e-14  35%  480 aa  TRIP6_MOUSE RecName: Full=Thyroid receptor-interacting protein 6;  
  116::267     8e-14  32% 1150 aa  RGA1_SCHPO RecName: Full=Rho-type GTPase-activating protein 1;
  384::542     8e-14  33%  923 aa  PRIC1_ANOGA RecName: Full=Protein prickle;
   55::203     8e-14  29%  405 aa  LIN11_CAEEL RecName: Full=Protein lin-11;AltName: Full=Abnormal
  282::384     8e-14  35%  514 aa  LIM_HALRO RecName: Full=LIM/homeobox protein LIM;       
  259::418     1e-13  31%  421 aa  TES_AOTNA RecName: Full=Testin;
  125::290     1e-13  32%  845 aa  PRIC2_MOUSE RecName: Full=Prickle-like protein 2;
   64::183     1e-13  34%  331 aa  LHX9_XENLA RecName: Full=LIM/homeobox protein Lhx9;       
  259::418     1e-13  30%  421 aa  TES_SAIBB RecName: Full=Testin;
  259::418     1e-13  31%  421 aa  TES_PIG RecName: Full=Testin;
  259::418     1e-13  31%  421 aa  TES_CALMO RecName: Full=Testin;
  259::418     1e-13  31%  421 aa  TES_ATEGE RecName: Full=Testin;
   24::137     1e-13  37%  171 aa  LMO4B_XENLA RecName: Full=LIM domain transcription factor
  125::290     2e-13  32%  844 aa  PRIC2_HUMAN RecName: Full=Prickle-like protein 2;
  305::436     2e-13  34%  481 aa  TRIP6_BOVIN RecName: Full=Thyroid receptor-interacting protein 6;  
  259::418     2e-13  32%  422 aa  TES_XENLA RecName: Full=Testin;AltName: Full=Xtes;
  259::418     2e-13  30%  421 aa  TES_PAPAN RecName: Full=Testin;
  259::418     2e-13  32%  421 aa  TES_OTOGA RecName: Full=Testin;
  259::418     2e-13  31%  421 aa  TES_NEONE RecName: Full=Testin;
  259::418     2e-13  31%  421 aa  TES_MUNRE RecName: Full=Testin;
  259::418     2e-13  31%  421 aa  TES_MUNMU RecName: Full=Testin;
  259::418     2e-13  31%  421 aa  TES_FELCA RecName: Full=Testin;
  259::418     2e-13  31%  421 aa  TES_EULMM RecName: Full=Testin;
  218::418     2e-13  31%  421 aa  TES_DASNO RecName: Full=Testin;
  259::418     2e-13  30%  421 aa  TES_CERAE RecName: Full=Testin;
  189::418     2e-13  29%  421 aa  TES_ATEAB RecName: Full=Testin;
   33::154     2e-13  34%  382 aa  LMX1A_MOUSE RecName: Full=LIM homeobox transcription factor
   33::154     2e-13  34%  382 aa  LMX1A_MESAU RecName: Full=LIM homeobox transcription factor
  259::418     3e-13  31%  421 aa  TES_LOXAF RecName: Full=Testin;
  300::431     4e-13  37%  476 aa  TRIP6_HUMAN RecName: Full=Thyroid receptor-interacting protein 6;  
  259::418     4e-13  31%  421 aa  TES_SHEEP RecName: Full=Testin;
  259::418     4e-13  30%  421 aa  TES_PONAB RecName: Full=Testin;
  259::418     4e-13  30%  421 aa  TES_PANTR RecName: Full=Testin;
  259::418     4e-13  30%  421 aa  TES_HYLLE RecName: Full=Testin;
  259::418     4e-13  30%  421 aa  TES_HUMAN RecName: Full=Testin;AltName: Full=TESS;
  259::418     4e-13  31%  421 aa  TES_HORSE RecName: Full=Testin;
  259::418     4e-13  30%  421 aa  TES_COLGU RecName: Full=Testin;
  259::418     4e-13  31%  421 aa  TES_CANFA RecName: Full=Testin;
  259::418     5e-13  30%  421 aa  TES_MUSPF RecName: Full=Testin;
  259::418     5e-13  31%  422 aa  TES_MONDO RecName: Full=Testin;
  259::418     5e-13  30%  421 aa  TES_CALJA RecName: Full=Testin;
  119::304     6e-13  29%  832 aa  PRIC1_MOUSE RecName: Full=Prickle-like protein 1;
  119::304     6e-13  29%  831 aa  PRIC1_HUMAN RecName: Full=Prickle-like protein 1;AltName:
  259::418     1e-12  30%  421 aa  TES_MICMU RecName: Full=Testin;
   12::145     1e-12  34%  158 aa  RBTN2_MOUSE RecName: Full=Rhombotin-2;AltName: Full=LIM domain only
   12::145     1e-12  34%  158 aa  RBTN2_HUMAN RecName: Full=Rhombotin-2;AltName: Full=LIM domain only
   12::145     1e-12  34%  158 aa  RBTN2_BOVIN RecName: Full=Rhombotin-2;AltName: Full=LIM domain only
  259::418     2e-12  31%  421 aa  TES_BOVIN RecName: Full=Testin;
    5::184     2e-12  32%  217 aa  CRIP3_HUMAN RecName: Full=Cysteine-rich protein 3;       
   43::145     3e-12  34%  158 aa  RBTN2_XENTR RecName: Full=Rhombotin-2;AltName: Full=LIM domain only
   43::145     3e-12  34%  158 aa  RBTN2_XENLA RecName: Full=Rhombotin-2;AltName: Full=LIM domain only
  257::416     4e-12  31%  419 aa  TES_RAT RecName: Full=Testin;
  261::420     4e-12  31%  423 aa  TES_MOUSE RecName: Full=Testin;AltName: Full=TES1/TES2;
   43::145     4e-12  34%  159 aa  RBTN2_DANRE RecName: Full=Rhombotin-2;AltName: Full=LIM domain only
   16::254     5e-12  31%  281 aa  LIMG_DICDI RecName: Full=LIM domain-containing protein G;
    7::178     5e-12  33%  193 aa  CSRP2_RAT RecName: Full=Cysteine and glycine-rich protein 2;       
    5::186     5e-12  33%  208 aa  CRIP2_PONAB RecName: Full=Cysteine-rich protein 2;
  126::304     7e-12  29%  831 aa  PRIC1_RAT RecName: Full=Prickle-like protein 1;AltName:
    3::186     7e-12  36%  208 aa  CRIP2_HUMAN RecName: Full=Cysteine-rich protein 2;       
  259::418     9e-12  31%  422 aa  TES_CHICK RecName: Full=Testin;
  259::372     2e-11  36%  421 aa  TES_RHIFE RecName: Full=Testin;
    7::178     2e-11  33%  193 aa  CSRP2_MOUSE RecName: Full=Cysteine and glycine-rich protein 2;     
    3::186     2e-11  36%  208 aa  CRIP2_BOVIN RecName: Full=Cysteine-rich protein 2;
    7::178     3e-11  33%  193 aa  CSRP2_HUMAN RecName: Full=Cysteine and glycine-rich protein 2;     
    7::178     3e-11  33%  193 aa  CSRP2_BOVIN RecName: Full=Cysteine and glycine-rich protein 2;     
  183::344     8e-11  33%  615 aa  PRIC3_HUMAN RecName: Full=Prickle-like protein 3;AltName: Full=LIM
    9::177     8e-11  32%  194 aa  CSRP3_MOUSE RecName: Full=Cysteine and glycine-rich protein 3;     
    3::186     8e-11  35%  208 aa  CRIP2_MOUSE RecName: Full=Cysteine-rich protein 2;       
    7::179     1e-10  34%  194 aa  CSRP2_COTJA RecName: Full=Cysteine and glycine-rich protein 2;     
    9::177     1e-10  32%  194 aa  CSRP3_RAT RecName: Full=Cysteine and glycine-rich protein 3;       
    9::177     1e-10  30%  194 aa  CSRP3_BOVIN RecName: Full=Cysteine and glycine-rich protein 3;     
    3::186     1e-10  36%  208 aa  CRIP2_RAT RecName: Full=Cysteine-rich protein 2;       
   16::146     2e-10  30%  351 aa  HM14_CAEEL RecName: Full=Homeobox protein ceh-14;
    9::177     2e-10  30%  194 aa  CSRP3_HUMAN RecName: Full=Cysteine and glycine-rich protein 3;     
    7::179     2e-10  33%  194 aa  CSRP2_CHICK RecName: Full=Cysteine and glycine-rich protein 2;     
   29::131     3e-10  34%  318 aa  MEC3_CAEBR RecName: Full=Mechanosensory protein 3;
    8::141     3e-10  32%  275 aa  AWH_DROME RecName: Full=LIM/homeobox protein Awh;AltName:
   48::157     5e-10  40%  396 aa  LHX9_DANRE RecName: Full=LIM/homeobox protein Lhx9;       
  160::277     9e-10  32%  532 aa  Y1927_ARATH RecName: Full=LIM and UIM domain-containing At1g19270;
  556::656     1e-09  40%  706 aa  PXL1_YEAST RecName: Full=Paxillin-like protein 1;
  183::333     1e-09  32%  624 aa  PRIC3_MOUSE RecName: Full=Prickle-like protein 3;AltName: Full=LIM
   18::97      1e-09  36%  650 aa  LIMK_DICDI RecName: Full=Probable LIM domain-containing
  111::169     1e-09  38%  182 aa  LIMC_DICDI RecName: Full=LIM domain-containing protein C;
   71::157     3e-09  40%  397 aa  LHX9_CHICK RecName: Full=LIM/homeobox protein Lhx9;       
   29::131     4e-09  32%  320 aa  MEC3_CAERE RecName: Full=Mechanosensory protein 3;
  301::518     6e-09  30%  688 aa  ZN420_HUMAN RecName: Full=Zinc finger protein 420;
    4::64      7e-09  39%   77 aa  CRIP1_RAT RecName: Full=Cysteine-rich protein 1;AltName:
    4::64      7e-09  39%   77 aa  CRIP1_MOUSE RecName: Full=Cysteine-rich protein 1;AltName:
    4::64      7e-09  39%   77 aa  CRIP1_HUMAN RecName: Full=Cysteine-rich protein 1;AltName:
    4::64      7e-09  39%   77 aa  CRIP1_BOVIN RecName: Full=Cysteine-rich protein 1;
   41::131     1e-08  32%  321 aa  MEC3_CAEEL RecName: Full=Mechanosensory protein 3;
  217::482     1e-08  31%  609 aa  ZN571_HUMAN RecName: Full=Zinc finger protein 571;
   46::450     1e-08  38% 1017 aa  LRG1_YEAST RecName: Full=Rho-GTPase-activating protein
  216::481     2e-08  31%  608 aa  ZN571_PONAB RecName: Full=Zinc finger protein 571;
  759::826     2e-08  41%  826 aa  VILI_CHICK RecName: Full=Villin-1;
    7::171     2e-08  30%  193 aa  CSRP1_RAT RecName: Full=Cysteine and glycine-rich protein 1;       
    7::171     2e-08  30%  193 aa  CSRP1_MOUSE RecName: Full=Cysteine and glycine-rich protein 1;     
    7::171     2e-08  30%  193 aa  CSRP1_HUMAN RecName: Full=Cysteine and glycine-rich protein 1;     
    7::171     2e-08  30%  193 aa  CSRP1_BOVIN RecName: Full=Cysteine and glycine-rich protein 1;     
  185::451     2e-08  30%  462 aa  YS029_HUMAN RecName: Full=Putative zinc finger protein
   19::141     2e-08  31%  969 aa  RGA3_SCHPO RecName: Full=Probable Rho-type GTPase-activating
   42::139     2e-08  29%  167 aa  LMO41_XENTR RecName: Full=LIM domain transcription factor
    7::171     2e-08  30%  193 aa  CSRP1_PONAB RecName: Full=Cysteine and glycine-rich protein 1;     
    7::170     2e-08  30%  192 aa  CSRP1_COTJA RecName: Full=Cysteine and glycine-rich protein 1;     
    7::170     2e-08  30%  192 aa  CSRP1_CHICK RecName: Full=Cysteine and glycine-rich protein 1;     
  217::458     3e-08  32%  495 aa  MLP2_DROME RecName: Full=Muscle LIM protein Mlp84B;
  264::363     3e-08  31%  363 aa  LMCD1_PIG RecName: Full=LIM and cysteine-rich domains protein 1;
  265::365     3e-08  29%  365 aa  LMCD1_HUMAN RecName: Full=LIM and cysteine-rich domains protein
  292::537     4e-08  27%  634 aa  ZFP59_MOUSE RecName: Full=Zinc finger protein 59;       
  266::365     4e-08  30%  365 aa  LMCD1_MOUSE RecName: Full=LIM and cysteine-rich domains protein 1;
  296::508     6e-08  27%  604 aa  ZSC12_PONPY RecName: Full=Zinc finger and SCAN domain-containing
  296::508     6e-08  27%  604 aa  ZSC12_MACNE RecName: Full=Zinc finger and SCAN domain-containing
   84::200     6e-08  29%  344 aa  PRIC4_HUMAN RecName: Full=Prickle-like protein 4;AltName:
  296::508     1e-07  27%  604 aa  ZSC12_PANTR RecName: Full=Zinc finger and SCAN domain-containing
  237::292     1e-07  36%  315 aa  PDLI3_CHICK RecName: Full=PDZ and LIM domain protein 3;AltName:
  264::363     1e-07  30%  363 aa  LMCD1_BOVIN RecName: Full=LIM and cysteine-rich domains protein 1;
  296::508     1e-07  27%  604 aa  ZSC12_PANPA RecName: Full=Zinc finger and SCAN domain-containing
  296::508     1e-07  27%  604 aa  ZSC12_HUMAN RecName: Full=Zinc finger and SCAN domain-containing
  296::508     1e-07  27%  604 aa  ZSC12_GORGO RecName: Full=Zinc finger and SCAN domain-containing
  235::508     1e-07  26%  524 aa  ZN479_HUMAN RecName: Full=Zinc finger protein 479;AltName:
  193::434     1e-07  26%  474 aa  ZN141_HUMAN RecName: Full=Zinc finger protein 141;
  262::507     2e-07  26%  559 aa  ZN734_HUMAN RecName: Full=Zinc finger protein 734;
  140::434     2e-07  29%  487 aa  ZN345_BOVIN RecName: Full=Zinc finger protein 345;
  257::480     2e-07  28%  483 aa  ZN774_HUMAN RecName: Full=Zinc finger protein 774;
  262::506     2e-07  26%  522 aa  ZN733_HUMAN RecName: Full=Zinc finger protein 733;
  377::629     3e-07  31%  660 aa  ZN540_HUMAN RecName: Full=Zinc finger protein 540;
  292::341     3e-07  38%  362 aa  PDLI3_RAT RecName: Full=PDZ and LIM domain protein 3;AltName:
  261::506     4e-07  32%  654 aa  ZN283_MACFA RecName: Full=Zinc finger protein 283;
  766::827     4e-07  40%  827 aa  VILI_HUMAN RecName: Full=Villin-1;
  295::342     4e-07  40%  365 aa  PDLI3_PIG RecName: Full=PDZ and LIM domain protein 3;AltName:
  246::293     4e-07  40%  316 aa  PDLI3_MOUSE RecName: Full=PDZ and LIM domain protein 3;AltName:
  246::293     4e-07  40%  316 aa  PDLI3_BOVIN RecName: Full=PDZ and LIM domain protein 3;
    2::59      4e-07  44%  335 aa  LASP1_CAEEL RecName: Full=LIM and SH3 domain protein F42H10.3;
  570::807     5e-07  27%  807 aa  ZN594_HUMAN RecName: Full=Zinc finger protein 594;AltName:
  294::341     5e-07  40%  364 aa  PDLI3_HUMAN RecName: Full=PDZ and LIM domain protein 3;AltName:
  751::819     5e-07  38%  819 aa  AVIL_MOUSE RecName: Full=Advillin;AltName: Full=p92;AltName:
  532::792     7e-07  27%  898 aa  ZO71_XENLA RecName: Full=Oocyte zinc finger protein XlCOF7.1;Flags:
  365::605     9e-07  28%  730 aa  ZN615_PONAB RecName: Full=Zinc finger protein 615;
  916::974     9e-07  39%  974 aa  VILI4_ARATH RecName: Full=Villin-4;
    4::57      9e-07  38%  263 aa  LASP1_MOUSE RecName: Full=LIM and SH3 domain protein 1;       
  352::598     1e-06  26%  661 aa  ZNF81_HUMAN RecName: Full=Zinc finger protein 81;AltName:
  366::606     1e-06  28%  731 aa  ZN615_HUMAN RecName: Full=Zinc finger protein 615;
  306::528     1e-06  29%  648 aa  ZN595_HUMAN RecName: Full=Zinc finger protein 595;
  377::629     1e-06  30%  660 aa  ZN540_PONAB RecName: Full=Zinc finger protein 540;
    2::63      1e-06  37%  243 aa  CRIP3_MOUSE RecName: Full=Cysteine-rich protein 3;       
  240::537     2e-06  33%  936 aa  ZN836_HUMAN RecName: Full=Zinc finger protein 836;
  430::669     2e-06  29%  743 aa  ZN267_HUMAN RecName: Full=Zinc finger protein 267;AltName:
    4::57      2e-06  38%  263 aa  LASP1_RAT RecName: Full=LIM and SH3 domain protein 1;       
    4::57      2e-06  38%  263 aa  LASP1_RABIT RecName: Full=LIM and SH3 domain protein 1;       
    4::57      2e-06  38%  261 aa  LASP1_PONAB RecName: Full=LIM and SH3 domain protein 1;       
    4::57      2e-06  38%  261 aa  LASP1_HUMAN RecName: Full=LIM and SH3 domain protein 1;       
  104::314     2e-06  28%  412 aa  ZN260_HUMAN RecName: Full=Zinc finger protein 260;       
    2::54      2e-06  40%  657 aa  LASP1_DROME RecName: Full=LIM and SH3 domain protein Lasp;
  147::404     3e-06  28%  451 aa  ZN222_HUMAN RecName: Full=Zinc finger protein 222;
  338::517     3e-06  29%  538 aa  ZN155_HUMAN RecName: Full=Zinc finger protein 155;
  461::702     4e-06  26%  718 aa  ZNF28_HUMAN RecName: Full=Zinc finger protein 28;AltName: Full=Zinc
  275::515     4e-06  27%  588 aa  ZN676_HUMAN RecName: Full=Zinc finger protein 676;
  188::418     4e-06  32%  679 aa  ZN283_HUMAN RecName: Full=Zinc finger protein 283;
  766::827     4e-06  39%  827 aa  VILI_BOVIN RecName: Full=Villin-1;
  519::792     6e-06  29%  836 aa  ZN546_HUMAN RecName: Full=Zinc finger protein 546;
  232::443     6e-06  29%  458 aa  ZN275_HUMAN RecName: Full=Zinc finger protein 275;
  662::885     6e-06  24%  947 aa  ZN268_HUMAN RecName: Full=Zinc finger protein 268;AltName:
  485::765     6e-06  26%  909 aa  ZBT41_HUMAN RecName: Full=Zinc finger and BTB domain-containing
  844::888     6e-06  40%  888 aa  QUAI_DROME RecName: Full=Villin-like protein quail;
  255::302     6e-06  33%  330 aa  PDLI4_RAT RecName: Full=PDZ and LIM domain protein 4;AltName:
  255::302     6e-06  33%  330 aa  PDLI4_MOUSE RecName: Full=PDZ and LIM domain protein 4;AltName:
  255::302     6e-06  33%  330 aa  PDLI4_HUMAN RecName: Full=PDZ and LIM domain protein 4;AltName:
  256::303     6e-06  33%  331 aa  PDLI4_BOVIN RecName: Full=PDZ and LIM domain protein 4;
  229::485     8e-06  28%  542 aa  ZNF30_HUMAN RecName: Full=Zinc finger protein 30;AltName: Full=Zinc
  222::467     8e-06  28%  499 aa  ZN253_HUMAN RecName: Full=Zinc finger protein 253;AltName:
  484::762     8e-06  27%  908 aa  ZBT41_MOUSE RecName: Full=Zinc finger and BTB domain-containing
  767::827     8e-06  38%  827 aa  VILI_MOUSE RecName: Full=Villin-1;
  255::302     8e-06  33%  330 aa  PDLI4_CHICK RecName: Full=PDZ and LIM domain protein 4;AltName:
  251::490     1e-05  32%  536 aa  ZN737_HUMAN RecName: Full=Zinc finger protein 737;AltName:
  207::475     1e-05  28%  781 aa  ZN616_HUMAN RecName: Full=Zinc finger protein 616;
  523::740     1e-05  27%  754 aa  ZN287_PONPY RecName: Full=Zinc finger protein 287;
  523::740     1e-05  27%  754 aa  ZN287_HUMAN RecName: Full=Zinc finger protein 287;AltName:
  534::844     1e-05  29%  873 aa  ZN252_CANFA RecName: Full=Zinc finger protein 252;
  504::744     1e-05  27% 1029 aa  ZN197_HUMAN RecName: Full=Zinc finger protein 197;AltName:
   13::123     1e-05  32% 1007 aa  RGA1_YEAST RecName: Full=Rho-type GTPase-activating protein 1;
  290::337     1e-05  35%  358 aa  PDLI3_XENLA RecName: Full=PDZ and LIM domain protein 3;
  371::447     1e-05  34%  753 aa  LIMA1_MOUSE RecName: Full=LIM domain and actin-binding protein
  510::749     1e-05  32%  790 aa  ZN560_HUMAN RecName: Full=Zinc finger protein 560;
  528::745     1e-05  27%  759 aa  ZN287_MOUSE RecName: Full=Zinc finger protein 287;       
  322::566     1e-05  24%  580 aa  ZN271_MOUSE RecName: Full=Zinc finger protein 271;AltName:
  861::909     1e-05  41%  909 aa  VILI1_ARATH RecName: Full=Villin-1;
 1621::1704    1e-05  32% 1704 aa  VILD_DICDI RecName: Full=Villidin;
  161::383     2e-05  25%  568 aa  ZN675_HUMAN RecName: Full=Zinc finger protein 675;AltName:
  263::539     2e-05  26%  646 aa  ZN493_HUMAN RecName: Full=Zinc finger protein 493;
  451::668     2e-05  26%  839 aa  ZN347_HUMAN RecName: Full=Zinc finger protein 347;AltName:
  366::612     2e-05  23%  706 aa  ZN225_HUMAN RecName: Full=Zinc finger protein 225;
  279::496     2e-05  28%  818 aa  ZN160_HUMAN RecName: Full=Zinc finger protein 160;AltName:
  194::438     2e-05  29%  533 aa  ZFP30_MOUSE RecName: Full=Zinc finger protein 30;       
  260::307     2e-05  33%  329 aa  PDLI1_HUMAN RecName: Full=PDZ and LIM domain protein 1;AltName:
  259::306     2e-05  33%  328 aa  PDLI1_BOVIN RecName: Full=PDZ and LIM domain protein 1;AltName:
    4::57      2e-05  36%  260 aa  LASP1_BOVIN RecName: Full=LIM and SH3 domain protein 1;       
  393::633     2e-05  28%  809 aa  ZNF43_HUMAN RecName: Full=Zinc finger protein 43;AltName: Full=Zinc
  162::419     2e-05  32%  674 aa  ZN429_HUMAN RecName: Full=Zinc finger protein 429;
  192::465     2e-05  28%  532 aa  ZFP82_HUMAN RecName: Full=Zinc finger protein 82 homolog;       
  587::832     2e-05  25%  843 aa  PRDM9_MOUSE RecName: Full=Histone-lysine N-methyltransferase PRDM9;
  122::278     2e-05  28%  292 aa  OZF_MOUSE RecName: Full=Zinc finger protein OZF;AltName: Full=Only
  122::278     2e-05  28%  292 aa  OZF_BOVIN RecName: Full=Zinc finger protein OZF;AltName: Full=Only
    6::54      2e-05  31% 1728 aa  NRAP_MOUSE RecName: Full=Nebulin-related-anchoring protein;        
  390::449     2e-05  34%  759 aa  LIMA1_HUMAN RecName: Full=LIM domain and actin-binding protein
  503::716     3e-05  27%  808 aa  ZN841_HUMAN RecName: Full=Zinc finger protein 841;
  217::490     3e-05  29%  499 aa  ZN565_HUMAN RecName: Full=Zinc finger protein 565;
  304::598     3e-05  26%  673 aa  ZN433_HUMAN RecName: Full=Zinc finger protein 433;
  419::631     3e-05  32% 1167 aa  ZN208_HUMAN RecName: Full=Zinc finger protein 208;
  234::479     3e-05  28%  577 aa  YS020_HUMAN RecName: Full=Zinc finger protein LOC400713;
  122::278     3e-05  28%  292 aa  OZF_PONAB RecName: Full=Zinc finger protein OZF;AltName: Full=Only
  122::278     3e-05  28%  292 aa  OZF_HUMAN RecName: Full=Zinc finger protein OZF;AltName: Full=Only
  204::407     4e-05  31%  595 aa  ZNF85_HUMAN RecName: Full=Zinc finger protein 85;AltName: Full=Zinc
  212::402     4e-05  27%  422 aa  ZN620_HUMAN RecName: Full=Zinc finger protein 620;
  264::509     4e-05  25%  519 aa  ZFP30_MACFA RecName: Full=Zinc finger protein 30 homolog;       
  399::613     4e-05  29%  825 aa  ZFP28_MOUSE RecName: Full=Zinc finger protein 28;       
  264::531     4e-05  28%  612 aa  Z354B_HUMAN RecName: Full=Zinc finger protein 354B;
  907::966     4e-05  37%  966 aa  VILI3_ARATH RecName: Full=Villin-3;
  258::305     4e-05  33%  327 aa  PDLI1_RAT RecName: Full=PDZ and LIM domain protein 1;AltName:
  258::305     4e-05  33%  327 aa  PDLI1_MOUSE RecName: Full=PDZ and LIM domain protein 1;AltName:
    6::54      4e-05  31% 1730 aa  NRAP_HUMAN RecName: Full=Nebulin-related-anchoring protein;        
  752::819     4e-05  36%  819 aa  AVIL_HUMAN RecName: Full=Advillin;AltName: Full=p92;
  330::569     5e-05  27%  643 aa  ZNF23_HUMAN RecName: Full=Zinc finger protein 23;AltName: Full=Zinc
  349::590     5e-05  27%  617 aa  ZN813_HUMAN RecName: Full=Zinc finger protein 813;
  261::500     5e-05  27%  687 aa  ZN778_HUMAN RecName: Full=Zinc finger protein 778;
  201::486     5e-05  29%  536 aa  ZN623_HUMAN RecName: Full=Zinc finger protein 623;
  284::526     5e-05  29%  626 aa  ZN471_HUMAN RecName: Full=Zinc finger protein 471;AltName:
  451::607     5e-05  30%  652 aa  ZN432_HUMAN RecName: Full=Zinc finger protein 432;
  218::497     5e-05  29%  540 aa  ZN136_HUMAN RecName: Full=Zinc finger protein 136;
  329::558     5e-05  27%  647 aa  ZG48_XENLA RecName: Full=Gastrula zinc finger protein
  260::418     6e-05  30%  435 aa  ZO22_XENLA RecName: Full=Oocyte zinc finger protein XlCOF22;
  435::677     6e-05  27%  686 aa  ZNF7_PONAB RecName: Full=Zinc finger protein 7;
  435::677     6e-05  27%  686 aa  ZNF7_HUMAN RecName: Full=Zinc finger protein 7;AltName: Full=Zinc
  259::499     6e-05  30%  911 aa  ZN721_HUMAN RecName: Full=Zinc finger protein 721;
  314::498     6e-05  29%  540 aa  ZN519_HUMAN RecName: Full=Zinc finger protein 519;
  203::406     6e-05  30%  444 aa  ZN506_HUMAN RecName: Full=Zinc finger protein 506;
  122::336     6e-05  29%  914 aa  ZFP62_MOUSE RecName: Full=Zinc finger protein 62;       
  310::549     6e-05  23%  707 aa  ZFP60_MOUSE RecName: Full=Zinc finger protein 60;       
 3246::3316    6e-05  33% 3784 aa  XIRP2_MOUSE RecName: Full=Xin actin-binding repeat-containing protein
  147::206     6e-05  36%  870 aa  MILK1_MOUSE RecName: Full=MICAL-like protein 1;AltName:
  110::418     8e-05  28%  421 aa  ZN584_HUMAN RecName: Full=Zinc finger protein 584;
  177::418     8e-05  26%  544 aa  ZN502_HUMAN RecName: Full=Zinc finger protein 502;
  258::509     8e-05  27%  575 aa  ZN417_HUMAN RecName: Full=Zinc finger protein 417;
  344::529     8e-05  27%  578 aa  ZN192_PANTR RecName: Full=Zinc finger protein 192;
  344::529     8e-05  27%  578 aa  ZN192_PANPA RecName: Full=Zinc finger protein 192;
  344::529     8e-05  27%  578 aa  ZN192_HUMAN RecName: Full=Zinc finger protein 192;AltName:
  218::497     8e-05  29%  540 aa  ZN136_PONAB RecName: Full=Zinc finger protein 136;
  350::570     8e-05  26%  783 aa  ZN107_HUMAN RecName: Full=Zinc finger protein 107;AltName:
  218::457     1e-04  26%  563 aa  ZN708_HUMAN RecName: Full=Zinc finger protein 708;AltName:
  280::493     1e-04  26%  676 aa  ZN418_HUMAN RecName: Full=Zinc finger protein 418;
  319::584     1e-04  27%  599 aa  ZN343_HUMAN RecName: Full=Zinc finger protein 343;
  264::509     1e-04  24%  519 aa  ZFP30_HUMAN RecName: Full=Zinc finger protein 30 homolog;       
   41::100     1e-04  36%  128 aa  LIMD2_RAT RecName: Full=LIM domain-containing protein 2;
  212::371     1e-04  29%  422 aa  ZN620_PONAB RecName: Full=Zinc finger protein 620;
  365::559     1e-04  29%  892 aa  ZN473_MOUSE RecName: Full=Zinc finger protein 473 homolog;AltName:
  286::473     1e-04  27%  499 aa  ZN439_HUMAN RecName: Full=Zinc finger protein 439;
  192::376     1e-04  29%  475 aa  ZN383_MACFA RecName: Full=Zinc finger protein 383;
  357::569     1e-04  27%  711 aa  ZN175_HUMAN RecName: Full=Zinc finger protein 175;AltName:
  210::474     1e-04  29%  487 aa  ZIK1_HUMAN RecName: Full=Zinc finger protein interacting with
 2571::2614    1e-04  36% 2614 aa  TALB_DICDI RecName: Full=Talin-B;
   41::100     1e-04  36%  128 aa  LIMD2_MOUSE RecName: Full=LIM domain-containing protein 2;
   40::99      1e-04  36%  127 aa  LIMD2_HUMAN RecName: Full=LIM domain-containing protein 2;
  288::518     2e-04  26% 1191 aa  ZNF91_HUMAN RecName: Full=Zinc finger protein 91;AltName: Full=Zinc
  227::514     2e-04  28%  516 aa  ZNF83_HUMAN RecName: Full=Zinc finger protein 83;AltName: Full=Zinc
  248::504     2e-04  27%  533 aa  ZN846_HUMAN RecName: Full=Zinc finger protein 846;
  384::625     2e-04  27%  644 aa  ZN568_HUMAN RecName: Full=Zinc finger protein 568;
  115::390     2e-04  27%  463 aa  ZN331_PONAB RecName: Full=Zinc finger protein 331;
  115::390     2e-04  27%  463 aa  ZN331_HUMAN RecName: Full=Zinc finger protein 331;AltName:
  341::497     2e-04  28%  706 aa  ZN132_HUMAN RecName: Full=Zinc finger protein 132;
   96::322     2e-04  26%  456 aa  ZNF25_HUMAN RecName: Full=Zinc finger protein 25;AltName: Full=Zinc
  248::493     2e-04  27%  636 aa  ZN790_HUMAN RecName: Full=Zinc finger protein 790;
  490::731     2e-04  25%  852 aa  ZN484_HUMAN RecName: Full=Zinc finger protein 484;
  178::416     2e-04  27%  707 aa  ZN224_HUMAN RecName: Full=Zinc finger protein 224;AltName:
  347::429     2e-04  28%  564 aa  ADCE_DICDI RecName: Full=Arrestin domain-containing protein E;
  349::590     3e-04  27%  617 aa  ZN813_PONAB RecName: Full=Zinc finger protein 813;
  214::408     3e-04  32%  411 aa  ZN679_HUMAN RecName: Full=Zinc finger protein 679;
  204::444     3e-04  28%  463 aa  ZIK1_MOUSE RecName: Full=Zinc finger protein interacting with
  400::591     3e-04  24%  606 aa  ZG66_XENLA RecName: Full=Gastrula zinc finger protein
  278::339     3e-04  32%  349 aa  PDLI2_RAT RecName: Full=PDZ and LIM domain protein 2;
  278::339     3e-04  32%  349 aa  PDLI2_MOUSE RecName: Full=PDZ and LIM domain protein 2;AltName:
  281::342     3e-04  32%  352 aa  PDLI2_MACFA RecName: Full=PDZ and LIM domain protein 2;
  281::342     3e-04  32%  352 aa  PDLI2_HUMAN RecName: Full=PDZ and LIM domain protein 2;AltName:
  277::338     3e-04  32%  348 aa  PDLI2_BOVIN RecName: Full=PDZ and LIM domain protein 2;
   38::192     4e-04  29%  213 aa  ZNF80_CERAE RecName: Full=Zinc finger protein 80;
  192::376     4e-04  29%  475 aa  ZN383_HUMAN RecName: Full=Zinc finger protein 383;
   45::309     4e-04  27%  407 aa  ZN260_MOUSE RecName: Full=Zinc finger protein 260;       
  419::638     4e-04  28%  645 aa  ZN235_MOUSE RecName: Full=Zinc finger protein 235;AltName:
  276::522     4e-04  31%  617 aa  ZN221_HUMAN RecName: Full=Zinc finger protein 221;
  217::458     4e-04  23%  472 aa  ZIM3_HUMAN RecName: Full=Zinc finger imprinted 3;
  383::650     4e-04  26%  833 aa  Z780B_HUMAN RecName: Full=Zinc finger protein 780B;AltName:
  365::572     4e-04  29%  601 aa  Z354B_MOUSE RecName: Full=Zinc finger protein 354B;AltName:
  388::538     5e-04  28%  643 aa  ZNF74_HUMAN RecName: Full=Zinc finger protein 74;       
  212::421     5e-04  26%  519 aa  ZNF35_HUMAN RecName: Full=Zinc finger protein 35;AltName: Full=Zinc
  186::370     5e-04  26%  610 aa  ZN823_HUMAN RecName: Full=Zinc finger protein 823;AltName:
  306::487     5e-04  29%  503 aa  ZN730_HUMAN RecName: Full=Putative zinc finger protein 730;
  287::378     5e-04  35%  498 aa  ZN682_HUMAN RecName: Full=Zinc finger protein 682;
  259::521     5e-04  30%  525 aa  ZN678_HUMAN RecName: Full=Zinc finger protein 678;
  275::492     5e-04  29%  696 aa  ZN607_HUMAN RecName: Full=Zinc finger protein 607;
  413::653     5e-04  26%  670 aa  ZN551_HUMAN RecName: Full=Zinc finger protein 551;AltName:
  178::472     5e-04  30%  700 aa  ZN234_HUMAN RecName: Full=Zinc finger protein 234;AltName:
  442::656     5e-04  27%  868 aa  ZFP28_HUMAN RecName: Full=Zinc finger protein 28 homolog;       
  343::524     5e-04  29%  572 aa  Z354A_MOUSE RecName: Full=Zinc finger protein 354A;AltName:
  163::394     5e-04  31%  397 aa  YS033_HUMAN RecName: Full=Zinc finger protein ENSP00000380285;
  249::463     5e-04  25%  711 aa  RBAK_MOUSE RecName: Full=RB-associated KRAB zinc finger
  277::396     7e-04  36%  445 aa  ZNF66_HUMAN RecName: Full=Zinc finger protein 66;
  258::509     7e-04  28%  575 aa  ZN587_HUMAN RecName: Full=Zinc finger protein 587;
  128::262     7e-04  30%  271 aa  ZN501_HUMAN RecName: Full=Zinc finger protein 501;AltName:
  129::309     7e-04  28%  407 aa  ZN260_RAT RecName: Full=Zinc finger protein 260;       
  331::512     7e-04  27%  647 aa  ZFP11_MOUSE RecName: Full=Zinc finger protein 11;       
  260::477     7e-04  28%  737 aa  Z585A_PONAB RecName: Full=Zinc finger protein 585A;
  432::686     7e-04  26% 1350 aa  XFIN_XENLA RecName: Full=Zinc finger protein Xfin;
    4::55      7e-04  31%  199 aa  LIME_DICDI RecName: Full=LIM domain-containing protein E;AltName:
  301::552     0.001  25%  642 aa  ZNF14_PONAB RecName: Full=Zinc finger protein 14;
  364::577     0.001  28%  632 aa  ZN860_HUMAN RecName: Full=Zinc finger protein 860;
  303::548     0.001  25%  613 aa  ZN665_HUMAN RecName: Full=Zinc finger protein 665;AltName:
  249::461     0.001  28%  588 aa  ZN599_HUMAN RecName: Full=Zinc finger protein 599;
  220::432     0.001  27%  645 aa  ZN573_HUMAN RecName: Full=Zinc finger protein 573;
  347::620     0.001  27%  628 aa  ZN528_HUMAN RecName: Full=Zinc finger protein 528;
  406::649     0.001  24%  683 aa  ZN510_HUMAN RecName: Full=Zinc finger protein 510;
  128::262     0.001  31%  271 aa  ZN501_PONAB RecName: Full=Zinc finger protein 501;
  128::290     0.001  32%  687 aa  ZN420_BOVIN RecName: Full=Zinc finger protein 420;
  370::607     0.001  30%  751 aa  ZN337_HUMAN RecName: Full=Zinc finger protein 337;
  241::473     0.001  25%  627 aa  ZN256_HUMAN RecName: Full=Zinc finger protein 256;AltName:
  475::690     0.001  29%  738 aa  ZN235_HUMAN RecName: Full=Zinc finger protein 235;AltName:
  168::325     0.001  34%  337 aa  ZG26_XENLA RecName: Full=Gastrula zinc finger protein
  264::448     0.001  28%  461 aa  ZFP2_HUMAN RecName: Full=Zinc finger protein 2 homolog;       
  185::233     0.001  35%  904 aa  MILK2_HUMAN RecName: Full=MICAL-like protein 2;
    7::59      0.001  29%  198 aa  LIMD_DICDI RecName: Full=LIM domain-containing protein D;
    4::109     3e-14  36%  642 aa  LIMK2_CHICK RecName: Full=LIM domain kinase 2;       (query 37->141)
   26::151     2e-12  33%  615 aa  LIMK1_XENLA RecName: Full=LIM domain kinase 1;       (query 45->163)
   20::125     1e-14  38%  647 aa  LIMK1_MOUSE RecName: Full=LIM domain kinase 1;       (query 38->144)
   20::125     3e-14  38%  647 aa  LIMK1_HUMAN RecName: Full=LIM domain kinase 1;       (query 38->144)
   20::125     1e-13  37%  647 aa  LIMK1_RAT RecName: Full=LIM domain kinase 1;         Short=LIMK-1; (query 38->144)
   12::109     3e-13  35%  638 aa  LIMK2_RAT RecName: Full=LIM domain kinase 2;         Short=LIMK-2; (query 45->141)
   12::109     7e-12  34%  638 aa  LIMK2_BOVIN RecName: Full=LIM domain kinase 2;       (query 45->141)
    9::109     5e-12  34%  638 aa  LIMK2_HUMAN RecName: Full=LIM domain kinase 2;       (query 42->141)
   12::109     6e-13  35%  638 aa  LIMK2_MOUSE RecName: Full=LIM domain kinase 2;       (query 45->141)
   42::128     2e-10  34%  390 aa  LHX4_MOUSE RecName: Full=LIM/homeobox protein Lhx4;       (query 56->141)
   42::128     2e-10  34%  390 aa  LHX4_HUMAN RecName: Full=LIM/homeobox protein Lhx4;       (query 56->141)
   54::166     2e-10  30% 1257 aa  LIMK1_DROME RecName: Full=LIM domain kinase 1;       (query 62->174)
    1::104     6e-14  34%  405 aa  LHX1_DANRE RecName: Full=LIM/homeobox protein Lhx1;       (query 42->143)
    1::132     6e-14  30%  403 aa  LHX1_XENLA RecName: Full=LIM/homeobox protein Lhx1;       (query 42->170)
    6::128     1e-12  34%  145 aa  LMO3_PONAB RecName: Full=LIM domain only protein 3;(query 37->153)
    6::128     1e-12  34%  145 aa  LMO3_MOUSE RecName: Full=LIM domain only protein 3;AltName:(query 37->153)
    6::128     1e-12  34%  145 aa  LMO3_HUMAN RecName: Full=LIM domain only protein 3;AltName:(query 37->153)
    6::128     1e-12  34%  145 aa  LMO3_BOVIN RecName: Full=LIM domain only protein 3;(query 37->153)
    2::105     4e-13  33%  402 aa  LHX5_RAT RecName: Full=LIM/homeobox protein Lhx5;         Short=LIM(query 42->143)
    2::105     4e-13  33%  402 aa  LHX5_MOUSE RecName: Full=LIM/homeobox protein Lhx5;       (query 42->143)
    2::105     4e-13  33%  402 aa  LHX5_HUMAN RecName: Full=LIM/homeobox protein Lhx5;       (query 42->143)
    2::105     4e-14  33%  399 aa  LHX5_DANRE RecName: Full=LIM/homeobox protein Lhx5;       (query 42->143)
   17::140     9e-12  30%  363 aa  ISL3_ONCTS RecName: Full=Insulin gene enhancer protein ISL-3;      (query 35->153)
    9::122     7e-12  32%  340 aa  ISL2B_ONCTS RecName: Full=Insulin gene enhancer protein ISL-2B;    (query 45->153)
   17::139     2e-12  34%  156 aa  LMO3_XENLA RecName: Full=LIM domain only protein 3;       (query 37->153)
    6::128     2e-12  34%  145 aa  LMO3_DANRE RecName: Full=LIM domain only protein 3;(query 37->153)
    4::105     3e-13  34%  402 aa  LHX5_XENLA RecName: Full=LIM/homeobox protein Lhx5;       (query 44->143)
   17::140     4e-12  32%  360 aa  ISL2_RAT RecName: Full=Insulin gene enhancer protein ISL-2;        (query 36->153)
   17::140     4e-12  32%  359 aa  ISL2_MOUSE RecName: Full=Insulin gene enhancer protein ISL-2;      (query 36->153)
   17::140     4e-12  32%  359 aa  ISL2_HUMAN RecName: Full=Insulin gene enhancer protein ISL-2;      (query 36->153)
   24::140     4e-13  34%  156 aa  RBTN1_XENLA RecName: Full=Rhombotin-1;AltName: Full=LIM domain only(query 45->154)
   24::140     5e-13  34%  156 aa  RBTN1_MOUSE RecName: Full=Rhombotin-1;AltName: Full=LIM domain only(query 45->154)
   24::140     4e-13  34%  156 aa  RBTN1_HUMAN RecName: Full=Rhombotin-1;AltName: Full=LIM domain only(query 45->154)
   23::139     4e-13  34%  155 aa  RBTN1_DANRE RecName: Full=Rhombotin-1;AltName: Full=LIM domain only(query 45->154)
   13::128     6e-13  34%  145 aa  LMO3_RAT RecName: Full=LIM domain only protein 3;AltName:(query 45->153)
   40::126     4e-12  36%  395 aa  LHX3_CHICK RecName: Full=LIM/homeobox protein Lhx3;       (query 56->141)
   17::140     3e-12  30%  359 aa  ISL2A_DANRE RecName: Full=Insulin gene enhancer protein(query 35->153)
    8::130     2e-11  33%  349 aa  ISL1_DANRE RecName: Full=Insulin gene enhancer protein isl-1;      (query 37->153)
    8::130     3e-11  33%  349 aa  ISL1_CHICK RecName: Full=Insulin gene enhancer protein ISL-1;      (query 37->153)
   40::126     5e-11  35%  398 aa  LHX3_DANRE RecName: Full=LIM/homeobox protein Lhx3;       (query 56->141)
    8::130     2e-11  33%  349 aa  ISL1_RAT RecName: Full=Insulin gene enhancer protein ISL-1;        (query 37->153)
    8::130     2e-11  33%  349 aa  ISL1_MOUSE RecName: Full=Insulin gene enhancer protein ISL-1;      (query 37->153)
    8::130     2e-11  33%  349 aa  ISL1_MESAU RecName: Full=Insulin gene enhancer protein ISL-1;      (query 37->153)
    8::130     2e-11  33%  349 aa  ISL1_HUMAN RecName: Full=Insulin gene enhancer protein ISL-1;      (query 37->153)
   17::140     9e-12  30%  358 aa  ISL2B_DANRE RecName: Full=Insulin gene enhancer protein(query 35->153)
   24::140     1e-12  33%  156 aa  RBTN1_BOVIN RecName: Full=Rhombotin-1;AltName: Full=LIM domain only(query 45->154)
   75::192     6e-11  36%  356 aa  LHX8_HUMAN RecName: Full=LIM/homeobox protein Lhx8;       (query 172->282)
   96::213     3e-11  36%  367 aa  LHX8_MOUSE RecName: Full=LIM/homeobox protein Lhx8;       (query 172->282)
   40::126     3e-11  35%  395 aa  LHX3_XENLA RecName: Full=LIM/homeobox protein Lhx3;       (query 56->141)
   43::129     4e-10  34%  397 aa  LHX3_HUMAN RecName: Full=LIM/homeobox protein Lhx3;       (query 56->141)
  103::171     5e-05  37%  388 aa  LHX9_RAT RecName: Full=LIM/homeobox protein Lhx9;         Short=LIM(query 84->151)
  112::180     5e-05  37%  397 aa  LHX9_MOUSE RecName: Full=LIM/homeobox protein Lhx9;       (query 84->151)
  112::180     5e-05  37%  397 aa  LHX9_HUMAN RecName: Full=LIM/homeobox protein Lhx9;       (query 84->151)
   28::114     2e-10  37%  383 aa  LHX3_PIG RecName: Full=LIM/homeobox protein Lhx3;         Short=LIM(query 56->141)
   46::132     4e-10  34%  400 aa  LHX3_MOUSE RecName: Full=LIM/homeobox protein Lhx3;       (query 56->141)
  112::180     5e-05  37%  397 aa  LHX9_BOVIN RecName: Full=LIM/homeobox protein Lhx9;       (query 84->151)
   94::167     8e-06  36%  406 aa  LHX2_MOUSE RecName: Full=LIM/homeobox protein Lhx2;       (query 84->154)
   94::167     8e-06  36%  406 aa  LHX2_HUMAN RecName: Full=LIM/homeobox protein Lhx2;       (query 84->154)
   70::174     1e-10  34%  363 aa  LHX6_MOUSE RecName: Full=LIM/homeobox protein Lhx6;       (query 172->272)
   70::174     4e-10  33%  363 aa  LHX6_HUMAN RecName: Full=LIM/homeobox protein Lhx6;       (query 172->272)
  130::250     4e-10  30%  469 aa  APTE_DROME RecName: Full=Protein apterous;(query 31->142)
   93::166     1e-05  36%  426 aa  LHX2_RAT RecName: Full=LIM/homeobox protein Lhx2;         Short=LIM(query 84->154)
   93::153     3e-05  39%  377 aa  LHX9_ASTFA RecName: Full=LIM/homeobox protein Lhx9;       (query 84->141)
   11::102     9e-12  35%  319 aa  ISL2_CHICK RecName: Full=Insulin gene enhancer protein ISL-2;      (query 64->152)
   23::138     1e-12  32%  165 aa  LMO42_XENTR RecName: Full=LIM domain transcription factor(query 45->153)
   33::143     8e-13  32%  377 aa  LMX1B_CHICK RecName: Full=LIM/homeobox protein LMX-1.2;       (query 45->153)
   94::154     4e-05  39%  379 aa  LHX9_RANRU RecName: Full=LIM/homeobox protein Lhx9;       (query 84->141)
   33::143     3e-12  31%  372 aa  LMX1B_MOUSE RecName: Full=LIM homeobox transcription factor(query 45->153)
   23::133     3e-12  31%  369 aa  LMX1B_MESAU RecName: Full=LIM homeobox transcription factor(query 45->153)
   33::143     3e-12  31%  379 aa  LMX1B_HUMAN RecName: Full=LIM homeobox transcription factor(query 45->153)
   23::138     2e-12  32%  165 aa  LMO4_MOUSE RecName: Full=LIM domain transcription factor(query 45->153)
   23::138     2e-12  32%  165 aa  LMO4_HUMAN RecName: Full=LIM domain transcription factor(query 45->153)
   23::138     2e-12  32%  165 aa  LMO4_BOVIN RecName: Full=LIM domain transcription factor(query 45->153)
   24::139     1e-12  32%  171 aa  LMO4A_XENLA RecName: Full=LIM domain transcription factor(query 45->153)
   47::145     2e-10  29%  382 aa  LMX1A_HUMAN RecName: Full=LIM homeobox transcription factor(query 56->153)
  294::381     2e-09  31%  514 aa  LIM_HALRO RecName: Full=LIM/homeobox protein LIM;       (query 56->142)
  114::186     6e-06  32%  331 aa  LHX9_XENLA RecName: Full=LIM/homeobox protein Lhx9;       (query 84->154)
   24::139     8e-13  32%  171 aa  LMO4B_XENLA RecName: Full=LIM domain transcription factor(query 45->153)
   47::145     1e-09  28%  382 aa  LMX1A_MOUSE RecName: Full=LIM homeobox transcription factor(query 56->153)
   47::145     1e-09  28%  382 aa  LMX1A_MESAU RecName: Full=LIM homeobox transcription factor(query 56->153)
   30::142     2e-11  36%  158 aa  RBTN2_MOUSE RecName: Full=Rhombotin-2;AltName: Full=LIM domain only(query 172->277)
   30::142     2e-11  36%  158 aa  RBTN2_HUMAN RecName: Full=Rhombotin-2;AltName: Full=LIM domain only(query 172->277)
   30::142     2e-11  36%  158 aa  RBTN2_BOVIN RecName: Full=Rhombotin-2;AltName: Full=LIM domain only(query 172->277)
   30::158     9e-12  34%  158 aa  RBTN2_XENTR RecName: Full=Rhombotin-2;AltName: Full=LIM domain only(query 172->292)
   30::158     1e-11  34%  158 aa  RBTN2_XENLA RecName: Full=Rhombotin-2;AltName: Full=LIM domain only(query 172->292)
   30::142     8e-11  35%  159 aa  RBTN2_DANRE RecName: Full=Rhombotin-2;AltName: Full=LIM domain only(query 172->277)
   48::150     2e-10  28%  351 aa  HM14_CAEEL RecName: Full=Homeobox protein ceh-14;(query 172->272)
   27::131     8e-05  25%  318 aa  MEC3_CAEBR RecName: Full=Mechanosensory protein 3;(query 170->270)
    3::109     1e-08  32%  650 aa  LIMK_DICDI RecName: Full=Probable LIM domain-containing(query 169->268)
   27::131     2e-04  26%  320 aa  MEC3_CAERE RecName: Full=Mechanosensory protein 3;(query 170->270)
   46::131     1e-04  28%  321 aa  MEC3_CAEEL RecName: Full=Mechanosensory protein 3;(query 189->270)
   37::135     1e-05  30%  167 aa  LMO41_XENTR RecName: Full=LIM domain transcription factor(query 185->275)
  249::359     2e-06  27%  363 aa  LMCD1_PIG RecName: Full=LIM and cysteine-rich domains protein 1;(query 37->157)
  251::365     3e-06  27%  365 aa  LMCD1_HUMAN RecName: Full=LIM and cysteine-rich domains protein(query 37->161)
  251::365     8e-06  27%  365 aa  LMCD1_MOUSE RecName: Full=LIM and cysteine-rich domains protein 1;(query 37->161)
   84::179     1e-07  33%  344 aa  PRIC4_HUMAN RecName: Full=Prickle-like protein 4;AltName:(query 172->260)
  244::288     1e-04  36%  315 aa  PDLI3_CHICK RecName: Full=PDZ and LIM domain protein 3;AltName:(query 230->274)
  249::363     2e-06  27%  363 aa  LMCD1_BOVIN RecName: Full=LIM and cysteine-rich domains protein 1;(query 37->161)
  292::351     1e-04  28%  362 aa  PDLI3_RAT RecName: Full=PDZ and LIM domain protein 3;AltName:(query 231->290)
  295::339     2e-04  47%  365 aa  PDLI3_PIG RecName: Full=PDZ and LIM domain protein 3;AltName:(query 231->268)
  246::305     8e-05  28%  316 aa  PDLI3_MOUSE RecName: Full=PDZ and LIM domain protein 3;AltName:(query 231->290)
  246::290     2e-04  47%  316 aa  PDLI3_BOVIN RecName: Full=PDZ and LIM domain protein 3;(query 231->268)
  294::353     3e-05  30%  364 aa  PDLI3_HUMAN RecName: Full=PDZ and LIM domain protein 3;AltName:(query 231->290)
  240::284     8e-05  50%  330 aa  PDLI4_RAT RecName: Full=PDZ and LIM domain protein 4;AltName:(query 212->260)
  255::284     3e-04  47%  330 aa  PDLI4_RAT RecName: Full=PDZ and LIM domain protein 4;AltName:(query 104->133)
  240::284     8e-05  50%  330 aa  PDLI4_MOUSE RecName: Full=PDZ and LIM domain protein 4;AltName:(query 212->260)
  255::284     3e-04  47%  330 aa  PDLI4_MOUSE RecName: Full=PDZ and LIM domain protein 4;AltName:(query 104->133)
  240::284     8e-05  50%  330 aa  PDLI4_HUMAN RecName: Full=PDZ and LIM domain protein 4;AltName:(query 212->260)
  255::284     3e-04  47%  330 aa  PDLI4_HUMAN RecName: Full=PDZ and LIM domain protein 4;AltName:(query 104->133)
  241::285     8e-05  50%  331 aa  PDLI4_BOVIN RecName: Full=PDZ and LIM domain protein 4;(query 212->260)
  256::285     3e-04  47%  331 aa  PDLI4_BOVIN RecName: Full=PDZ and LIM domain protein 4;(query 104->133)
  254::314     5e-04  26%  330 aa  PDLI4_CHICK RecName: Full=PDZ and LIM domain protein 4;AltName:(query 230->290)
  255::284     5e-04  47%  330 aa  PDLI4_CHICK RecName: Full=PDZ and LIM domain protein 4;AltName:(query 104->133)
  290::333     4e-04  36%  358 aa  PDLI3_XENLA RecName: Full=PDZ and LIM domain protein 3;(query 231->274)
  383::453     7e-04  28%  753 aa  LIMA1_MOUSE RecName: Full=LIM domain and actin-binding protein(query 37->113)
  385::455     0.001  28%  759 aa  LIMA1_HUMAN RecName: Full=LIM domain and actin-binding protein(query 37->113)
   61::117     4e-04  33%  128 aa  LIMD2_RAT RecName: Full=LIM domain-containing protein 2;(query 64->129)
   61::117     4e-04  33%  128 aa  LIMD2_MOUSE RecName: Full=LIM domain-containing protein 2;(query 64->129)
   60::116     5e-04  33%  127 aa  LIMD2_HUMAN RecName: Full=LIM domain-containing protein 2;(query 64->129)
    1::724

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxDPHHTMGDYKVAHPQDPHHPSEKPVIHCHKCGEPCKGEVLRVQTKHFHIKCFT
ABLM1_HUMAN     ---------------------------VAHPQDPHHPSEKPVIHCHKCGEPCKGEVLRVQTKHFHIKCFT
ABLM1_MOUSE     ------------------------DPSVAHPQDPHHSSEKPVIHCHKCGEPCKGEVLRVQTKHFHIKCFT
ABLM3_HUMAN     ---------------------------IPYQQNPYNPGSSNVIQCYRCGDTCKGEVVRVHNNHFHIRCFT
ABLM3_MOUSE     ---------------------------IPYQQSPYSPGGSNVIQCYRCGDTCKGEVVRVHNNHFHIRCFT
ABLM2_RAT       ---------------------------VSQPQAAHAPLEKPAILCNTCGNVCKGEVLRVQNKHFHIRCFV
ABLM2_HUMAN     ---------------------------VSQPQAAPSPLEKSAILCNTCGNVCKGEVLRVQDKYFHIKCFV
ABLM2_MOUSE     ---------------------------VSQPQAAHAPLEKPAILCNTCGNVCKGEVLRVQNKYFHIRCFV
DEMA_BOVIN      ----------------------------------------------------------------------
DEMA_PONAB      ----------------------------------------------------------------------
DEMA_HUMAN      ----------------------------------------------------------------------
DEMA_MOUSE      ----------------------------------------------------------------------
PXL1_CAEEL      ----------------------------------HGVNTIPKGDCAACGKPIIGQVVIALGKMWHPEHYT
PAXB_DICDI      --------------------------------------------CGGCRKPIFGETIQAMGKFYHPEHFC
PAXI_PONAB      --------------------------------------------CGACKKPIAGQVVTAMGKTWHPEHFV
PAXI_HUMAN      --------------------------------------------CGACKKPIAGQVVTAMGKTWHPEHFV
PAXI_CHICK      --------------------------------------------CGACKKPIAGQVVTAMGKTWHPEHFV
PAXI_RAT        --------------------------------------------CGACKKPIAGQVVTAMGKTWHPEHFV
PAXI_MOUSE      --------------------------------------------CGACKKPIAGQVVTAMGKTWHPEHFV
LPXN_HUMAN      ----------------------------------------PKGHCASCQKPIAGKVIHALGQSWHPEHFV
TGFI1_XENLA     --------------------------------------------CESCQRPIAGQVVTALGHTWHPEHFV
LPXN_MOUSE      ----------------------------------------PKGYCASCQKPIAGKVIHALGQSWHPEHFV
FHL3_BOVIN      -----------------------------------------------------------EDRHFHEGCFR
LIMS2_HUMAN     --------------------------------------------CGSCGEFIIGRVIKAMNNNWHPGCFR
LIMS2_BOVIN     --------------------------------------------CGSCGEFIIGRVIKAMNNNWHPGCFR
TGFI1_HUMAN     --------------------------------------------CGSCNKPIAGQVVTALGRAWHPEHFV
TGFI1_BOVIN     --------------------------------------------CGSCNKPIAGQVVTALGRAWHPEHFV
FHL3_HUMAN      -----------------------------------------------------------EDRHFHEGCFR
FHL3_MOUSE      -----------------------------------------------------------EDRHFHEGCFR
FHL2_RAT        --------------------------------------------CEECGTPCDCKDLSYKDRHWHEGCFH
LIMS2_MOUSE     ---------------------------------------------------------------YHEHCFV
FHL2_MOUSE      --------------------------------------------CEECGTPCDCKDLSYKDRHWHEGCFH
FHL1_RAT        --------------------------------------------CVECRKPISADAKEVHYKYWHDTCFR
FHL1_MOUSE      --------------------------------------------CVDCRKPISADAKEVHYKYWHDNCFR
LIMS1_MOUSE     ----------------------------------------------------------------------
LIMS1_HUMAN     ----------------------------------------------------------------------
UNC97_CAEEL     --------------------------------------------CGKCNEFIVGRVIKAMNASWHPGCFC
FHL5_RAT        -------------------------------------------YCEQCKEPIESDSLCYKNRHWHEGCFR
FHL2_HUMAN      --------------------------------------------CEECGKPCDCKDLSYKDRHWHEACFH
FHL5_MOUSE      -------------------------------------------YCEQCKEPIESDSLCYKNRHWHEGCFR
TGFI1_RAT       --------------------------------------------CGSCNKPIAGQVVTALGRAWHPEHFL
FHL2_BOVIN      --------------------------------------------CEECGKGCDCKDLSYKDRHWHEACFH
FHL5_BOVIN      -------------------------------------------YCEECKEPIESKDLCYKGHHWHEGCFN
PDLI7_CHICK     ----------------------------AAQQAPESPGRTPL--CYKCNKIIRGRYLVALGHYYHPEEFT
PDLI7_MOUSE     ----------------------------------------------------------------------
LIMK1_CHICK     ----------------------------------------------------------------------
FHL5_HUMAN      -------------------------------------------YCEECKKPIESDSLCYKDRHWHEGCFK
FHL5_MACFA      -------------------------------------------YCEECKKPIESDSLCYKDRHWHGGCFK
PDLI7_XENLA     ----------------------------------------------------------------------
LIMK2_CHICK     ----------------------------------------------------------------------
PDLI7_RAT       ----------------------------------------------------------------------
PDLI7_BOVIN     ----------------------------------------------------------------------
PIN2_CAEEL      --------------------------------------------CAKCNEFVIGQVVHSSNNSYHLACFT
PDLI7_DANRE     ----------------------------------------------------------------------
PDLI5_RAT       ----------------------------------HIPAGKRTPMCAHCNQAIRGPFLVALGKSWHPEEFN
PDLI7_HUMAN     ----------------------------------------------------------------------
PDLI5_MOUSE     ----------------------------------------------------------------------
PDLI5_HUMAN     ----------------------------------------------------------------------
LIMK1_XENLA     ----------------------------------------------------------------------
FHL1_HUMAN      --------------------------------------------CVECRKPIGADSKEVHYKNWHDTCFR
LIMK1_MOUSE     ----------------------------------------------------------------------
LIMK1_HUMAN     ----------------------------------------------------------------------
LIMK1_RAT       ----------------------------------------------------------------------
LDB3_HUMAN      --------------------------------------------CGHCNNVIRGPFLVAMGRSWHPEEFT
LIMB_DICDI      --------------------------------------------CGACGDMIIGVCTNALGRSYHPEHFV
LIMK2_RAT       ----------------------------------------------------------------------
WTIP_DANRE      --------------------------------------------CVKCGKGVYGQACQAMGNLYHTNCFT
LIMK2_BOVIN     ----------------------------------------------------------------------
LIMK2_HUMAN     ----------------------------------------------------------------------
LDB3_MOUSE      --------------------------------------------CGHCNNVIRGPFLVAMGRSWHPEEFN
LIMK2_MOUSE     ----------------------------------------------------------------------
ZYX_MOUSE       -----------------------------------HPQRQSVASCGKCNQPLARAAVRALGQLFHITCFT
ZYX_HUMAN       --------------------------------------------CGRCHQPLARAAVRALGQLFHIACFT
YOCC_SCHPO      -----------------------------------HTSTKPVLYCHSCGGSLRGRIISASGKKLHPQCFK
LHX4_MOUSE      ----------------------------------------------------------------------
LHX4_HUMAN      ----------------------------------------------------------------------
TGFI1_MOUSE     --------------------------------------------CGSCNKPIAGQVVTALGRAWHPEHFX
FBLI1_PONAB     --------------------------------------------CHKTVSP-RELAVEAMKRQYHAQCFT
FBLI1_BOVIN     --------------------------------------------CHKTVSP-RELAVEAMKRQYHAQCFT
WTIP_HUMAN      --------------------------------------------CIKCGLGIYGQACQAMGSLYHTDCFT
FBLI1_HUMAN     --------------------------------------------CHKTVSP-RELAVEAMKRQYHAQCFT
LIMK1_DROME     ----------------------------------------------------------------------
WTIP_XENLA      --------------------------------------------CIKCGKGVYGQACQAMGNLYHTNCFT
FBLI1_MOUSE     --------------------------------------------CGFCHKPVSPRELAVEARQYHAQCFT
LIMCH_DICDI     --------------------------------------------CGKCNGELVGSAISVMDKNFHPQCFK
LIMD1_MOUSE     -----------------------------------HPKADYFGSCVKCSKGVAGQACQAMGDLYHDACFT
LIMD1_HUMAN     -----------------------------------HPKADYFGACVKCSKGVAGQACQAMGNLYHDTCFT
Y6787_DICDI     ----------------------------------------------------------------------
LHX1_SAIBB      ----------------------------------------------------------------------
LHX1_RAT        ----------------------------------------------------------------------
LHX1_PANTR      ----------------------------------------------------------------------
LHX1_MOUSE      ----------------------------------------------------------------------
LHX1_MESAU      ----------------------------------------------------------------------
LHX1_HUMAN      ----------------------------------------------------------------------
LHX1_DANRE      ----------------------------------------------------------------------
LHX1_CHICK      ----------------------------------------------------------------------
WTIP_MOUSE      --------------------------------------------CIKCGLGIYGQACQAMGSLYHTDCFI
LHX1_XENLA      ----------------------------------------------------------------------
LPP_RAT         ------------------------------------PADDYFGRCARCGENVVGEGTTAMDQVFHVDCFT
LMO3_PONAB      ----------------------------------------------------------------------
LMO3_MOUSE      ----------------------------------------------------------------------
LMO3_HUMAN      ----------------------------------------------------------------------
LMO3_BOVIN      ----------------------------------------------------------------------
LHX5_RAT        ----------------------------------------------------------------------
LHX5_MOUSE      ----------------------------------------------------------------------
LHX5_HUMAN      ----------------------------------------------------------------------
LHX5_DANRE      ----------------------------------------------------------------------
ISL3_ONCTS      ----------------------------------------------------------------------
ISL2B_ONCTS     ----------------------------------------------------------------------
LPP_MOUSE       ------------------------------------PADDYFGRCARCGENVVGEGTTAMDQVFHVDCFT
JUB_RAT         --------------------------------------------CIKCNKGIYGQSNACQALDYHTQCFV
JUB_MOUSE       --------------------------------------------CIKCNKGIYGQSNACQALDYHTQCFV
JUB_HUMAN       --------------------------------------------CIKCNKGIYGQSNACQALDYHTQCFV
LMO3_XENLA      ----------------------------------------------------------------------
LMO3_DANRE      ----------------------------------------------------------------------
LHX5_XENLA      ----------------------------------------------------------------------
ISL2_RAT        ----------------------------------------------------------------------
ISL2_MOUSE      ----------------------------------------------------------------------
ISL2_HUMAN      ----------------------------------------------------------------------
ISL2A_ONCTS     ----------------------------------------------------------------------
RBTN1_XENLA     ----------------------------------------------------------------------
RBTN1_MOUSE     ----------------------------------------------------------------------
RBTN1_HUMAN     ----------------------------------------------------------------------
RBTN1_DANRE     ----------------------------------------------------------------------
LMO3_RAT        ----------------------------------------------------------------------
LHX3_CHICK      ----------------------------------------------------------------------
ISL2A_DANRE     ----------------------------------------------------------------------
ISL1_DANRE      ----------------------------------------------------------------------
ISL1_CHICK      ----------------------------------------------------------------------
LHX3_DANRE      ----------------------------------------------------------------------
ISL1_RAT        ----------------------------------------------------------------------
ISL1_MOUSE      ----------------------------------------------------------------------
ISL1_MESAU      ----------------------------------------------------------------------
ISL1_HUMAN      ----------------------------------------------------------------------
ISL2B_DANRE     ----------------------------------------------------------------------
RBTN1_BOVIN     ----------------------------------------------------------------------
LPP_CHICK       ------------------------------------PSDDYFGRCARCGENVVGEGTTAMDQVFHVECFT
LHX8_HUMAN      --------------------------------------------CNSCGEIVDKYLLKVNDLCWHVRCLS
LPP_HUMAN       ------------------------------------PADEYFGRCARCGENVVGEGTTAMDQVFHVDCFT
ZYX_XENLA       -------------------------------------------------------VVRAGEHLYHVACFT
LHX8_MOUSE      --------------------------------------------CSSCGEIVDKYLLKVNDLCWHVRCLS
LHX3_XENLA      ----------------------------------------------------------------------
LHX3_HUMAN      ----------------------------------------------------------------------
ZYX_XENTR       -------------------------------------------------------VVRAGEHLYHVTCFT
TES_XENTR       ----------------------------AHDQDPHELSPNEVKQMEQFVKKYKNEVLGVGDVKLP-KEVE
LHX9_RAT        ----------------------------------------------------------------------
LHX9_MOUSE      ----------------------------------------------------------------------
LHX9_HUMAN      ----------------------------------------------------------------------
LHX3_PIG        ----------------------------------------------------------------------
LHX3_MOUSE      ----------------------------------------------------------------------
LHX9_BOVIN      ----------------------------------------------------------------------
LHX2_MOUSE      ----------------------------------------------------------------------
LHX2_HUMAN      ----------------------------------------------------------------------
ZYX_CHICK       -------------------------------KDMDHPPPVEAATSELCGF-CRKPLSRTQPAVFHVECFT
LHX6_MOUSE      --------------------------------------------CSSCGEILDRYLLKVNNLIWHVRCLE
LHX6_HUMAN      --------------------------------------------CSSCGEILDRYLLKVNNLIWHVRCLE
APTE_DROME      ----------------------------------------------------------------------
LHX2_RAT        ----------------------------------------------------------------------
LIMA_DICDI      --------------------------------------------CRKCNTRVEGETIFVFGYHYHPNCFV
LHX9_ASTFA      ----------------------------------------------------------------------
PRIC1_XENTR     ---------------------------------------RAVMHCEKCGEKINGGEIAIFVSRWHPSCFV
ISL2_CHICK      ----------------------------------------------------------------------
PRIC1_AEDAE     ----------------------------------------------------------------------
PRI1B_XENLA     ---------------------------------------RAVMHCEKCGEKINGGEIAIFVSRWHPSCFV
LMO42_XENTR     ----------------------------------------------------------------------
LMX1B_CHICK     ----------------------------------------------------------------------
LHX9_RANRU      ----------------------------------------------------------------------
PRIC1_DROME     ----------------------------------------------------------------------
PRI1A_XENLA     ---------------------------------------RAVMHCEKCGEKINGGEVAIFVSRWHPSCFV
LMX1B_MOUSE     ----------------------------------------------------------------------
LMX1B_MESAU     ----------------------------------------------------------------------
LMX1B_HUMAN     ----------------------------------------------------------------------
LIMF_DICDI      ----------------------------------------------------------------------
LMO4_MOUSE      ----------------------------------------------------------------------
LMO4_HUMAN      ----------------------------------------------------------------------
LMO4_BOVIN      ----------------------------------------------------------------------
LMO4A_XENLA     ----------------------------------------------------------------------
PRIC1_DROPS     ----------------------------------------------------------------------
ESN_DROPS       ----------------------------------------------------------------------
TES_RABIT       ----------------------------------------------------------------------
LMX1A_HUMAN     ----------------------------------------------------------------------
ESN_DROME       ----------------------------------------------------------------------
TRIP6_MOUSE     ---------------------------------------------------------------FHIGCFV
RGA1_SCHPO      --------------------------------------------CASCGQVISGQYVRALGNIYHLECFR
PRIC1_ANOGA     ----------------------------------------------------------------------
LIN11_CAEEL     ----------------------------------------------------------------------
LIM_HALRO       ----------------------------------------------------------------------
TES_AOTNA       ----------------------------------------------------------------------
PRIC2_MOUSE     ----------------------------------------------------------------------
LHX9_XENLA      ----------------------------------------------------------------------
TES_SAIBB       ----------------------------------------------------------------------
TES_PIG         ----------------------------------------------------------------------
TES_CALMO       ----------------------------------------------------------------------
TES_ATEGE       ----------------------------------------------------------------------
LMO4B_XENLA     ----------------------------------------------------------------------
PRIC2_HUMAN     ----------------------------------------------------------------------
TRIP6_BOVIN     ---------------------------------------------------------------FHVGCFV
TES_XENLA       ----------------------------------------------------------------------
TES_PAPAN       ----------------------------------------------------------------------
TES_OTOGA       ----------------------------------------------------------------------
TES_NEONE       ----------------------------------------------------------------------
TES_MUNRE       ----------------------------------------------------------------------
TES_MUNMU       ----------------------------------------------------------------------
TES_FELCA       ----------------------------------------------------------------------
TES_EULMM       ----------------------------------------------------------------------
TES_DASNO       ----------------------------------------------------------------------
TES_CERAE       ----------------------------------------------------------------------
TES_ATEAB       ----------------------VGDVKLPHEMESQGPNKMHIPGGDRSTTAAVGAIASKSAEHKRTQCYC
LMX1A_MOUSE     ----------------------------------------------------------------------
LMX1A_MESAU     ----------------------------------------------------------------------
TES_LOXAF       ----------------------------------------------------------------------
TRIP6_HUMAN     ---------------------------------------------------------------FHVGCFV
TES_SHEEP       ----------------------------------------------------------------------
TES_PONAB       ----------------------------------------------------------------------
TES_PANTR       ----------------------------------------------------------------------
TES_HYLLE       ----------------------------------------------------------------------
TES_HUMAN       ----------------------------------------------------------------------
TES_HORSE       ----------------------------------------------------------------------
TES_COLGU       ----------------------------------------------------------------------
TES_CANFA       ----------------------------------------------------------------------
TES_MUSPF       ----------------------------------------------------------------------
TES_MONDO       ----------------------------------------------------------------------
TES_CALJA       ----------------------------------------------------------------------
PRIC1_MOUSE     ---------------------------------------RAVMHCEQCGLQMNGGEVAVFASRWHPSCFV
PRIC1_HUMAN     ---------------------------------------RAVMHCEQCGLKINGGEVAVFASRWHPSCFV
TES_MICMU       ----------------------------------------------------------------------
RBTN2_MOUSE     ------------------------------------PSEEPVLTCGGCQQNIGDRYLKAIDQYWHEDCLS
RBTN2_HUMAN     ------------------------------------PSEEPVLTCGGCQQNIGDRYLKAIDQYWHEDCLS
RBTN2_BOVIN     ------------------------------------PSEEPVLTCGGCQQNIGDRYLKAIDQYWHEDCLS
TES_BOVIN       ----------------------------------------------------------------------
CRIP3_HUMAN     --------------------------------------------CPRCQQPVFAEKVSSLGKNWHRFCLK
RBTN2_XENTR     --------------------------------------------------------LKAIDQYWHEDCLS
RBTN2_XENLA     --------------------------------------------------------LKAIDQYWHEDCLS
TES_RAT         ----------------------------------------------------------------------
TES_MOUSE       ----------------------------------------------------------------------
RBTN2_DANRE     --------------------------------------------------------LKAIEQYWHEDCLS
LIMG_DICDI      ------------------PFKSTDNIKTSNFKKYHEQCFSQDLNCSKCSGPASAEHKQVLGKIYHSKCFT
CSRP2_RAT       ----------------------------------------------------------------------
CRIP2_PONAB     --------------------------------------------CPKCDKTCFAEKVSSLGKDWHKFCLK
PRIC1_RAT       --------------------------------------------CEQCGLQMNGGEVAVFASRWRPSCFV
CRIP2_HUMAN     ----------------------------------------------------------------------
TES_CHICK       ----------------------------------------------------------------------
TES_RHIFE       ----------------------------------------------------------------------
CSRP2_MOUSE     ----------------------------------------------------------------------
CRIP2_BOVIN     ----------------------------------------------------------------------
CSRP2_HUMAN     ----------------------------------------------------------------------
CSRP2_BOVIN     ----------------------------------------------------------------------
PRIC3_HUMAN     ----------------------------------------------------------------------
CSRP3_MOUSE     ----------------------------------------------KCGACEKAEEIQCNGRSFHKTCFH
CRIP2_MOUSE     ----------------------------------------------------------------------
CSRP2_COTJA     ----------------------------------------------------------------------
CSRP3_RAT       ----------------------------------------------KCGACDKAEEIQCNGRSFHKTCFH
CSRP3_BOVIN     ----------------------------------------------KCGACEKAEEIQCNGRSFHKTCFH
CRIP2_RAT       ----------------------------------------------------------------------
HM14_CAEEL      -----------------DNHIVMCSTGLLSPQEDFHPNNEEAI-CSLCDKKIRDRVSKVNGRCYHSSCLR
CSRP3_HUMAN     ----------------------------------------------KCGACEKAEEIQCNGRSFHKTCFH
CSRP2_CHICK     ----------------------------------------------------------------------
MEC3_CAEBR      --------------------------------------------CYCCNEQIFDRICRMDNRSYHENCVK
AWH_DROME       --------------------------------------------CAACGEPISDRFLEVGGCSWHAHCLR
LHX9_DANRE      ----------------------------------------------------------------------
Y1927_ARATH     ----------------------------------------------------------------------
PXL1_YEAST      ----------------------------------------------------------------------
PRIC3_MOUSE     ----------------------------------------------------------------------
LIMK_DICDI      ------------------------------------------------------ERVKAGTSVFHAKCFV
LIMC_DICDI      -------------------------------------------NCPKCGKKAYFNELKVNSRDWHKTCFA
LHX9_CHICK      ----------------------------------------------------------------------
MEC3_CAERE      --------------------------------------------CNCCNEQIYDRIYRMDNHSYHENCVK
ZN420_HUMAN     -----------------------------------HTGEKPY-ECKECGKACGSQLSQHQKIHNGEKPYE
CRIP1_RAT       ----------------------------------------------------------------------
CRIP1_MOUSE     ----------------------------------------------------------------------
CRIP1_HUMAN     ----------------------------------------------------------------------
CRIP1_BOVIN     ----------------------------------------------------------------------
MEC3_CAEEL      -------------------------------------------------------IYRMDNRSYHENCVK
ZN571_HUMAN     -----------------------------------HTNEKPY-QCNACGKAFGSQLTEHQRVHTGEKPYE
LRG1_YEAST      --------------------------------------------------------LKALGKYYHESCFT
ZN571_PONAB     -----------------------------------HTNEKPY-QCNACGKAFGSQLTEHQRVHTGEKPYE
VILI_CHICK      ----------------------------------------------------------------------
CSRP1_RAT       ----------------------------------------------------------------------
CSRP1_MOUSE     ----------------------------------------------------------------------
CSRP1_HUMAN     ----------------------------------------------------------------------
CSRP1_BOVIN     ----------------------------------------------------------------------
YS029_HUMAN     -----------------------------------HTGEKPY-DCKECGKSFTSALIRHQRIHTGEKPYD
RGA3_SCHPO      ----------------------------------------------------------------------
LMO41_XENTR     -------------------------------------------------------------RYWHTRCLK
CSRP1_PONAB     ----------------------------------------------------------------------
CSRP1_COTJA     ----------------------------------------------------------------------
CSRP1_CHICK     ----------------------------------------------------------------------
MLP2_DROME      ---------------------------------------RPGEGCPRCG----GVVYAAEQKEWHKKCFN
LMCD1_PIG       ----------------------------------------------------------------------
LMCD1_HUMAN     ----------------------------------------------------------------------
ZFP59_MOUSE     -----------------------------------HSEEKP-FECEECGKKFRTHLVKHQRIHSGEKPFE
LMCD1_MOUSE     ----------------------------------------------------------------------
ZSC12_PONPY     -----------------------------------HTGDRPY-KCEECGKAFRGRTVLIRHKIIHTKPYK
ZSC12_MACNE     -----------------------------------HTGDRPY-KCEECGKAFRGRTVLIRHKIIHTKPYK
PRIC4_HUMAN     --------------------------------------------CEKCRELLKPGEYGVEQRCWHQPCFA
ZSC12_PANTR     -----------------------------------HTGDRPY-RCEECGKAFRGRTVLIRHKIIHTKPYK
PDLI3_CHICK     ------------------------------------PGAQKVPQCDKCGSGILGTVVKARDKYRHPECFV
LMCD1_BOVIN     ----------------------------------------------------------------------
ZSC12_PANPA     -----------------------------------HTGDRPY-KCEECGKAFRGRTVLIRHKIIHTKPYK
ZSC12_HUMAN     -----------------------------------HTGDRPY-KCEECGKAFRGRTVLIRHKIIHTKPYK
ZSC12_GORGO     -----------------------------------HTGDRPY-KCEECGKAFRGRTVLIRHKIIHTKPYK
ZN479_HUMAN     -----------------------------------HTGEKPY-RCEECGKAFSWSANLTRHKRTHTKPYT
ZN141_HUMAN     -----------------------------------HAGEKPYT-CEECGKAFKWSLIFNEHKRIHTKPFT
ZN734_HUMAN     -----------------------------------HTGEKPYT-CEECGQAFRRSSALTNHKRIHTRPYK
ZN345_BOVIN     -----------------------------------HTGEKPY-ECKECGKAFSSGLIRHQIIHSGEKPYE
ZN774_HUMAN     -----------------------------------HTGEKPYLECHKSFSRSSNFITHQRT-HTGVKPYR
ZN733_HUMAN     -----------------------------------HTGEKPYT-CEECGQAFRRSSALTNHKRIHTRPYK
ZN540_HUMAN     -----------------------------------HAGKKPY-ECKECGKSVRGQLNRHKTIHTGIKPFA
PDLI3_RAT       --------------------------------------------CDKCGSGIVGAVVKARDKYRHPECFV
ZN283_MACFA     -----------------------------------HTGEKPY-ECKECGKASRGYHLTQHQKHIGVKSYK
VILI_HUMAN      ----------------------------------------------------------------------
PDLI3_PIG       --------------------------------------------CDKCGSGIVGAVVKARDKYRHPECFV
PDLI3_MOUSE     --------------------------------------------CDKCGSGIVGAVVKARDKYRHPECFV
PDLI3_BOVIN     --------------------------------------------CDKCGSGIVGAVVKARDKYRHPECFV
LASP1_CAEEL     ----------------------------------------------------------------------
ZN594_HUMAN     --------------------------------------------CNQCGRAFQGDLIRHQVTHTREKPYE
PDLI3_HUMAN     --------------------------------------------CDKCGSGIVGAVVKARDKYRHPECFV
AVIL_MOUSE      ----------------------------------------------------------------------
ZO71_XENLA      -----------------------------------HTGEKPFCECGKCFSSSSGLTAHQQRTHMKVKPFS
ZN615_PONAB     -----------------------------------HTGEKPFI-CNKCGKTLKNSLITHQQTHTEEKLYT
VILI4_ARATH     ----------------------------------------------------------------------
LASP1_MOUSE     ----------------------------------------------------------------------
ZNF81_HUMAN     -----------------------------------HTREKPY-KCNECGKSFVSSLLRHQTTHTGEKLFE
ZN615_HUMAN     -----------------------------------HTGEKPFI-CNKCGKTLKNSLITHQQTHTGEKLYT
ZN595_HUMAN     -----------------------------------HTGEKPY-KCKECGKAFRQSRSLNEHKNIHTKPYT
ZN540_PONAB     -----------------------------------HAGKKPY-ECKECGKSVRGQLNRHKAIHTGIKPFA
CRIP3_MOUSE     ----------------------------------------------------------------------
ZN836_HUMAN     -----------------------------------HTTEKPY-KCNECGKAFRGSLLTIQIVHTRGKPYQ
ZN267_HUMAN     -----------------------------------HTGEKPY-KCKECGKAFNRSLTQHQTTHTGEKLYK
LASP1_RAT       ----------------------------------------------------------------------
LASP1_RABIT     ----------------------------------------------------------------------
LASP1_PONAB     ----------------------------------------------------------------------
LASP1_HUMAN     ----------------------------------------------------------------------
ZN260_HUMAN     ----------------------------------HHTGEKPY-ECEKVSIQMP-TIIRHQKNHTGTKPYA
LASP1_DROME     ----------------------------------------------------------------------
ZN222_HUMAN     --------------------------------------------CDECGKSCYISALHIQRVHMGVKCYK
ZN155_HUMAN     -----------------------------------HTGEKPY-RCEQCGKGFIGRLYKHQVVHTGEKPYN
ZNF28_HUMAN     -----------------------------------HTAEKPY-KCEECDKVCKSHLERHRRIHTGEKPYK
ZN676_HUMAN     -----------------------------------HAEEKPY-KCEECGKASNSSSKLMEHKRIHTKPYK
ZN283_HUMAN     -------------------------YRKSKSLTPHHNTEKSYV-CKECGKACSHGSKLVQHERTHTKHFE
VILI_BOVIN      ----------------------------------------------------------------------
ZN546_HUMAN     -----------------------------------HTGEKPYI-CNECGKAFRGELTRHHRIHTCEKPYE
ZN275_HUMAN     -----------------------------------HSREKP-FDCEECGRSFKTHLFRHQKLHTSEKPFA
ZN268_HUMAN     -----------------------------------HTGVKPY-GCSQCAKTLKSQLIVHQRSHTGVKPYG
ZBT41_HUMAN     -----------------------------------HSQDKP-FKCTYCEEHFKSRFARLKHQEFHLGPFP
QUAI_DROME      ----------------------------------------------------------------------
PDLI4_RAT       --------------------------------------------CTRCGHGIVGTIVKARDKLYHPECFM
PDLI4_MOUSE     --------------------------------------------CTRCGHGIVGTIVKARDKLYHPECFM
PDLI4_HUMAN     --------------------------------------------CTRCGHGIVGTIVKARDKLYHPECFM
PDLI4_BOVIN     --------------------------------------------CTRCGHGIVGTIVKARDKLYHPECFM
ZNF30_HUMAN     -----------------------------------HTGEKPY-ECKECGKSFTGQLTRHQSIHTGEKPFE
ZN253_HUMAN     -----------------------------------HTGEKPY-RCEECGKAFKQSSNLTTHKKIHTKPYK
ZBT41_MOUSE     -----------------------------------HSQDKP-FKCTYCEEHFKSRFARLKHQEFHLGPFP
VILI_MOUSE      ----------------------------------------------------------------------
PDLI4_CHICK     --------------------------------------------CTRCGNGIVGTIVKARDKLYHPECFM
ZN737_HUMAN     -----------------------------------HSGEKPY-KCEECGKAFKRSSNLTTHKIIHTKPYK
ZN616_HUMAN     -----------------------------------HTTEKPY-KCNECGKAFHRASLLTVHKVVHTKSYQ
ZN287_PONPY     -----------------------------------HTGKKPY-KCNECWKVFSQSLIRHQRIHSGEKCYK
ZN287_HUMAN     -----------------------------------HTGKKPY-KCNECWKVFSQSLIRHQRIHSGEKCYK
ZN252_CANFA     -----------------------------------HTGEKPY-GCSECGKTFKGHLIQHQRIHTGEKPYE
ZN197_HUMAN     -----------------------------------HKGEEPY-KCNKCQKALKKSLILHQRIHSGEKPYK
RGA1_YEAST      ----------------------------------------------------------------------
PDLI3_XENLA     --------------------------------------------CDRCGNGIVGTVVKAKDKLRHPDCFV
LIMA1_MOUSE     ----------------------------------------------------------------------
ZN560_HUMAN     -----------------------------------HTGEKP-FKCYKCGKPFTSSALRIHMRHTEERLYQ
ZN287_MOUSE     -----------------------------------HTGKKPY-KCNECWKVFSQSLIRHQRIHSGEKCYK
ZN271_MOUSE     -----------------------------------HTGEKPY-PCNQCTKSFSSDLINHQRIHTGEKPYP
VILI1_ARATH     ----------------------------------------------------------------------
VILD_DICDI      ----------------------------------------------------------------------
ZN675_HUMAN     ---------------------------------------------------------RHKIKHMENKPFK
ZN493_HUMAN     ---------------------TLTKHKIIHTEEKSH-------RCEECGKAYKESSHLTTHKRIHTKPYK
ZN347_HUMAN     -----------------------------------HTGEKPY-KCHECGKVFRSHLARHQLIHTGEKPYK
ZN225_HUMAN     -----------------------------------HTGEKPY-NCKECGKSFRSGLSRHVRVHSGETTFK
ZN160_HUMAN     -----------------------------------HSGEKPY-KCSECGKTVRSNLTIHQVIHTGEKPYK
ZFP30_MOUSE     -----------------------------------HTGEKPY-ECKECGKAFRAHLSRHQRIHASDKLYE
PDLI1_HUMAN     --------------------------------------------CDKCGTGIVGVFVKLRDRHRHPECYV
PDLI1_BOVIN     --------------------------------------------CDKCGTGIVGVFVKLRERHRHPECYV
LASP1_BOVIN     ----------------------------------------------------------------------
ZNF43_HUMAN     -------------------------------------TEKKPYKCEECGKAFKWSSKLTEHKLTHTKPYK
ZN429_HUMAN     ---------------------------------------------------------RYKTRHTGKKPFQ
ZFP82_HUMAN     -----------------------------------HTGEKPY-ECKECGMAFRAHLTRHQRLHSGEKLYE
PRDM9_MOUSE     -----------------------------------HTGEKPYV-CRECGRGFKSDLIKHQRTHTGEKPYV
OZF_MOUSE       -----------------------------------HTGEKPFI-CKECGKTFSGKSNLTEHEKIHIKPFK
OZF_BOVIN       -----------------------------------HTGEKPFI-CKECGKTFSGKSNLTEHEKIHIKPFK
NRAP_MOUSE      ----------------------------------------------------------------------
LIMA1_HUMAN     ----------------------------------------------------------------------
ZN841_HUMAN     -----------------------------------HTGEKP-FQCNECGKVFSYYSCLARHRKIHTKPYK
ZN565_HUMAN     -----------------------------------HTGEKPY-DCKDCGKAFTSELILHQRLHTGVKPYE
ZN433_HUMAN     -----------------------------------HTGEKPY-ECKECGKACPSSVRRHERTHSRKKPYE
ZN208_HUMAN     -----------------------------------HTGEKPY-KCEECGKAFNWSSNLMEHKKIHTTPYK
YS020_HUMAN     -----------------------------------HTGEKPY-KCHECGKLFNRISLLARHQRIHTKPYK
OZF_PONAB       -----------------------------------HTGEKPFV-CKECGKTFSGKSNLTEHEKIHIKPFK
OZF_HUMAN       -----------------------------------HTGEKPFV-CKECGKTFSGKSNLTEHEKIHIKPFK
ZNF85_HUMAN     --------------------------------------------CEECGKAFNWSSTLTKHKRIHTKPYK
ZN620_HUMAN     -----------------------------HRHEKCHTGEKS-FECKECGKYFRYNSLLIRHQIIHTKPFK
ZFP30_MACFA     -----------------------------------HTGEKPY-ECKECGKAFRAHLTRHQRLNIAEKCYE
ZFP28_MOUSE     -----------------------------------HTGEKPY-KCNQCGKAFSSSFARHQRCHTGKKPYE
Z354B_HUMAN     -----------------------------------HTGEKPYI-CKECGKAFSHSASLCKHLRTHTKCYR
VILI3_ARATH     ----------------------------------------------------------------------
PDLI1_RAT       --------------------------------------------CDKCGTGIVGVFVKLRDHHRHPECYV
PDLI1_MOUSE     --------------------------------------------CDKCGTGIVGVFVKLRDHHRHPECYV
NRAP_HUMAN      ----------------------------------------------------------------------
AVIL_HUMAN      ----------------------------------------------------------------------
ZNF23_HUMAN     -----------------------------------HTGEKPY-ECNECGKGCSSQLRQHQSIHTGEKPYQ
ZN813_HUMAN     -----------------------------------HTGEKP-FKCNECGKTFKSSLTCHHRLHTGEKPYK
ZN778_HUMAN     -----------------------------------HAAEKPC-ECKECGKAFTG--LSGLSKHVQTKPYE
ZN623_HUMAN     -----------------------------------HSGEKP-FKCAQCGKAFSSDLIRHQRVHTRERPFE
ZN471_HUMAN     -----------------------------------HTGEKPY-KCKECRKAFRQPAHLAQHQRIHTKPYE
ZN432_HUMAN     -----------------------------------HTGEKPYT-CSECGKPLKSRLIVHQRTHTGEKPYR
ZN136_HUMAN     -----------------------------------HTGEKPY-ECQECGKACITSVRRHMIKHTGDGPYK
ZG48_XENLA      ----------------------------------------------------KSNLVRHQRIHTGEKPFS
ZO22_XENLA      -----------------------------------HTGEKP-FSCFQCGKSFQSRLINHQRTHTGEKPFS
ZNF7_PONAB      -----------------------------------HTGEKPY-KCNKCTKACSSRLIRHQRTHTGEKPFK
ZNF7_HUMAN      -----------------------------------HTGEKPY-KCNKCTKACSSRLIRHQRTHTGEKPFK
ZN721_HUMAN     -----------------------------------HTGEKP-FKCLECGKAFN--ISTTLTKHRRIKPYT
ZN519_HUMAN     -----------------------------------HTGEKP-FKCKECGKAFNRGSYLTQHQRIHTRAFK
ZN506_HUMAN     --------------------------------------------CEECGKAYKQSSHLTTHKKIHTKPYK
ZFP62_MOUSE     ---------------------------------PAHIADKKLHKCDECGKSFKYNSRLVQHKIMHT---G
ZFP60_MOUSE     -----------------------------------HSEDRP-FHCKVCGKAFTAQLTRHENIHTEDKSFE
XIRP2_MOUSE     ----------------------------------------------------------------------
MILK1_MOUSE     ----------------------------------------------------------------------
ZN584_HUMAN     ------------------PEH-LKSYRVIQHQDTHSEG-KPRRHTHGAAFPPGSSCGQQQEVHVAEKLFK
ZN502_HUMAN     -----------------------------------HTGERPYT-CEECGKAFSRSSFLVQHQRIHVKPYG
ZN417_HUMAN     -----------------------------HQRD--HTAKGPY-DCGECGKSYKSSLIQHQRVHTGKTAYP
ZN192_PANTR     -----------------------------------HTGEKPY-QCNVCGKAFRSALLSHQDIHNKVKRYH
ZN192_PANPA     -----------------------------------HTGEKPY-QCNVCGKAFRSALLSHQDIHNKVKRYH
ZN192_HUMAN     -----------------------------------HTGEKPY-QCNVCGKAFRSALLSHQDIHNKVKRYH
ZN136_PONAB     -----------------------------------HTGEKPY-ECKECGKACITSVRRHMIKHTGDGPYK
ZN107_HUMAN     -----------------------------------HTGEKPY-KCKECGKAFNQSSNLTEHKKIHTKSYK
ZN708_HUMAN     -----------------------------------HTGEKPY-KCEECGKAFNQSSTLTRHKIIHTKLYK
ZN418_HUMAN     -----------------------------------HTGKRPY-ECGECGKSFKGSLVQHQRVHTGERPYE
ZN343_HUMAN     -----------------------------------HSEEKPYL-CRECGQSFRSKSIRHQWTHSEEKPYV
ZFP30_HUMAN     -----------------------------------HTGEKPY-ECKECGKAFRAHLTRHQRLNIAEKCYE
LIMD2_RAT       ----------------------------------------------------------------------
ZN620_PONAB     -----------------------------HRHQKCHTGEKS-FECKECGKDFRYNSLLIRHQIIHTKPFK
ZN473_MOUSE     --------------------------------------------------------LRHQKTPTNAKCFR
ZN439_HUMAN     -----------------------------HRHERSHMGEK-AYQCKECGKACPRYVRRHERTHSRKKLYE
ZN383_MACFA     -----------------------------------HIGEKSY-ECKECGKSCGSHVTRHLKIHTGEKPFE
ZN175_HUMAN     -----------------------------------HTRKKPY-KCHDCGKAFFQSLFRHQRTHSREKLYE
ZIK1_HUMAN      -------------------HYKSGECGKAHKHTPYHPTGKKLYECSKCGKAFRGKYSLVQHQRVHTRPWE
TALB_DICDI      ----------------------------------------------------------------------
LIMD2_MOUSE     ----------------------------------------------------------------------
LIMD2_HUMAN     ----------------------------------------------------------------------
ZNF91_HUMAN     -----------------------------------HTGEKPY-KCEECGKAFSHSSTLAKHKRIHTKPYK
ZNF83_HUMAN     -----------------------------------HTGEKPY-ECNKCGKVFSRNSYLVQHLIIHTKPYR
ZN846_HUMAN     -----------------------------------HSGEKPYV-CKECGKASTGLKLHIRT-HSGEKPYK
ZN568_HUMAN     -----------------------------------HTGEKPY-KCNKCGKACSVFIIHMRS-HTGEKPYV
ZN331_PONAB     ----------------------------------------------------EGTPPRTHQRHHKENSFE
ZN331_HUMAN     ----------------------------------------------------EGTPPRTHQRHHKENSFE
ZN132_HUMAN     -----------------------------------HSGERPY-ECDECGKAFRSHLIRHEKVHTGERPFE
ZNF25_HUMAN     ----------------------------------------------QAGNSRNGELTKHQKTHTTEKACE
ZN790_HUMAN     -----------------------------------HTGEKP-FKCKDCGKAFRFHSQLSVHKRIHTKSYE
ZN484_HUMAN     -----------------------------------HTGERPYI-CTVCGKAFRSNLIKHQKIHTGEKPYK
ZN224_HUMAN     --------------------------------------------CDECGKNCYISALRIQRVHMGEKCYK
ADCE_DICDI      ----------------------------------------------------------------------
ZN813_PONAB     -----------------------------------HTGEKPY-KCNECGKTFKSSLTCHHRLHTGEKPYK
ZN679_HUMAN     --------------------------------------------CEECGKPCSSTLSKHKRIHTGEKPYR
ZIK1_MOUSE      ----------------------------------HHPKTKKLYECSKCGKTFRGKYSLDQHQRVHTRPWE
ZG66_XENLA      ---------------------------IAHQQQVH--IEVKPFSCTKCGKSYRSRLVRHQRTHTGVKPYS
PDLI2_RAT       ----------------------------------------PKLHCEKCSVNISNQAVRIQEGRYHPGCYT
PDLI2_MOUSE     ----------------------------------------PKLHCEKCSVNISNQAVRIQEGRYHPGCYT
PDLI2_MACFA     ----------------------------------------PKLHCEKCSTSIANQAVRIQEGRYHPGCYT
PDLI2_HUMAN     ----------------------------------------PKLHCEKCSTSIANQAVRIQEGRYHPGCYT
PDLI2_BOVIN     ----------------------------------------PKLHCEKCNTSIANQAVRIQEGRYHPGCYT
ZNF80_CERAE     ----------------------------------------------------------------------
ZN383_HUMAN     -----------------------------------HIGEKSY-ECKECGKSCGSHVTRHLKIHTGEKPFE
ZN260_MOUSE     -----------------------------------HSGEKSP-ECTGCGE----ESSQASSLTLHLRSYK
ZN235_MOUSE     -----------------------------------HTGEKPY-KCEECGKSSASSFQSHQRVHTGEKPFH
ZN221_HUMAN     -----------------------------------HTGEKPY-NCEECGKAFDSQLQEHQRIHTGEKPFK
ZIM3_HUMAN      -----------------------------------HAEERPY-KCENCGNAYKSNLFQHQKMHTKEKPYQ
Z780B_HUMAN     -----------------------------------HTGEKP-FECKECGKSFNSNLIQHQSIHADVKPYE
Z354B_MOUSE     -----------------------------------HTGEKP-FKCSECGRAFSQSASLIQHERIHTKPYR
ZNF74_HUMAN     ----------------------------------------------------------------------
ZNF35_HUMAN     ------------------------------------------------------------------KPFT
ZN823_HUMAN     -------------------HHGDGPYKLFHLHERTHTGEKPY-ECKQCSKPFYSSYLRHERIHTGEKAYE
ZN730_HUMAN     -----------------------------------HTKEQPY-KCEKCGKAFKWSSTLTKHKRIHNKPYK
ZN682_HUMAN     ----------------------------------------------------------------------
ZN678_HUMAN     -----------------------------------HTGEKPY-KCEECGNVFNSHLTRHRRIHTGEKPYK
ZN607_HUMAN     -----------------------------------HTGEKPH-ECKECGKAFRQFSHLVGHKRIHTKPYE
ZN551_HUMAN     -----------------------------------HTGEMPY-QCSDCGKSCKSELIQHQRIHSGERPYE
ZN234_HUMAN     --------------------------------------------CDECGKSCYISALHIQRVHMGEKCYK
ZFP28_HUMAN     -----------------------------------HTGEKPY-KCNECGKAFSSSFARHQRCHTGKKPYE
Z354A_MOUSE     -----------------------------------HTGEKP-FKCSECGRAFSQSASLIQHERIHTKPYR
YS033_HUMAN     -----------------------------------HKTEKNPFKCKECGKSFCVLSHLTQHKRIHTTVNS
RBAK_MOUSE      ---------------------------------PRSQMELKPFECTQCGKSFKSKFIIHQRAHTGEKPYA
ZNF66_HUMAN     ----------------------------------------------------------------------
ZN587_HUMAN     -----------------------------HQRD--HTAKGPY-DCGECGKSYKSSLIQHQRVHTGQTAYP
ZN501_HUMAN     -----------------------------------HTGEKPY-KCTECGKAFSQSICRHQRSHSGDKPFK
ZN260_RAT       ------------------------------------------------------------------KPYA
ZFP11_MOUSE     -----------------------------------HTGEEPYI-CRECGKTFKSNLTRHQILHTGAKPYK
Z585A_PONAB     -----------------------------------HTGEKPY-ECSNCGKSSKSQLQVHQRVHTRVKPYI
XFIN_XENLA      -----------------------------------HTGEKPY-KCSDCGKEFRSNLILHQRIHTGERPYK
LIME_DICDI      ----------------------------------------------------------------------
ZNF14_PONAB     -----------------------------------HSGEKPY-ECKECGKAFSASFRAHVITHTGARPYK
ZN860_HUMAN     -----------------------------------HTGEKPY-KCNECGKAFSGQLIHHQAIHGIGKLYK
ZN665_HUMAN     -----------------------------------HTGEKPY-KCNECGKAFSSNLTKHQIIHTGEKPFK
ZN599_HUMAN     -----------------------------------HTGEKPY-KCIECGKAFKRRFHLTEHQRIHTKPYE
ZN573_HUMAN     -----------------------------------HTGGKPY-ECQECGRASQGGHLRIQRVHTGEKPYK
ZN528_HUMAN     -----------------------------------HTGEKPY-KCEECGKAVRSSLITHQLIHTGRKPYK
ZN510_HUMAN     --------------------------------------------CNECGKSFKGHLIQHQRTHTGEKPFE
ZN501_PONAB     -----------------------------------HTGEKPY-KCAECGKAFSQSVCRHQRSHSGDKPFK
ZN420_BOVIN     ----------------------------------------------------------------------
ZN337_HUMAN     -----------------------------------HSGEKPFA-CRQCKQSVKGSLLRHQRTHSGEKPFV
ZN256_HUMAN     --------------------------------------------CSECGKSFSSDHLRVHTSE---KPYT
ZN235_HUMAN     -----------------------------HSHQRVHTGEKPY-KCEECGKSSASSFQSHQRVHTGEKPFR
ZG26_XENLA      -----------------------------------HTTEKP-FPCTECGK-CFAEKKTLQNHHTGVKPFT
ZFP2_HUMAN      -----------------------------------HTGEKPY-ECSQCGKASKSSTLTLQRNHTGEKPYK
MILK2_HUMAN     ----------------------------------------------------------------------
LIMD_DICDI      ----------------------------------------------------------------------
LIMK2_CHICK     ------------------------------------PPGEEVWRCLGCGDLIAARLYRMVNEAWHISCFR
LIMK1_XENLA     --------------------------------------------CASCGQSIDGCYLQALALDWHSDCFR
LIMK1_MOUSE     -------------------------------------SELPV--CASCGQRIDGQYLQALNADWHADCFR
LIMK1_HUMAN     -------------------------------------SELPV--CASCGQRIDGQYLQALNADWHADCFR
LIMK1_RAT       -------------------------------------SELPV--CASCSQSIDGQYLQALNADWHADCFR
LIMK2_RAT       --------------------------------------------CRGCGNPLSQRLYRTANEAWHSSCFR
LIMK2_BOVIN     --------------------------------------------CQGCGDYVNQRLYRTVSEAWPTSCFR
LIMK2_HUMAN     -----------------------------------------VWRCPGCGDHIAPSQIRTVNETWHGSCFR
LIMK2_MOUSE     --------------------------------------------CRGCGTPLSQRLYRTANEAWHGSCFR
LHX4_MOUSE      -------------------------------------------------------ILKVLDRHWHSSCLK
LHX4_HUMAN      -------------------------------------------------------ILKVLDRHWHSSCLK
LIMK1_DROME     -------------------------------------------------------------QQWHCDCFR
LHX1_DANRE      -----------------------------------------MVHCAGCERPILDRLLNVLDRAWHIKCVQ
LHX1_XENLA      -----------------------------------------MVHCAGCERPILDRLLNVLDRAWHVKCVQ
LMO3_PONAB      ------------------------------------PDTKPK-GCAGCNRKIKDRLLKALDKYWHEDCLK
LMO3_MOUSE      ------------------------------------PDTKPK-GCAGCNRKIKDRLLKALDKYWHEDCLK
LMO3_HUMAN      ------------------------------------PDTKPK-GCAGCNRKIKDRLLKALDKYWHEDCLK
LMO3_BOVIN      ------------------------------------PDTKPK-GCAGCNRKIKDRLLKALDKYWHEDCLK
LHX5_RAT        -----------------------------------------MVHCAGCERPILDRLLNVLDRAWHIKCVQ
LHX5_MOUSE      -----------------------------------------MVHCAGCERPILDRLLNVLDRAWHIKCVQ
LHX5_HUMAN      -----------------------------------------MVHCAGCERPILDRLLNVLDRAWHIKCVQ
LHX5_DANRE      -----------------------------------------MVHCAGCERPILDRLLNVLDRAWHAKCVQ
ISL3_ONCTS      ----------------------------------HSKKKSGFAMCVGCGSQIHDQILRVSPDEWHAACLK
ISL2B_ONCTS     --------------------------------------------CVGCGSQIHDQILRVAPDEWHAACLK
LMO3_XENLA      ------------------------------------PDTKPK-GCAGCNRKIKDRLLKALDKYWHEDCLK
LMO3_DANRE      ------------------------------------PDTKPK-GCAGCNRKIKDRLLKALDKYWHEDCLK
LHX5_XENLA      -------------------------------------------HCAGCERPILDRLLNVLDRAWHVKCVQ
ISL2_RAT        -----------------------------------HSKKKPTAMCVGCGSQIHDQILRVSPDEWHAACLK
ISL2_MOUSE      -----------------------------------HSKKKPTAMCVGCGSQIHDQILRVSPDEWHAACLK
ISL2_HUMAN      -----------------------------------HSKKKPTAMCVGCGSQIHDQILRVSPDEWHAACLK
RBTN1_XENLA     --------------------------------------------CAGCNRKIKDRLLKALDKYWHEDCLK
RBTN1_MOUSE     --------------------------------------------CAGCNRKIKDRLLKALDKYWHEDCLK
RBTN1_HUMAN     --------------------------------------------CAGCNRKIKDRLLKALDKYWHEDCLK
RBTN1_DANRE     --------------------------------------------CAGCNRKIKDRLLKALDKYWHEDCLK
LMO3_RAT        --------------------------------------------CAGCNRKIKDRLLKALDKYWHEDCLK
LHX3_CHICK      -------------------------------------------------------ILKVLDRHWHSKCLK
ISL2A_DANRE     ----------------------------------HSKKKSGIAMCVGCGSQIHDQILRVSPDEWHAACLK
ISL1_DANRE      ------------------------------------PKKKRLISCVGCGNQIHDQILRVSPDEWHAACLK
ISL1_CHICK      ------------------------------------PKKKRLISCVGCGNQIHDQILRVSPDEWHAACLK
LHX3_DANRE      -------------------------------------------------------ILKVLDRHWHSKCLK
ISL1_RAT        ------------------------------------PKKKRLISCVGCGNQIHDQILRVSPDEWHAACLK
ISL1_MOUSE      ------------------------------------PKKKRLISCVGCGNQIHDQILRVSPDEWHAACLK
ISL1_MESAU      ------------------------------------PKKKRLISCVGCGNQIHDQILRVSPDEWHAACLK
ISL1_HUMAN      ------------------------------------PKKKRLISCVGCGNQIHDQILRVSPDEWHAACLK
ISL2B_DANRE     ----------------------------------HSKKKSGLAMCVGCGSQIHDQILRVSPDEWHAACLK
RBTN1_BOVIN     --------------------------------------------CAGCNRKIKDRLLKALDQYWHEDCLK
LHX8_HUMAN      ----------------------------------------------------------------------
LHX8_MOUSE      ----------------------------------------------------------------------
LHX3_XENLA      -------------------------------------------------------ILKVLDRHWHSKCLK
LHX3_HUMAN      -------------------------------------------------------ILKALDRHWHSKCLK
LHX9_RAT        ----------------------------------------------------------------------
LHX9_MOUSE      ----------------------------------------------------------------------
LHX9_HUMAN      ----------------------------------------------------------------------
LHX3_PIG        -------------------------------------------------------ILKALDRHWHSKCLK
LHX3_MOUSE      -------------------------------------------------------ILKALDRHWHSKCLK
LHX9_BOVIN      ----------------------------------------------------------------------
LHX2_MOUSE      ----------------------------------------------------------------------
LHX2_HUMAN      ----------------------------------------------------------------------
LHX6_MOUSE      ----------------------------------------------------------------------
LHX6_HUMAN      ----------------------------------------------------------------------
APTE_DROME      ------------------------------PSSPESTSDSKITRCSGCGRQIQDRFLSAVEKRWHASCLQ
LHX2_RAT        ----------------------------------------------------------------------
LHX9_ASTFA      ----------------------------------------------------------------------
ISL2_CHICK      ---------------------------------------------------------------WHVACLK
LMO42_XENTR     --------------------------------------------CAGCGGKIADRLLYAMDSYWHSRCLK
LMX1B_CHICK     --------------------------------------------CEGCQRPISDRFLRVNESSWHEECLQ
LHX9_RANRU      ----------------------------------------------------------------------
LMX1B_MOUSE     --------------------------------------------CEGCQRPISDRFLRVNESSWHEECLQ
LMX1B_MESAU     --------------------------------------------CEGCQRPISDRFLRVNESSWHEECLQ
LMX1B_HUMAN     --------------------------------------------CEGCQRPISDRFLRVNESSWHEECLQ
LMO4_MOUSE      --------------------------------------------CAGCGGKIADRLLYAMDSYWHSRCLK
LMO4_HUMAN      --------------------------------------------CAGCGGKIADRLLYAMDSYWHSRCLK
LMO4_BOVIN      --------------------------------------------CAGCGGKIADRLLYAMDSYWHSRCLK
LMO4A_XENLA     --------------------------------------------CAGCGGKIGDRLLYSMDRYWHTRCLK
LMX1A_HUMAN     -------------------------------------------------------LLRLNDSFWHEQCVQ
LIM_HALRO       -------------------------------------------------------ILKVQDKPWHSQCLK
LHX9_XENLA      ----------------------------------------------------------------------
LMO4B_XENLA     --------------------------------------------CAGCGGKIADRLLYSMDRYWHTRCLK
LMX1A_MOUSE     -------------------------------------------------------LLRLNDSFWHEQCVQ
LMX1A_MESAU     -------------------------------------------------------LLRLNDSFWHEQCVQ
RBTN2_MOUSE     ----------------------------------------------------------------------
RBTN2_HUMAN     ----------------------------------------------------------------------
RBTN2_BOVIN     ----------------------------------------------------------------------
RBTN2_XENTR     ----------------------------------------------------------------------
RBTN2_XENLA     ----------------------------------------------------------------------
RBTN2_DANRE     ----------------------------------------------------------------------
HM14_CAEEL      ----------------------------------------------------------------------
MEC3_CAEBR      ----------------------------------------------------------------------
LIMK_DICDI      ----------------------------------------------------------------------
MEC3_CAERE      ----------------------------------------------------------------------
MEC3_CAEEL      ----------------------------------------------------------------------
LMO41_XENTR     ----------------------------------------------------------------------
LMCD1_PIG       ------------------------------------PADSPVVYSDRAG----------YSKQWHPACFV
LMCD1_HUMAN     ------------------------------------PPDSPVVYSDRAG----------YNKQWHPTCFV
LMCD1_MOUSE     ------------------------------------PVDSPVVYADRAG----------YSKQWHPTCFQ
PRIC4_HUMAN     ----------------------------------------------------------------------
PDLI3_CHICK     ----------------------------------------------------------------------
LMCD1_BOVIN     ------------------------------------PADSPVVYSDRAG----------YSKQWHPACFV
PDLI3_RAT       ----------------------------------------------------------------------
PDLI3_PIG       ----------------------------------------------------------------------
PDLI3_MOUSE     ----------------------------------------------------------------------
PDLI3_BOVIN     ----------------------------------------------------------------------
PDLI3_HUMAN     ----------------------------------------------------------------------
PDLI4_RAT       ----------------------------------------------------------------------
PDLI4_RAT       ----------------------------------------------------------------------
PDLI4_MOUSE     ----------------------------------------------------------------------
PDLI4_MOUSE     ----------------------------------------------------------------------
PDLI4_HUMAN     ----------------------------------------------------------------------
PDLI4_HUMAN     ----------------------------------------------------------------------
PDLI4_BOVIN     ----------------------------------------------------------------------
PDLI4_BOVIN     ----------------------------------------------------------------------
PDLI4_CHICK     ----------------------------------------------------------------------
PDLI4_CHICK     ----------------------------------------------------------------------
PDLI3_XENLA     ----------------------------------------------------------------------
LIMA1_MOUSE     ------------------------------------PAKESCVECQKTVYPM--ERLLANQQVFHISCFR
LIMA1_HUMAN     ------------------------------------PARETCVECQKTVYPM--ERLLANQQVFHISCFR
LIMD2_RAT       ---------------------------------------------------------------FHNSCFC
LIMD2_MOUSE     ---------------------------------------------------------------FHNSCFC
LIMD2_HUMAN     ---------------------------------------------------------------FHNSCFC


                         .         .         *         .         .         .         .:140
query           CKVCGCDLAQGGFFIKNGEYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPG
ABLM1_HUMAN     CKVCGCDLAQGGFFIKNGEYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPG
ABLM1_MOUSE     CKVCGCDLAQGGFFIKNGDYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPG
ABLM3_HUMAN     CQVCGCGLAQSGFFFKNQEYICTQDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSLCRKPFPIG
ABLM3_MOUSE     CQVCGCGLAQSGFFFKNQEYICTQDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSLCRKPFPIG
ABLM2_RAT       CKACGCDLAEGGFFVRQGEHICTRDYQRLYGTRCFSCDCFIEGEVVSALGKTYHPDCFVCAVCRLPFPPG
ABLM2_HUMAN     CKACGCDLAEGGFFVRQGEYICTLDYQRLYGTRCFSCDQFIEGEVVSALGKTYHPDCFVCAVCRLPFPPG
ABLM2_MOUSE     CKACGCDLAEGGFFVRQGEHICTRDYQRLYGTRCFSCDRFIEGEVVSALGKTYHPDCFVCAVCRLPFPPG
DEMA_BOVIN      ----------------------------------------------------------------------
DEMA_PONAB      ----------------------------------------------------------------------
DEMA_HUMAN      ----------------------------------------------------------------------
DEMA_MOUSE      ----------------------------------------------------------------------
PXL1_CAEEL      CCECGAELGQRPFFERNGRAFCEEDYHNQFSPKCQGCHRAITDRCVSVMNKNFHIECFTCAECNQPF---
PAXB_DICDI      CHNCQNPLGTKNYYEQESLPHCEKCYQELFCARCAHCDEPISDRCITALGKKWHVHHFVCTQCLKPFEGG
PAXI_PONAB      CTHCQEEIGSRNFFERDGQPYCEKDYHNLFSPRCYYCNGPILDKVVTALDRTWHPEHFFCAQCGAFFGPE
PAXI_HUMAN      CTHCQEEIGSRNFFERDGQPYCEKDYHNLFSPRCYYCNGPILDKVVTALDRTWHPEHFFCAQCGAFFGPE
PAXI_CHICK      CTHCQEEIGSRNFFERDGQPYCEKDYHNLFSPRCYYCNGPILDKVVTALDRTWHPEHFFCAQCGVFFGPE
PAXI_RAT        CTHCQEEIGSRNFFERDGQPYCEKDYHSLFSPRCYYCNGPILDKVVTALDRTWHPEHFFCAQCGAFFGPE
PAXI_MOUSE      CTHCQEEIGSRNFFERDGQPYCEKDYHSLFSPRCYYCNGPILDKVVTALDRTWHPEHFFCAQCGAFFGPE
LPXN_HUMAN      CTHCKEEIGSSPFFERSGLAYCPNDYHQLFSPRCAYCAAPILDKVLTAMNQTWHPEHFFCSHCGEVF---
TGFI1_XENLA     CAHCHTLIGTSNFFEKDGRPYCEKDYFMLYAPRCALCELPIVQNMVTALGCTWHPEHFCCKVCKKPI---
LPXN_MOUSE      CTHCKEELGSSPFFERSGLAYCSKDYHRLFSPRCAYCAAPITDKVLTAMNKTWHPEHFFCSHCGEVF---
FHL3_BOVIN      CCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVGSRKLEYGGQTWHEHCFLCSGCEQPLGSR
LIMS2_HUMAN     CELCDVELADLGFVKNAGRHLCRPCHNREKAKGCQRCHLVIDEQPLMFRSDAYHPDHFNCTHC------G
LIMS2_BOVIN     CELCDVELADLGFVKNAGRHLCRPCHNREKAKGCQRCHLVIDEQPLMFKNDAYHPDHFSCTHC------G
TGFI1_HUMAN     CGGCSTALGGSSFFEKDGAPFCPECYFERFSPRCGFCNQPIRHKMVTALGTHWHPEHFCCVSCGEPF--G
TGFI1_BOVIN     CGGCSTALGGSSFFEKDGAPFCPECYFERFSPRCGLCNQPIRHKMVTALGTHWHPEHFCCVSCGEPF--G
FHL3_HUMAN      CCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVGSRKLEYGGQTWHEHCFLCSGCEQPLGSR
FHL3_MOUSE      CCRCQRSLADEPFTCQDSELLCNECYCTAFSSQCSACGETVGSRKLEYGGQTWHEHCFLCSGCEQPLASR
FHL2_RAT        CSRCGSSLVDKPFAAKEEQLLCTDCYSNEYSSKCQECKKTIGTRKMEYKGSSWHETCFTCQRCQQPIGTK
LIMS2_MOUSE     CAQCFRPFPEGLFYEFEGRKYCEHDFQMLFAPCCGFCGEFVIGRVIKAMNANWHPGCFRCELCDRPCHNR
FHL2_MOUSE      CSRCGSSLVDKPFAAKEEQLLCTDCYSNEYSSKCQECKKTIGTRKMEYKGSSWHETCFTCQRCQQPIGTK
FHL1_RAT        CAKCLHPLASETFVSKDGKILCNKCATREDSPRCKGCFKAIVAQNVEYKGTIWHKDCFTCSNCKQVIGTG
FHL1_MOUSE      CAKCLHPLASETFVSKDGKILCNKCATREDSPRCKGCFKAIVAQNVEYKGTVWHKDCFTCSNCKQVIGTG
LIMS1_MOUSE     ---------EGLFYEFEGRKYCEHDFQMLFAPCCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADI
LIMS1_HUMAN     ---------EGLFYEFEGRKYCEHDFQMLFAPCCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADI
UNC97_CAEEL     CEICNKQLADVGFLRNAGRALCRECNEREKAAGCHKCHAMIDGQHIKFRGDSFHPYHFKCKRCNNELTTA
FHL5_RAT        CNKCHHSLVEKPFVAKDERLLCTDCYSNECSSKCFHCKRTIGSRKMEFKGNYWHETCFVCEHCRQPIGTK
FHL2_HUMAN      CSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIGTRKMEYKGSSWHETCFICHRCQQPFIPK
FHL5_MOUSE      CNKCHHSLVEKPFVAKDDRLLCTDCYSNECSSKCFHCKRTIGSRKMEFKGNYWHETCFVCEHCRQPIGTK
TGFI1_RAT       CRGCSTTLGGSSFFEKDGAPFCPECYFERFSPRCGFCNQPIRHKMVTALGTHWHPEHFCCVSCXXXXXXX
FHL2_BOVIN      CSRCRGSLVDKPFAAKEDQLLCTDCYSQEYSSRCQECKKSIGTRKMEYKGSSWHETCFICHRCQQPFIPK
FHL5_BOVIN      CTKCNHSLVEKPFAAKDERLLCSECYSNECSSKCFHCKKTIGSRKMEFKGNYWHETCFVCEHCRQPIGTK
PDLI7_CHICK     CCQCRKVLDEGGFFEEKGSIFCPKCYDTRYAPSCAKCKKKITGEVMHALKMTWHVQCFTCAACKTPI--R
PDLI7_MOUSE     ---------------------------------CHQCHKIIRGRYLVALGHAYHPEEFVCSQCGKVLEEG
LIMK1_CHICK     ----------------------------------------------------------------------
FHL5_HUMAN      CTKCNHSLVEKPFAAKDERLLCTECYSNECSSKCFHCKRTIGSRKMEFKGNYWHETCFVCENCRQPIGTK
FHL5_MACFA      CTKCNHSLVEKPFAAKDERLLCTECYSNECSSKCFHCKRTIGSRKMEFKGNYWHETCFVCENCRQPIGTK
PDLI7_XENLA     ---------------------------------CSQCNKIIRGRFLLALGRYYHPEEFTCSQCHKVLEEG
LIMK2_CHICK     ----------------------------------------------------------------------
PDLI7_RAT       ---------------------------------CHQCHKIIRGRYLVALGHAYHPEEFVCSQCGKVLEEG
PDLI7_BOVIN     ---------------------------------CHQCHKVIRGRYLVALGRAYHPEEFVCSQCGKVLEEG
PIN2_CAEEL      CDECNVHLNSQIAYRYQGTILCFLCNQKKPKMRCNKCKQHVDNDLLTYQENPYHAYHFKCTTCKKVLESD
PDLI7_DANRE     ---------------------------------CAACSKIIRGRYVVALGRSWHPEEFMCCQCKRLLDEG
PDLI5_RAT       CAHCKNTMAYIGFVEEKGALYCELCYEKFFAPECGRCQRKILGEVINALKQTWHVSCFVCVACGKPIRNN
PDLI7_HUMAN     ---------------------------------CHQCHKVIRGRYLVALGHAYHPEEFVCSQCGKVLEEG
PDLI5_MOUSE     ---------------------------------CAHCNQVIRGPFLVALGKSWHPEEFNCAHCKNTMAYI
PDLI5_HUMAN     ---------------------------------CAHCNQVIRGPFLVALGKSWHPEEFNCAHCKNTMAYI
LIMK1_XENLA     ----------------------------------------------------------------------
FHL1_HUMAN      CAKCLHPLANETFVAKDNKILCNKCTTREDSPKCKGCFKAIVAQNVEYKGTVWHKDCFTCSNCKQVIGTG
LIMK1_MOUSE     ----------------------------------------------------------------------
LIMK1_HUMAN     ----------------------------------------------------------------------
LIMK1_RAT       ----------------------------------------------------------------------
LDB3_HUMAN      CAYCKTSLADVCFVEEQNNVYCERCYEQFFAPLCAKCNTKIMGEVMHALRQTWHTTCFVCAACKKPF---
LIMB_DICDI      CTYC--KLPFSGSFIEHEEKLCENDYLELFSPRCFACIKPIEDTCINALGNRYHPECFSCSGCGKPYKEE
LIMK2_RAT       ----------------------------------------------------------------------
WTIP_DANRE      CCSCGRRLRGKAFYNVNGKVYCEEDFLQQTAEKCFVCGHLIMEMILQALGRSYHPGCFRCVICKEGL---
LIMK2_BOVIN     ----------------------------------------------------------------------
LIMK2_HUMAN     ----------------------------------------------------------------------
LDB3_MOUSE      CAYCKTSLADVCFVEEQNNVYCERCYEQFFAPICAKCNTKIMGEVMHALRQTWHTTCFVCAACKKPF---
LIMK2_MOUSE     ----------------------------------------------------------------------
ZYX_MOUSE       CHXXXXXXXXXXFYSLEGAPYCEGCYTDTL-EKCNTCGQPITDRMLRATGKAYHPQCFTCVVCACP----
ZYX_HUMAN       CHXXXXXXXXXXFYSLEGAPYCEGCYTDTL-EKCNTCGEPITDRMLRATGKAYHPHCFTCVVCARPLEGT
YOCC_SCHPO      CDTCSQNLEHVGFYYREGKFYCHLDYHEQFSPRCKHCKTPIEDQAVHINNDWFHENHHFCAGCSEVFNVN
LHX4_MOUSE      ----------------------------------------------------------------------
LHX4_HUMAN      ----------------------------------------------------------------------
TGFI1_MOUSE     XXXXXXXXXXXXXXEKDGAPFCPECYFERFSPRCGFCNQPIRHKMVTALGTHWHPEHFCCVSCXXXXXXX
FBLI1_PONAB     CRTCRRQLAGQSFYQKDGRPLCEPCYQDTL-ERCGKCGEVVRDHIIRALGQAFHPSCFTCVTCARCI--G
FBLI1_BOVIN     CRVCRRQLAGQSFYQKDGRPLCEPCYQDTL-EKCGKCGEVVREHIIRALGQAFHPSCFTCVTCARRI--G
WTIP_HUMAN      CDSCGRRLRGKAFYNVGEKVYCQEDFLQQTADKCSVCGHLIMEMILQALGKSYHPGCFRCSVCNECL---
FBLI1_HUMAN     CRTCRRQLAGQSFYQKDGRPLCEPCYQDTL-ERCGKCGEVVRDHIIRALGQAFHPSCFTCVTCARCI--G
LIMK1_DROME     ----------------------------------------------------------------------
WTIP_XENLA      CCSCGRRLRGKAFYNVNGKVYCEEDFLQQTADKCFVCGHLIMEMILQALGKSYHPGCFRCVVCNECL---
FBLI1_MOUSE     CRTCRRQLAGQRFYQKDGRPLCEPCYQDTL-EKCGKCGEVVQEHVIRALGKAFHPPCFTCVTCARCISDE
LIMCH_DICDI     CDSCNKNLNQNDQIKKSGNPLXXXXXXXXXXXXXXXXXXXISGSSVEALDRPYHPNCLKCYSCSKNLK--
LIMD1_MOUSE     CAACSRKLRGKAFYFVNGKVFCEEDFLQQSADRCFLCGHLIMDMILQALGKSYHPGCFRCVICNECL---
LIMD1_HUMAN     CAACSRKLRGKAFYFVNGKVFCEEDFLQQSADRCFLCGHLIMDMILQALGKSYHPGCFRCVICNECL---
Y6787_DICDI     ---------------------------------CYSCKQPITEICLTAFGLQWHPHHIGCNVCGKDFSDG
LHX1_SAIBB      ----------------------------------------------------------------------
LHX1_RAT        ----------------------------------------------------------------------
LHX1_PANTR      ----------------------------------------------------------------------
LHX1_MOUSE      ----------------------------------------------------------------------
LHX1_MESAU      ----------------------------------------------------------------------
LHX1_HUMAN      ----------------------------------------------------------------------
LHX1_DANRE      ----------------------------------------------------------------------
LHX1_CHICK      ----------------------------------------------------------------------
WTIP_MOUSE      CDSCGRRLRGKAFYNVGEKVYCQEDFLQQTADKCSVCGHLIMEMILQALGKSYHPGCFRCSVCNECL---
LHX1_XENLA      ----------------------------------------------------------------------
LPP_RAT         CMVCDIKLRGQPFYAVEKKAYCEPCYINTL-EQCSVCSKPIMERILRATGKAYHPHCFTCVMCHRSL---
LMO3_PONAB      ----------------------------------------------------------------------
LMO3_MOUSE      ----------------------------------------------------------------------
LMO3_HUMAN      ----------------------------------------------------------------------
LMO3_BOVIN      ----------------------------------------------------------------------
LHX5_RAT        ----------------------------------------------------------------------
LHX5_MOUSE      ----------------------------------------------------------------------
LHX5_HUMAN      ----------------------------------------------------------------------
LHX5_DANRE      ----------------------------------------------------------------------
ISL3_ONCTS      ----------------------------------------------------------------------
ISL2B_ONCTS     ----------------------------------------------------------------------
LPP_MOUSE       CIVCDVKLRGQPFYAVEKKAYCEPCYINTL-EQCSVCSKPIMERILRATGKAYHPHCFTCVMCHRSL---
JUB_RAT         CCSCGRTLRCKAFYSVNGSVYCEEDYLQEAAEKCCVCGHLILEKILQAMGKSYHPGCFRCIVCNK-----
JUB_MOUSE       CCSCGRTLRCKAFYSVNGSVYCEEDYLQEAAEKCCVCGHLILEKILQAMGKSYHPGCFRCIVCNK-----
JUB_HUMAN       CCSCGRTLRCKAFYSVNGSVYCEEDYLQEAAEKCCVCGHLILEKILQAMGKSYHPGCFRCIVCNK-----
LMO3_XENLA      ----------------------------------------------------------------------
LMO3_DANRE      ----------------------------------------------------------------------
LHX5_XENLA      ----------------------------------------------------------------------
ISL2_RAT        ----------------------------------------------------------------------
ISL2_MOUSE      ----------------------------------------------------------------------
ISL2_HUMAN      ----------------------------------------------------------------------
ISL2A_ONCTS     ----------------------------------------------------------------------
RBTN1_XENLA     ----------------------------------------------------------------------
RBTN1_MOUSE     ----------------------------------------------------------------------
RBTN1_HUMAN     ----------------------------------------------------------------------
RBTN1_DANRE     ----------------------------------------------------------------------
LMO3_RAT        ----------------------------------------------------------------------
LHX3_CHICK      ----------------------------------------------------------------------
ISL2A_DANRE     ----------------------------------------------------------------------
ISL1_DANRE      ----------------------------------------------------------------------
ISL1_CHICK      ----------------------------------------------------------------------
LHX3_DANRE      ----------------------------------------------------------------------
ISL1_RAT        ----------------------------------------------------------------------
ISL1_MOUSE      ----------------------------------------------------------------------
ISL1_MESAU      ----------------------------------------------------------------------
ISL1_HUMAN      ----------------------------------------------------------------------
ISL2B_DANRE     ----------------------------------------------------------------------
RBTN1_BOVIN     ----------------------------------------------------------------------
LPP_CHICK       CMMCNNKLRGQPFYAVEKKAYCEPCYINTL-EQCSVCAKPIMERILRATGKAYHPHCFTCVMCHRSL---
LHX8_HUMAN      CSVCRTSLGRHSCYIKDKDIFCKLDYFRRYGTRCSRCGRHIHSTVRRAKGNVYHLACFACFSCKRQLSTG
LPP_HUMAN       CIICNNKLRGQPFYAVEKKAYCEPCYINTL-EQCNVCSKPIMERILRATGKAYHPHCFTCVMCHRSL-DG
ZYX_XENLA       CSRCDQQLQGQQYYESAGKPLCDECYQDTLEC-CAVCDKKITERLLKAIGKSYHPSCFTCAVCK------
LHX8_MOUSE      CSVCRTSLGRHSCYIKDKDIFCKLDYFRRYGTRCSRCGRHIHSTVRRAKGNVYHLACFACFSCKRQLSTG
LHX3_XENLA      ----------------------------------------------------------------------
LHX3_HUMAN      ----------------------------------------------------------------------
ZYX_XENTR       CSKCEQQLQGQQYYESAGKPLCEECYQDTLEC-CAVCEKKITERLLRAIGQAYHPSCFTCAVCK------
TES_XENTR       AQACGAGRSTNGSLVKGTEDKVAAQKESTY--YCFRCKENMEGDPAVGYDKLWHPSCFVCFTCNELLV--
LHX9_RAT        ----------------------------------------------------------------------
LHX9_MOUSE      ----------------------------------------------------------------------
LHX9_HUMAN      ----------------------------------------------------------------------
LHX3_PIG        ----------------------------------------------------------------------
LHX3_MOUSE      ----------------------------------------------------------------------
LHX9_BOVIN      ----------------------------------------------------------------------
LHX2_MOUSE      ----------------------------------------------------------------------
LHX2_HUMAN      ----------------------------------------------------------------------
ZYX_CHICK       CFKCEKQLQGQQFYNVDEKPFCEDCYA---GTKCSVCKQTITDRMLKATGNSYHPQCFTCVMCHTP----
LHX6_MOUSE      CSVCRTSLRQNSCYIKNKEIYCKMDYFSRFGTKCARCGRYASDWVRRARGNAYHLACFACFSCKRQLSTG
LHX6_HUMAN      CSVCRTSLRQNSCYIKNKEIFCKMDYFSRFGTKCARCGRYASDWVRRARGNAYHLACFACFSCKRQLSTG
APTE_DROME      ----------------------------------------------------------------------
LHX2_RAT        ----------------------------------------------------------------------
LIMA_DICDI      CVSCNCSLSDVYFEIDKLPY-CELDYKK--GKNCKRCKEIFGNTLINHLQETYHPECFKCSNCFSSIPYF
LHX9_ASTFA      ----------------------------------------------------------------------
PRIC1_XENTR     CSTCNELLVDLIYFYQDGKIHCGRHHAELLKPRCSACDEIIADECTEAEGRHWHMNHFSCYECETVLGGQ
ISL2_CHICK      ----------------------------------------------------------------------
PRIC1_AEDAE     ---------------------------------CDGCGECISSGDMGVYGTCWHPACFVCSVCKELLV--
PRI1B_XENLA     CSTCNELLVDLIYFYQDGKIHCGRHHAELLKPRCSACDEIIADECTEAEGRHWHMNHFCCYECETVLGGQ
LMO42_XENTR     ----------------------------------------------------------------------
LMX1B_CHICK     ----------------------------------------------------------------------
LHX9_RANRU      ----------------------------------------------------------------------
PRIC1_DROME     --------------------------QLMSARPCDGCDDLISGDIATRLGPSWHPACFACSVCRELLV--
PRI1A_XENLA     CSTCNELLVDLIYFYQDGKIHCGRHHAELLKPRCSACDEIIADECTEAEGRHWHMNHFCCYECETVLGGQ
LMX1B_MOUSE     ----------------------------------------------------------------------
LMX1B_MESAU     ----------------------------------------------------------------------
LMX1B_HUMAN     ----------------------------------------------------------------------
LIMF_DICDI      --------------------------------KCKKCQLEITNKIITNHNSTFHEQCFVCKLCSTPISDP
LMO4_MOUSE      ----------------------------------------------------------------------
LMO4_HUMAN      ----------------------------------------------------------------------
LMO4_BOVIN      ----------------------------------------------------------------------
LMO4A_XENLA     ----------------------------------------------------------------------
PRIC1_DROPS     --------------------------QLMSARPCDGCDELISGDIATRLGPSWHPACFTCCICRELLV--
ESN_DROPS       ---------------------------------CKGCEESLSGGDIVVFAQRWHPGCFVCSVCKELLV--
TES_RABIT       --------------------------------------------------KLWHPACFVCSTCSELLV--
LMX1A_HUMAN     ----------------------------------------------------------------------
ESN_DROME       ---------------------------------CKGCEEPLSGGDIVVFAQRWHPGCFVCSVCKELLV--
TRIP6_MOUSE     CSTCRAQLRGQHFYAVERRAYCESCYVATL-EKCSTCSEPILDRILRAMGKAYHPGCFTCVVCHRGL---
RGA1_SCHPO      CHDCNSLVASKFFPIDDPTLLCETDYFRRLDLLCASCGMALRGYYITALNKKFHIEHFTCSLCYTVFGPN
PRIC1_ANOGA     ---------------------------------CERCGECASGDMMVFASRCWHPACFACCVCKELLV--
LIN11_CAEEL     ----------------------------------------------------------------------
LIM_HALRO       ----------------------------------------------------------------------
TES_AOTNA       --------------------------------------------------KLWHPACFVCSICHELLV--
PRIC2_MOUSE     ----------------------------MTGAICEQCGGQIKGGDIAVFGICWHPPCFVCTVCNELLV--
LHX9_XENLA      ----------------------------------------------------------------------
TES_SAIBB       --------------------------------------------------KLWHPACFVCSVCHELLV--
TES_PIG         --------------------------------------------------KLWHPACFVCSTCHELLV--
TES_CALMO       --------------------------------------------------KLWHPACFLCSICHELLV--
TES_ATEGE       --------------------------------------------------KLWHPACFVCSICHELLV--
LMO4B_XENLA     ----------------------------------------------------------------------
PRIC2_HUMAN     ----------------------------MTGAICEQCGGQINGGDIAVFGVCWHPPCFVCTVCNELLV--
TRIP6_BOVIN     CSTCRAQLRGQHFYAVERRAYCESCYVATL-EKCSTCSQPILDRILRAMGKAYHPGCFTCVVCHRGL---
TES_XENLA       --------------------------------------------------KLWHPSCFVCFTCNELLV--
TES_PAPAN       --------------------------------------------------KLWHPACFVCSTCHELLV--
TES_OTOGA       --------------------------------------------------KLWHPACFVCSICYELLV--
TES_NEONE       --------------------------------------------------KLWHPACFVCSACQELLV--
TES_MUNRE       --------------------------------------------------KLWHPACFVCSACHELLV--
TES_MUNMU       --------------------------------------------------KLWHPACFVCSACHELLV--
TES_FELCA       --------------------------------------------------KLWHPACFVCSACQELLV--
TES_EULMM       --------------------------------------------------KLWHPACFVCSICYELLV--
TES_DASNO       --------AVGAMEAKSGEH-------RRTQYSCYGCKSMKEGDPAVGYNKLWHPACFICSTCCELLV--
TES_CERAE       --------------------------------------------------KLWHPACFVCSTCHELLV--
TES_ATEAB       CKLS----------MKEGE-------PAVYAERA-------------GYDKLWHPACFVCNTCRELLV--
LMX1A_MOUSE     ----------------------------------------------------------------------
LMX1A_MESAU     ----------------------------------------------------------------------
TES_LOXAF       --------------------------------------------------KLWHPACFVCSACSELLV--
TRIP6_HUMAN     CSTCRAQLRGQHFYAVEGCYVATLE-------KCATCSQPILDRILRAMGKAYHPGCFTCVVCHRGL---
TES_SHEEP       --------------------------------------------------KLWHPACFVCSTCHELLV--
TES_PONAB       --------------------------------------------------KLWHPACFVCSTCHELLV--
TES_PANTR       --------------------------------------------------KLWHPACFVCSTCHELLV--
TES_HYLLE       --------------------------------------------------KLWHPACFVCSTCHELLV--
TES_HUMAN       --------------------------------------------------KLWHPACFVCSTCHELLV--
TES_HORSE       --------------------------------------------------KLWHPACFVCSTCHELLV--
TES_COLGU       --------------------------------------------------KLWHPACFVCSTCHELLV--
TES_CANFA       --------------------------------------------------KLWHPACFVCSTCHELLV--
TES_MUSPF       --------------------------------------------------KLWHPACFVCSTCHELLV--
TES_MONDO       --------------------------------------------------KFWHPACFICNTCSELLV--
TES_CALJA       --------------------------------------------------KLWHPACFVCSICHELLV--
PRIC1_MOUSE     CFTCNELLVDLIYFYQDGKIHCGRHHAELLKPRCSACDEIIADECTEAEGRHWHMKHFCCLECETVLGGQ
PRIC1_HUMAN     CFTCNELLVDLIYFYQDGKIHCGRHHAELLKPRCSACDEIIADECTEAEGRHWHMKHFCCLECETVLGGQ
TES_MICMU       --------------------------------------------------KLWHPACFVCSTCYELLV--
RBTN2_MOUSE     CDLCGCRLGEVGLYYKLGRKLCRRDYLRLFGQDCASCDKRIRAYEMTVKDKVYHLECFKCAACQKHFCVG
RBTN2_HUMAN     CDLCGCRLGEVGLYYKLGRKLCRRDYLRLFGQDCASCDKRIRAYEMTVKDKVYHLECFKCAACQKHFCVG
RBTN2_BOVIN     CDLCGCRLGEVGLYYKLGRKLCRRDYLRLFGQDCASCDKRIRAYEMTVKDKVYHLECFKCAACQKHFCVG
TES_BOVIN       --------------------------------------------------KLWHPACFVCSTCHELLV--
CRIP3_HUMAN     CERCHSILSPGGHAEHNGRPYCHKPYGALFGPRIGGVGSYLYNPPTPSPG------------CTTPLXXX
RBTN2_XENTR     CDLCGCRLGEVGLYYKLGRKLCRRDYLRLFGQDCASCDKRIRAFEMTVKDKVYHLECFKCAACQKHFCVG
RBTN2_XENLA     CDLCGCRLGEVGLYYKLGRKLCRRDYLRLFGQDCASCDNRIRAYEMTVKDKVYHLECFKCAACQKHFCVG
TES_RAT         --------------------------------------------------KLWHPACFICSTCGELLV--
TES_MOUSE       --------------------------------------------------KLWHPACFICSTCGELLV--
RBTN2_DANRE     CDLCGCRLGEVGLYYKLGRKLCRRDYLRLFGQDCASCEKRIRAFEMTVRDKVYHLECFKCAACQKHFCVG
LIMG_DICDI      CASCSKVLSDNDFSEISGIPCCKSCFTEIFGSACTWCRNQIQAEAVSFGGNIYHSNCFTCSKCSSSIGKN
CSRP2_RAT       ------------------------------GNKCGACGRTVHAEEVQCDGRTFHRCCFLCMVCRKNLD-S
CRIP2_PONAB     CERCSKTLTPGGHAEHDGKPFCHKPYATLFGPKIGGAGSY---------------------IYEKPLAEG
PRIC1_RAT       CFTCNELLVDLIYFYQDGKIHCGRHHAELLKPRCSACDEIIADECTEAEGRHWHMKHFCCLECETVLGGQ
CRIP2_HUMAN     -------------------------------SKCPKCDKTVYAEKVSSLGKDWHKFCLKCERCSKTLTPG
TES_CHICK       --------------------------------------------------KLWHPACFVCCTCSELLV--
TES_RHIFE       --------------------------------------------------KLWHPACFVCSTCEELLV--
CSRP2_MOUSE     ------------------------------GNKCGACGRTVHAEEVQCDGRSFHRCCFLCMVCRKNLD-S
CRIP2_BOVIN     -------------------------------SKCPKCDKTVYAEKVSSLGKDWHRFCLRCEHCSKTLTPG
CSRP2_HUMAN     ------------------------------GNKCGACGRTVHAEEVQCDGRSFHRCCFLCMVCRKNLD-S
CSRP2_BOVIN     ------------------------------GNKCGACGRTVHAEEVQCDGRSFHRCCFLCMVCRKNLD-S
PRIC3_HUMAN     ------------------------------GAICEECGKQIGGGDIAVLGACWHPQCFVCTTCQELLV--
CSRP3_MOUSE     CMACRKALDSTTVAAHESEIYCKVCYGRRYGPKGIGFGQGA-GCLSTDTGEH-----LGLQFQQSPKPAR
CRIP2_MOUSE     -------------------------------SKCPKCDKTVYAEKVSSLGKDWHKFCLKCERCNKTLTPG
CSRP2_COTJA     ------------------------------GNKCGACGRTVHAEEVQCDGRSFHRCCFLCMVCRKNLD-S
CSRP3_RAT       CMACRKALDSTTVAAHESEIYCKVCYGRKYGPKGIGFGQGA-GCLSTDTGEH-----LGLQFQQSPKPAR
CSRP3_BOVIN     CMACRKALDSTTVAAHESEIYCKVCYGRRYGPKGIGYGQGA--------------GCLSTDT-------G
CRIP2_RAT       -------------------------------SKCPKCDKTVYAEKVSSLGKDWHKFCLKCERCNKTLTPG
HM14_CAEEL      CSTCKDELGATCFLREDSMY-CRAHFYKKFGTKCSSCNEGIVPDHVVASNHVYHVECFQCFICKRSLETG
CSRP3_HUMAN     CMACRKALDSTTVAAHESEIYCKVCYGRRYGPKGIGYGQGA-GCLSTDTGEH-----LGLQFQQSPKPAR
CSRP2_CHICK     ------------------------------GNKCGACGRTVHAEEVQCDGRSFHRCCFLCMVCRKNLD-S
MEC3_CAEBR      CAICESPLAEKCFW-KNGTIYCSQHYYKDYSARCAGCKKGVSTDMVYKLGLVFHVECHCCTLCGRHLSPG
AWH_DROME       CCMCMCPLRQQSCFIRERQVYCKADYSKNFGAKCSKCGISASDWVRRARELVFHLACFACDQCGRQLSTG
LHX9_DANRE      ----------------------------------------------------------------------
Y1927_ARATH     ----------------------------------------------------------------------
PXL1_YEAST      ----------------------------------------------------------------------
PRIC3_MOUSE     ------------------------------GAICEECGKQIGGGDIAVLGACWHPQCFVCTTCQELLV--
LIMK_DICDI      CKECKNELES---FIKDGSLICDECDIKLNARKCFKCQLPIQSTIVTARGKSFHNDCFNCASCEK-----
LIMC_DICDI      CFSCNKNLVSGQYSEKEGLIYCPRCYQSKFG---------------------------------------
LHX9_CHICK      ----------------------------------------------------------------------
MEC3_CAERE      CTICESPLAEKCFW-KNGRIYCSQHYYKDHSSRCAGCKKGVSTDMVYKLGLVFHVECHCCSLCGRHLSPG
ZN420_HUMAN     CKECGRAFIRGSLL---------MQHQRIHPYKCEECGKFIRGSQLTQHQRIHNEKPYECKECGKMFSHG
CRIP1_RAT       ----------------------------------------------------------------------
CRIP1_MOUSE     ----------------------------------------------------------------------
CRIP1_HUMAN     ----------------------------------------------------------------------
CRIP1_BOVIN     ----------------------------------------------------------------------
MEC3_CAEEL      CTICESPLAEKCFW-KNGRIYCSQHYYKDHSIRCAGCKKGVSTDMVYKLGLVFHVECHCCSLCGRHLSPG
ZN571_HUMAN     CKKCG------KAFSYCSQYTL---HQRIHSGECKDCGKFILGSQLT-----YHQRIYECKECGKAFILG
LRG1_YEAST      CQDCQKPLKPKYFVDKTSELLCQYDYFRRHNLLCHVCDTPLRGLYYTAFGYRYDEEHFSCTICATP----
ZN571_PONAB     CKKCG------KAFSYCSQYTL---HQRIHSGECKDCGKFILGSQLT-----YHQRIYECKECGKAFILG
VILI_CHICK      ----------------------------------------------------------------------
CSRP1_RAT       ------------------------------GKKCGVCQKTVYAEEVQCEGNSFHKSCFLCMVCKKNLD-S
CSRP1_MOUSE     ------------------------------GKKCGVCQKTVYAEEVQCEGNSFHKSCFLCMVCKKNLD-S
CSRP1_HUMAN     ------------------------------GKKCGVCQKTVYAEEVQCEGNSFHKSCFLCMVCKKNLD-S
CSRP1_BOVIN     ------------------------------GKKCGVCQKTVYAEEVQCEGSSFHKSCFLCLVCKKNLD-S
YS029_HUMAN     CKECG-----KSFTFRSG----LIGHQAIHTGECKECGKFTAGSTLIQHQRIHTEKPYDCKECGKSFASG
RGA3_SCHPO      ----------------------------------------------------------------------
LMO41_XENTR     CSCCQAQLGEIGTYTKSGMILCRNDYIRLFXXXXXXXXXXASEMVMRAQGSVYHLKCFTCATCRNRLVPG
CSRP1_PONAB     ------------------------------GKKCGVCQKTVYAEEVQCEGNSFHKSCFLCMVCKKNLD-S
CSRP1_COTJA     ------------------------------GKKCGVCQKAVYAEEVQCEGSSFHKSCFLCMVCKKNLD-S
CSRP1_CHICK     ------------------------------GKKCGVCQKAVYAEEVQCEGSSFHKSCFLCMVCKKNLD-S
MLP2_DROME      CKDCHKTLASDG---PDRDVYCRTCYGKKWGPHGYGCGSFLQTDGLTE----------DQISANRPFYNP
LMCD1_PIG       ----------------------------------------------------------------------
LMCD1_HUMAN     ----------------------------------------------------------------------
ZFP59_MOUSE     CNVCGSAFRLQLYLSEHQKTHMEEKY-----LECNVCGKFRLQDILSEHLKTHEENPFKCKLCGSSFPHK
LMCD1_MOUSE     ----------------------------------------------------------------------
ZSC12_PONPY     CNECGKAF---------GRWSALNQHQRLHTGECNDCGKAFSQKA----GLFHHIKIYQCTQCNK-----
ZSC12_MACNE     CNECGKAF---------GRWSALNQHQRLHTGECNDCGKAFSQKA----GLFHHIKIYQCTQCNK-----
PRIC4_HUMAN     CQACGQALINLIYFYHDGQLYCGRHHAELLRPRCPACDQLISWRCTEAEGQRWHENHFCCQDCAGPLGGG
ZSC12_PANTR     CNECGKAF---------GRWSALNQHQRLHTGECNDCGKAFSQKA----GLFHHIKIYQCTHCNK-----
PDLI3_CHICK     CSDCNLNLKQKGYFFVEGQLYC------------------------------------------------
LMCD1_BOVIN     ----------------------------------------------------------------------
ZSC12_PANPA     CNECGKAF---------GRWSALNQHQRLHTGECNDCGKAFSQKA----GLFHHIKIYQCTHCNK-----
ZSC12_HUMAN     CNECGKAF---------GRWSALNQHQRLHTGECNDCGKAFSQKA----GLFHHIKIYQCTQCNK-----
ZSC12_GORGO     CNECGKAF---------GRWSALNQHQRLHTGECNDCGKAFSQKA----GLFHHIKIYQCTQCNK-----
ZN479_HUMAN     CEECGQAFRRSSA-LTNHKRIHT--GERPY--KCEECGKAFSVSSTLTDHKRIHTGC-RCEECGKAFSWS
ZN141_HUMAN     CEECGSIFTTSSHFAKH-----KIIHTGEKPYKCEECGKAFNRFTTLTKHKRIHEKPITCEECRKIFTSS
ZN734_HUMAN     CEECGKAFSVSSTLIHTGEKPC----------RCEECGKAFSWSSNLSRHKRIHTRPYACEECGQAFSLS
ZN345_BOVIN     CKVCGKSFSFESALIHTGEYECK-DCGKAFGSECKGCGAFSSGSALTRHQRIHGEKPYICNECGKAFSFG
ZN774_HUMAN     CNDCGESFSQSSDLIKHQR---THTGERPF--KCPECGKFRDSSHFVAHMSTHSERPFSCPDCHKSFSQS
ZN733_HUMAN     CEECGKAFSVSSTLIHTGEKPC----------RCEECGKFSWSSNLTRHKRIHTRKPYACEECGQAFSLS
ZN540_HUMAN     CKVCEKAFSYSGDLIHTGEYECLTEHQRLHGVKCKECGKTFRVRSQISLHKKIHTDVYKCVRCGKTFRFG
PDLI3_RAT       CADCNLNLKQKGYFFVEGELYCEM----------------------------------------------
ZN283_MACFA     CKECGKAFFWGSSLAKH-EIIHT--GEKPY--QCKECGKFSRGYQLTQHQKIHGKKPYECKICGKAFCWG
VILI_HUMAN      ----------------------------------------------------------------------
PDLI3_PIG       CADCNLNLKQKGYFFVEGELYC------------------------------------------------
PDLI3_MOUSE     CADCNLNLKQKGYFFVEGELYC------------------------------------------------
PDLI3_BOVIN     CADCNLNLKQKGYFFVEGELYC------------------------------------------------
LASP1_CAEEL     ----------------------------------------------------------------------
ZN594_HUMAN     CKECGKTFNQSSDLLRHGEYVCN-----KCGKSFRGSSDLIKHHRIHTGEKPYE-----CSECGKAFSQR
PDLI3_HUMAN     CADCNLNLKQKGYFFIEGELYC------------------------------------------------
AVIL_MOUSE      ----------------------------------------------------------------------
ZO71_XENLA      CSACGKCFSNRSHLIRH-----QMIHTGEKPFSCFECRKCFSNPSNLARHQMTHEKPFSCSECGKCFASS
ZN615_PONAB     CSECG-----KGFSMKH----CLMVHQRTHPYKCNECGKALKSPLIRHQRTHTGEKPYVCTECRKGFTMK
VILI4_ARATH     ----------------------------------------------------------------------
LASP1_MOUSE     ----------------------------------------------------------------------
ZNF81_HUMAN     CSECG-----KGFSLNSALNIHQKIHTGERHHKCSECGKAFTQKSTLRMHQRIHERSYICTQCGQAFIQK
ZN615_HUMAN     CSECG-----KGFSMKH----CLMVHQRTHPYKCNECGKALKSPLIRHQRTHTGEKPYVCTECRKGFTMK
ZN595_HUMAN     CEKCGKAFNQXXXXXXXXXXXXE---QKLY--KCEECGKAFTWSSSLNKHKRIHTGPYACEECGKAFYRS
ZN540_PONAB     CKVCEKAFSYSGDLIHTGEYECLTEHQRLHGVKCKECGKTFRVRSQISLHKKIHTDVYKCVRCGKTFRFG
CRIP3_MOUSE     ----------------------------------------------------------------------
ZN836_HUMAN     CGVCGKIFRQNSDLVNHGEYKCNAIHQRIHTGKCNECGKFKQGSCLTT-HQIIHTGPYQCDICGKVFRQN
ZN267_HUMAN     CKVCSKSYARSSNLIM---------HQRVHPYKCKECGKFSRSSCLTQHRKIHGENLYKCKVCAKPFTVH
LASP1_RAT       ----------------------------------------------------------------------
LASP1_RABIT     ----------------------------------------------------------------------
LASP1_PONAB     ----------------------------------------------------------------------
LASP1_HUMAN     ----------------------------------------------------------------------
ZN260_HUMAN     CKECG-KAFNGKAYLTEHEKIHTGEKP----FECNQCGRAFSQKQYLIKHQNIHKKPFKCSECGKAFSQK
LASP1_DROME     ----------------------------------------------------------------------
ZN222_HUMAN     CDVCGKEFSQSGFRCRSALKVHCKLHMREKPYNCEKCGKAFMHNFQLQKHHRIHTGPFKCEICGKSFCL-
ZN155_HUMAN     CKECGKSFRWSS---------CLLNHQRVHSGKCEECGKYTNSQLSSHQRSHSGEKPYKCEECGKGYVTK
ZNF28_HUMAN     CKVCDKAFRSDS---------CLTEHQRVHTGECNECGKVFSTKANLACHHKLHEKPYKCEECEKVFSRK
ZN676_HUMAN     CEECGKAFSWSSSLTEHKRIHAG---EKPY--KCEECGKAFNRSSILTKHKIIHTGPYKCEGCGKAFSKV
ZN283_HUMAN     CKECG----------KNYLSAYQLNVHQRFHTECKECGKLVKHERIHTGEKPYE-----CKECGKAFSRG
VILI_BOVIN      ----------------------------------------------------------------------
ZN546_HUMAN     CKECGKAFIHSNQFISHSTYICKKIFSRRYNLTCNECGKAFRFQTELTQHHRIHTGPYKCTECGKAFIRS
ZN275_HUMAN     CKACSRD------FLDRQE---LLKHQRMHTGHCDDCGKSFRGVNGLAEHQRIHSGAYGCPHCGKLFRRS
ZN268_HUMAN     CSECGKAFRSKSYLII---HMRTHTGEKPH--ECRECGKSFSFNSQLIVHQRIHTNPYECSECGK-----
ZBT41_HUMAN     CDICGRQFNDTGNLKRHIE--CTHGGKRKW--TCFICGKSVRERTTLKEHLRIHEKPHLCSICGQSFRHG
QUAI_DROME      ----------------------------------------------------------------------
PDLI4_RAT       CSDCGLNLKQRGYFFLDERLYC------------------------------------------------
PDLI4_MOUSE     CSDCGLNLKQRGYFFLDERLYC------------------------------------------------
PDLI4_HUMAN     CSDCGLNLKQRGYFFLDERLYC------------------------------------------------
PDLI4_BOVIN     CSDCGLNLKQRGYFFLDERLYC------------------------------------------------
ZNF30_HUMAN     CKECGKAFRLSSFLHAHQRIHAEI---KPYG--CKECGRFSRASYLVQHGRLHGEKPYECKECGKAFSTG
ZN253_HUMAN     CEECG----------KAFNRSTDLTTHKIVHTKCEECGKAFKHPSHVTTHKKIHTRGYNCEECGKSFKHC
ZBT41_MOUSE     CDICGRQFNDTGNLKRHIE--CTHGGKRKW--TCFICGKSVRERTTLKEHLRIHEKPHLCSICGQSFRHG
VILI_MOUSE      ----------------------------------------------------------------------
PDLI4_CHICK     CDDCGLNLKQRGYFFIEEQLYC------------------------------------------------
ZN737_HUMAN     CEECGKAFKRSSILIHSGE--------KPY--KCEECGKAFKHPSVLTTHKRIHTGPYKCEECGRAFKYF
ZN616_HUMAN     CDVCGKIFRKNSYFVRHQRYICNAVHQRIHPYKCNLCGKSFSQRVHLRLHQTVHERPFKCNECGKTFKRS
ZN287_PONPY     CNECGKAFAHSSTLI---QHQTTHTGEKSY--ICNICGKFSQSANLTQHHRTHGEKPYKCSVCGKAFSQS
ZN287_HUMAN     CNECGKAFAHSSTLI---QHQTTHTGEKSY--ICNICGKFSQSANLTQHHRTHGEKPYKCSVCGKAFSQS
ZN252_CANFA     CNECGKAFSQSFNLIHNGEYECNVQHQRVHNYECHKCGKFSQGSHLIQHQRSHGEKPYECNECGKTFGQI
ZN197_HUMAN     CDECGKTFAQTTYLI---------DHQRLHSAKCKECGKVFIRSKSLLLHQRVHTETFGCKKCKSNFIDH
RGA1_YEAST      ---------------------------------CVRCKEFITTGHAYELGDRWHTHCFACYKCEKPLSES
PDLI3_XENLA     CSDCNLNLKQKGYFFVEGQLYC------------------------------------------------
LIMA1_MOUSE     ----------------------------------------------------------------------
ZN560_HUMAN     CKKCGKAFTKCSYLTK---HLRTHAGEKPY--ECMKCGKFTERSYLTKLRRHSGEKPYECKKCGKAFTER
ZN287_MOUSE     CTACGKAFAHSSTLI---QHQTTHTGEKSY--ICNVCGKFSQSANLTQHHRTHGEKPYKCSVCGKAFSQS
ZN271_MOUSE     CSQCSKMFSRRSDLVKH--------YRIHTGEKCDKCGKTFSQSSNLILHQRIHTGPYPCNSCSKSFSRG
VILI1_ARATH     ----------------------------------------------------------------------
VILD_DICDI      ----------------------------------------------------------------------
ZN675_HUMAN     CKECGRSFCMLSHLTRHER-----NYTKVNFCKCEECEKAVQSSKLTKHKRIYTEKLYKCQECDRTFNQF
ZN493_HUMAN     CEECGKTFSVFSILTKH-----KIIHTEEKPYKCEECGKAFKRSSTLTKHRIIHTEPYKCEECGKAFNQS
ZN347_HUMAN     CNECG-----KAFRAHSNLTTHQVIHTGEKPYKCNECGKVFTQNSHLANHQRIHTGVYMCNECGKAFSVY
ZN225_HUMAN     CEECG-----KGFYTNSQRYSHQRAHSGEKPYRCEECGKGYKRRLDLDFHQRVHEKPYNCKECGKSFGWA
ZN160_HUMAN     CHECGK-------VFRHNSYLAT--HRRIHTGKCNECGKAFRGHSNLTTHQLIHTGPFKCNECGKLFTQN
ZFP30_MOUSE     CKKCA------------KIFTCSSDHQRSHGEKCKECGKAFRVRGQLMLHQRIHTGPYACTECGKSFRQV
PDLI1_HUMAN     CTDCGTNLKQKGHFFVEDQIYC------------------------------------------------
PDLI1_BOVIN     CTDCGTNLKQKGHFFVEDQIYC------------------------------------------------
LASP1_BOVIN     ----------------------------------------------------------------------
ZNF43_HUMAN     CEECG----------KAFNWPSTLTKHNRIHTKCEVCGKAFNQFSNLTTHKRIHTKPYKCEECGKAFSRS
ZN429_HUMAN     CKKCGCMLSQKKIHIRENTYRCLTNHKRIYHYRCEECGKAFNHYSTLTNHKRIHEKPYKCKECGKAFSRY
ZFP82_HUMAN     CKECG------------EAFICGADHQKMHPYECKECGKAFRVRGQLTLHQRIHTGPYVCKECGKAFRQY
PRDM9_MOUSE     CRECGRGFTQKSVLIKHQR---THTGEKPY--VCRECGRFTQKSVLIKHQRTHGEKPYVCRECGRGFTQH
OZF_MOUSE       CNECGTAFGQKKYLIKHQNIHTG---EKPY--ECNECGKAFSQRTSLIVHVRIHDKPYECNVCGKAFSQS
OZF_BOVIN       CNECGTAFGQKKYLIKHQNIHTG---EKPY--ECNECGKAFSQRTSLIVHVRIHDKPYECNVCGKAFSQS
NRAP_MOUSE      ----------------------------------------------------------------------
LIMA1_HUMAN     ----------------------------------------------------------------------
ZN841_HUMAN     CNDCGKAYTQRSSLTKH--------LVIHTGENPYHCNEFGEAFIQSSKLARYHRNPTGCSECGRTFSHK
ZN565_HUMAN     CKECGKTFRQHSQLILHQR---THTGEKPY--VCKDCGKFIRGSQLT-VHRRIHTGAYECKECGKAFRQH
ZN433_HUMAN     CKHCGKVLSQNHLGMHTGEHKCKICGKAFYSPKCNQCGKAFNSSSSFRYHERTHEKPYECKQCGKAFRSA
ZN208_HUMAN     CEECG----------KGFSWSSTLSYHKKIHTKCEECGKAFNQSAILIKHKRIHTG-------EKPYK--
YS020_HUMAN     CHECGKVFTQNSH-LANHHRIHT--GEKPY--KCNECGKVFNRNAHLARHQKIHSGPYKCKECGKAFSGG
OZF_PONAB       CSECGTAFGQKKYLIKHQNIHTG---EKPY--ECNECGKAFSQRTSLIVHVRIHDKPYECNVCGKAFSQS
OZF_HUMAN       CSECGTAFGQKKYLIKHQNIHTG---EKPY--ECNECGKAFSQRTSLIVHVRIHDKPYECNVCGKAFSQS
ZNF85_HUMAN     CEECGKAFNQSSNLIKHKKIHTG---EKPY--KCEECGKTFNRFSTLTTHKIIHTG-------EKPYK--
ZN620_HUMAN     CKECGKGLSSDTALIQ---------HQRIHPYECKECGKAFSSSSVFLQHQRFHTECWKTFSCSSSFTVH
ZFP30_MACFA     CKECGAFLCSTGLRIHHKLHTGEKPYE------CKECGKAFRVRQQLTLHQRIHEKPYDCKECGKTFSRG
ZFP28_MOUSE     CPECGKAFIQNTSLVRHWRYYHTGEKP----FDCIDCGKAFSDHIGLNQHRRIHTGPYTCEVCHKSFRYG
Z354B_HUMAN     CKECGKSFSRSGLFIKASSYSTSLSHLRKKSYLCNECGNTFKSSSSLRYHQRIHEKPFKCSECGRAFSQS
VILI3_ARATH     ----------------------------------------------------------------------
PDLI1_RAT       CTDCGINLKQKGHFFVGDQIYC------------------------------------------------
PDLI1_MOUSE     CTDCGINLKQKGHFFVEDQIYC------------------------------------------------
NRAP_HUMAN      ----------------------------------------------------------------------
AVIL_HUMAN      ----------------------------------------------------------------------
ZNF23_HUMAN     CKECGKGFNNNTKLIQHGEYECT-ECGKAFSVK----GKLIQHQRIHTGEKPYECNCGKAFRCNSQFRQH
ZN813_HUMAN     CNECGKTFSQE----------LTLKCHRRLHTKCNECGKVFNKKANLARHHRLHSGPYKCTECVKTFSRN
ZN778_HUMAN     CKDCG--KACGGFYLLN-EHGKTHTREKPFA--CVVCGKYFRNSSCLNNHVRIHTGIYTCSYCGKAFTVR
ZN623_HUMAN     CKECGKGFSQSSLLIRHGEYECNRHYQEVKQYECKECGKAFRHRSDLIEHQRIHERPFECNECGKAFIRS
ZN471_HUMAN     CKECGKAFSDGSSFARHQR--CHTG-KRPY--ECIECGKFRYNTSFIRHWRSYHEKPFNCIDCGKAFSVH
ZN432_HUMAN     CSECG-----KGFIVNSGLMLHQRTHTGEKPYICNECGKGFAFKSNLVVHQRTHEKPFMCSECGKGFTMK
ZN136_HUMAN     CKVCGKPFHSLSSFIHTGEFKCTLRIHERTHTECKQCGKAFSYLPSLRLHERIHEKPFVCKQCGKAFRSA
ZG48_XENLA      CSECGCFRQSSQLFLHRRNHTGEKPFS------CSECGKCFKWRSLLIKHHKTHTGSFTCADCGKCFKKF
ZO22_XENLA      CSECGKSFSNQS---------CLRVHQRTHGEKPYSCSEFVTSSQLAVHRRRTHTGPFSCSECGK-----
ZNF7_PONAB      CDECGKGFVQGSHLIQ---------HQRIHTGECNDCGKAFSQSSSLIYHQRIHEKPYECLQCGKAFSMS
ZNF7_HUMAN      CDECGKGFVQGSHLIQ---------HQRIHTGECNDCGKAFSQSSSLIYHQRIHEKPYECLQCGKAFSMS
ZN721_HUMAN     CEVCGKAFRQSANLIHTGEKPYT----------CGECGKTFRQSANLYVHRRIHTGPYKCEDCGKAFGQH
ZN519_HUMAN     CEECGKAFNRGSYLTQ---------HQRIHTGRCKECGKAFNRSSYVTQHQRMHTGPFKCKECGKAFNRA
ZN506_HUMAN     CEECGKAYKQS----------CNLTTHKIIHTRCRECGKAFNHPATLFSHKKIHTGPYKCDKCGKAFISS
ZFP62_MOUSE     EKRYECDDCRGTFRSSSSLRVHKRIHTGEKPYKCDECGKAYMSYSSLINHKSTHKNC-KCDECGK-----
ZFP60_MOUSE     CKQCGKIFSNGSYLLRHYD---THTNEKPF--ECNICGKAFRLHLYLSEHQKTHTDPFKCKLCESAFSEH
XIRP2_MOUSE     ----------------------------------------------------------------------
MILK1_MOUSE     ----------------------------------------------------------------------
ZN584_HUMAN     CSDCGKVFLKAFALL---DHLITHSEERPF--RCPGRSAFKKSAHINPTGETAH----VCNECGKAFSYP
ZN502_HUMAN     CEQCGKTFRCRSFLTQ---------HQRIHTGKCNECGNSFRNHSHLTEHQRIHTGPYKCNRCGKAFNQN
ZN417_HUMAN     CEECGKSFSQKGSLISHGEYECR-EYGKSFGQK----GNLIQHQQGHTGERAYH--CGECGKSFRQFINH
ZN192_PANTR     CKECGKAFSQNGLILHQRIHTGEKPYQ------CNQCGKAFSQSAGLILHQRIHSGPYECNECGKAFSHS
ZN192_PANPA     CKECGKAFSQNGLILHQRIHTGEKPYQ------CNQCGKAFSQSAGLILHQRIHSGPYECNECGKAFSHS
ZN192_HUMAN     CKECGKAFSQNGLILHQRIHTGEKPYQ------CNQCGKAFSQSAGLILHQRIHSGPYECNECGKAFSHS
ZN136_PONAB     CKVCGKPFHSLSSFIHTGEFKCTLRIHERTHTECKQCGKAFSYLPSLRLHERIHEKPFVCKQCGKAFRSA
ZN107_HUMAN     CEECGKAFNQHSNLINHRKI-----YSGEKPYKCEECGKAFNRSSTLTRHKKIHTGPYKCEECDRAFSQS
ZN708_HUMAN     CEECGKAFNRSSNLTKH-----KIVHTGEKPYKCEECGKAFKQSSNLTNHKKIHTGPYKCGECGKAFTLS
ZN418_HUMAN     CGECGKSFSQNGTLIK---------HQRVHGERPYECEE-----------------CGKCFTQKGNLIQH
ZN343_HUMAN     CSECGRGFSEKSSFIRHQR---THSGEKPY--VCLECGRSFCDKSTLRKHQRIHEKPYVCRECGRGFSQN
ZFP30_HUMAN     CKECGAFLCSTGLRLHHKLHTGEKPYE------CKECGKAFRVRQQLTLHQRIHEKPYDCKECGKTFSRG
LIMD2_RAT       ----------------------------------------------------------------------
ZN620_PONAB     CKECGKGLSSDTALIQ---------HQRIHPYECKECGKAFSSSSVFLQHQRFHEKLYECNECWKTFSCS
ZN473_MOUSE     CKKCG-ETFSGAFHLAK--------HQRAHAQRLYKCASC---PAVFNLSK----HCFQHR--KSHFPQG
ZN439_HUMAN     CKQCGKALSSLTSF---QTHIRMHSGERPY--ECKTCGKFYSAKSFQRHEKTHSEKPYKCKQCGKAFTRS
ZN383_MACFA     CKECGKAFSCSSYLIHTGKYEC-----KECGKAFSYCSNLIDHQRIHTGEKPY-----ACKVCGKAFTKS
ZN175_HUMAN     CSECGKGFSQNSTLIIHQKIHTG---ERQYA--CSECGKAFTQKSTLSLHQRIHQKSYVCIECGQAFIQK
ZIK1_HUMAN      CNEC------GKFFSQTSH---LNDHRRIHGERCSECGKLFRQNSSLVDHQKIHTGAYECSQCGKSFSKH
TALB_DICDI      ----------------------------------------------------------------------
LIMD2_MOUSE     ----------------------------------------------------------------------
LIMD2_HUMAN     ----------------------------------------------------------------------
ZNF91_HUMAN     CEECGKAFSHSSALAKHKRIHTG---EKPY--KCKECGKAFSNSSTLANHKITHTEPYKCKECDKTFKRL
ZNF83_HUMAN     CNVCGSHLAQHQR-IHTGEYKCNVNHWRIHTGKCNECGKVFSHKSSLVNHWRIHTGPYKCNECGKVF---
ZN846_HUMAN     CKECGKAFTHSSYLT---------DHTRIHSGKCMECGKAFTRSTGLILHMRIHTGPYECKECGKAFIHS
ZN568_HUMAN     CSECGKAFSQSSSLVHMRNHTAEKPYE------CKECGKAFSRKENLITHQKIHTGPYECSECGKAFIQH
ZN331_PONAB     CKDCGKAFSRGYQLIHTGEYECLTQHQKIHPYECKDCGKAFRWGSSLVIHKRIHEKPYECKDCGKAFRRG
ZN331_HUMAN     CKDCGKAFSRGYQLIHTGEYECLTQHQKIHPYECKDCGKAFRWGSSLVIHKRIHEKPYECKDCGKAFRRG
ZN132_HUMAN     CLKCGRAFSQSSNFLRHQKV-----HTQVRPYECSQCGKSFSRSSALIQHWRVHTGPYECSECGR-----
ZNF25_HUMAN     CKECGKFFCQKSALIVHQH-----THSKGKSYDCDKCGKFSKNEDLIRHQKIHRDKTYECKECKKIFSRH
ZN790_HUMAN     CKECGKAFSCGSDLIHTGEYECN-ECRKAFSQRSH----LIKHQRIHTGEKPYE-----CKECGKAFTRG
ZN484_HUMAN     CSDCG-----KSFTWKSRLRIHQKCHTGERHYECSECGKAFIQKSTLSMHQRIHEKPYVCTECKSHFITH
ZN224_HUMAN     CDVCGKEFSQ-------SSHLQT--HQRVHGEKPFKCVECGKGFSRRSALNVHHEKPYNCEECGKAFQEH
ADCE_DICDI      ----------------------------------------------------------------------
ZN813_PONAB     CNECGKTFSQE----------LTLKCHRRLHTKCNECGKVFNKKANLARHHRLHSGPYKCTECVKTFSRN
ZN679_HUMAN     CEECG----------KAFTWSSTLTKHRRIHTTCEECGQAFSRSSTLANHKRIHTGPYTCEECGKAFSLS
ZIK1_MOUSE      CRDCGKFFSQTSHLIHTGEYECSVDHQKTHGARCSQCGKSFSQKATLVKHKRVHERPYKCSECGNSFSQS
ZG66_XENLA      CSECGKCFASSSHLIGHRQQV------HMEGKTCSECGKYYQSQLVRHQRTHTGEKPYSCSECGKCFATS
PDLI2_RAT       CADCGLNLKMRGHFWVGNELYCEKHARQRY----------------------------------------
PDLI2_MOUSE     CADCGLNLKMRGHFWVGNELYCEKHARQRY----------------------------------------
PDLI2_MACFA     CADCGLNLKMRGHFWVGDELYCEKHARQRY----------------------------------------
PDLI2_HUMAN     CADCGLNLKMRGHFWVGDELYCEKHARQRY----------------------------------------
PDLI2_BOVIN     CADCGLNLKMRGHFWVGDELYCEKHARQRY----------------------------------------
ZNF80_CERAE     -------------------------------------------------------------VLQEPVSTG
ZN383_HUMAN     CKECGKAFSCSSYLIHTGKYEC-----KECGKAFSYCSNLIDHQRIHTGEKPYE-----CKVCGKAFTKS
ZN260_MOUSE     CGECGKAFSQRGNFLSHQKQTTTVRNQRNTGNKCKECGKAFNGKSYLKEHEKIHTGPFECSQCGRAFSQK
ZN235_MOUSE     CSVCGKNFSRSSHF---------LDHQRIHPYRCEVCGKRFPWSLSLHSHQSVHTG-------KKPYKCG
ZN221_HUMAN     CDICG----------KSFRVRSRLNRHSMVHTRCDTCGKFRQRSALNSHSMVHEEKPYKCEQCGKGFI--
ZIM3_HUMAN      CKTCGKAFSWKSSCINHEKI-----HNAKKSYQCNECEKSFRQNSTLIQHKKVHQKPFQCTDCGKAFVKH
Z780B_HUMAN     CKECGKGFNRGANLIQHQKIECEMAFRYHYQLECKECGKAFSLLTQLARHKNIHEKPFECKDCGKAFNRG
Z354B_MOUSE     CSECG----------KGFTSISRLNRHRIIHTNCNECGKALSSHSTLIIHERIHTGC-KCKVCGKAFRQS
ZNF74_HUMAN     --------------------------------QCGSCGKAFTCHSSLTVHEKIHSGDFKCSDCEKAFNSR
ZNF35_HUMAN     CSVCGKGFSQSANLVV---------HQRIHPFECHECGKAFIQSANLVVHQRIHQKPYVCSKCGKAFTQS
ZN823_HUMAN     CKQCSKAFPDYSTYLRHER---THTGEKPY--KCTQCGKAFSCYYYTRLHERTHTGPYACKQCGK-----
ZN730_HUMAN     CEECG----------KAFNRSSTLNRHKITHTKYKECGKAFNQSSTLTIHKIIHTKFYKCEECGKAFSRI
ZN682_HUMAN     ----------------------------------------------------------------------
ZN678_HUMAN     CEECGKAFTQFASLTRHKRHTGEKPYQ------CEECGKTFNRCSHLSSHKRIHTGPYKCEECGRTFTQF
ZN607_HUMAN     CKECG-----KGFTCR---YQLTM-HQRIYGEKHYECKE--NGEAFSSGHQLTAPHTFECEECGKAFSVH
ZN551_HUMAN     CRECGKSFRQFSNLIRHRSYECSIQHQRVHGERCSECGKSFTRKSDLIQHRRIHTGTYECSECGK-----
ZN234_HUMAN     CDVCGKEFSQ-------SSHLQT--HQRVHTVKCVECGKFSRRSTLTVHCKLHSEKPYNCEECGRAFIHA
ZFP28_HUMAN     CIECGKAFIQNTSLIRHWRYYHTGEKP----FDCIDCGKAFSDHIGLNQHRRIHTGPYKCDVCHKSFRYG
Z354A_MOUSE     CSECG----------KGFTSISRLNRHRIIHTNCNECGKALSSHSTLIIHERIHTGC-KCKVCGKAFRQS
YS033_HUMAN     YKLEECGKA---FNVSS-----TLSQHKRIHTKCEECGKAFNVSSTLTQHKRIHTGPYKCEECGKAFNVS
RBAK_MOUSE      CSVCGKSFSQGTLTVHRRSHLEEKPY------KCNECGKFCQKLHLTQHQRTHSEKPYECSECGKSFCQK
ZNF66_HUMAN     ----------------------------------------------------------------------
ZN587_HUMAN     CEECGKSFSQKGSLISHGPYECLIQHQQGHGERAYHCGE---------CGKSFRQKCFRVHTGERPYKCG
ZN501_HUMAN     CNECGKAFNQSA---------CLMQHQRIHSGECTECGKFTQNSSLVEHERTHTEKLYKCSECEK-----
ZN260_RAT       CKECG-KAFNGKSYLKEHEKIHTGEKP----FECNQCGRAFSQKQYLIKHQNVHSGKFKCNECGKAFSQK
ZFP11_MOUSE     CPECG----------KAFNNSSTLTRHQIIHTKCQECSKYCSSYLIQHMKIHFEEIPYRCKECGKPFKCS
Z585A_PONAB     CT------EYGKVFSNNSNLITHKKVQREKSSICTECGKAFTYRSELIIHQRIHTGPYACSDCGKAFTQK
XFIN_XENLA      CTLCDRTFIQNSDLVKHQKVHANLPLSDPHTANSHKCSKFSHWSTFMKHSKLHSEKKFQCAECKKGFTQK
LIME_DICDI      ----------------------------------------------------------------------
ZNF14_PONAB     CKECGKAF--------NSSNSCRVHERTHIGEKCKQCGKSFSWSISLRLHERTHTGPYECKQCHKTFSFS
ZN860_HUMAN     CNDCHKVFSNATTIANHWRIH---NEERSY--KCNKCGKFFRRRSYLVVHWRTHTGPYKCNECGK-----
ZN665_HUMAN     CNECVKVFTQ---------YSHLANHRRIHTGRCDECGKAVRSSLTTHQAIHTGEKPYKCNDCGKVFTQN
ZN599_HUMAN     CKECGKAFTHRSSFIQHN-----MTHTREKPFLCKECGKAFYYSSSFAQHMRIHTGLYECGECGKAFTHR
ZN573_HUMAN     CKECGKTFSRRSNLVEHGQFHTD---EKPY--ICEKCGKFRRGHQLTVHQRVHTKKPYECKECGKGYTTA
ZN528_HUMAN     CKECDKVFGRKCFLTSHQRIHTR---ERPYG--CSQCGKIFSQKSDLIRHRKTHTDPYKCNKCGTAFREF
ZN510_HUMAN     CSECGKTFSQ-------KSHLST--HQRIHTAKCNECGKFVQKSTLRGHQRIHGEKPYECSECGKTFVQK
ZN501_PONAB     CNECGKAFNQSA---------CLMQHQRIHSGECTECGKFTQNSSLVEHERTHTEKLYKCSECEK-----
ZN420_BOVIN     -----------------------------------------------------HPRCYKCKECGKAFRRA
ZN337_HUMAN     CKDCERSFSQQGFIQKSTLVKHQITHSEEKPFVCKDCGRFIQKSTFTLHQRTHEEKPYGCRECGRRF--R
ZN256_HUMAN     CGECGKSYRQSSSLITHRRI-----HTGVRPHQCDECGKLFNRKYDLLIHQRVHTGPYKCSECGKSFSHS
ZN235_HUMAN     CNVCGKGFSQSSYFVHTGEYKCEVNHQRVHPYKCEECGKGFSQASNLQAHQSVHEKPFKCDACQKRFSQA
ZG26_XENLA      CTDCGKSFTQNHVKIHTGEKPFT----------CTECGKFSEKKTLREHNKIHGEKPFTCTYCGKSF--S
ZFP2_HUMAN      CNKCGKSFSQSTYLI---------EHQRLHSFECNECGKAFSKNSSLTQHRRIHEKPYECMVCGKHFTGR
MILK2_HUMAN     ----------------------------------------------------------------------
LIMD_DICDI      ----------------------------------------------------------------------
LIMK2_CHICK     CSECQ-DPLTNWYYEKDGKLYCHKDYWGKFGESCHGCSLLMTGPVMVAGEYKYHPECFACMSCKVIIEDG
LIMK1_XENLA     CSDCGVSLSHR-YYEKDGRLFCKKHYWTRFGGMCQGCSENIKGLVMVAGEHKYHPECFMCSRCKAYIGDG
LIMK1_MOUSE     CCECSVSLSHQ-YYEKDGQLFCKKDYWARYGESCHGCSEHIKGLVMVAGELKYHPECFICLACGNFIGDG
LIMK1_HUMAN     CCDCSASLSHQ-YYEKDGQLFCKKDYWARYGESCHGCSEITKGLVMVAGELKYHPECFICLTCGTFIGDG
LIMK1_RAT       CCECSTSLSHQ-YYEKDGQLFCKKDYWARYGESCHGCSEHITKGLVMVGGEKYHPECFICLACGNFIGDG
LIMK2_RAT       CSECQESLTNW-YYEKDGKLYCHKDYWAKFGEFCHGCSLLMTGPAMVAGEFKYHPECFACMSCKVIIEDG
LIMK2_BOVIN     CSECQ-DSLTNWYYEKDGKLYCHKDYWGKFGEFCHGCSLLMTGPVMVAGEFKYHPECFACMSCKVIIEDG
LIMK2_HUMAN     CSECQ-DSLTNWYYEKDGKLYCPKDYWGKFGEFCHGCSLLMTGPFMVAGEFKYHPECFACMSCKVIIEDG
LIMK2_MOUSE     CSECQESLTNW-YYEKDGKLYCHKDYWAKFGEFCHGCSLLMTGPAMVAGEFKYHPECFACMSCKVIIEDG
LHX4_MOUSE      CADCQMQLADR-CFSRAGSVYCKEDFFKRFGTKCTACQQGIPPTQVVRKAQVYHLHCFACIICNRQLATG
LHX4_HUMAN      CADCQMQLADR-CFSRAGSVYCKEDFFKRFGTKCTACQQGIPPTQVVRKAQVYHLHCFACIICNRQLATG
LIMK1_DROME     CSVCEGHL-HNWYFEREGLLYCREDYYGRFGDACQQCMAVITGPVMVAGEHKFHPECFCCTACGSFIGEG
LHX1_DANRE      CCECKCNLTEK-CFSREGKLYCKNDFFRRFGTKCAGCAQGISPNVRRARSKVFHLNCFTCMMCNKQLSTG
LHX1_XENLA      CCECKCNLTEK-CFSREGKLYCKNDFFRRFGTKCAGCAQGISPSVRRARSKVFHLNCFTCMMCNKQLSTG
LMO3_PONAB      CACCDCRLGEVGLYTKANLILCRRDYLRLFGVNCAACSKLIPAMVMRAKDNVYHLDCFACQLCNQRFCVG
LMO3_MOUSE      CACCDCRLGEVGLYTKANLILCRRDYLRLFGVNCAACSKLIPAMVMRAKDNVYHLDCFACQLCNQRFCVG
LMO3_HUMAN      CACCDCRLGEVGLYTKANLILCRRDYLRLFGVNCAACSKLIPAMVMRAKDNVYHLDCFACQLCNQRFCVG
LMO3_BOVIN      CACCDCRLGEVGLYTKANLILCRRDYLRLFGVNCAACSKLIPAMVMRAKDNVYHLDCFACQLCNQRFCVG
LHX5_RAT        CCECKTNLSEK-CFSREGKLYCKNDFFRRFGTKCAGCAQGISPSVRKARSKVFHLNCFTCMVCNKQLSTG
LHX5_MOUSE      CCECKTNLSEK-CFSREGKLYCKNDFFRRFGTKCAGCAQGISPSVRKARSKVFHLNCFTCMVCNKQLSTG
LHX5_HUMAN      CCECKTNLSEK-CFSREGKLYCKNDFFRRFGTKCAGCAQGISPSVRKARSKVFHLNCFTCMVCNKQLSTG
LHX5_DANRE      CCECNCNLTEK-CFSRDGKLYCKIDFFRRFGTKCAGCLQGISPSVRRARSKVFHLNCFTCMVCNKQLSTG
ISL3_ONCTS      CAECSQYLDETTCFVRDGKTYCKRDYVRLFGIKCAKCGFSSSDLVMRARDNVYHIECFRCSVCSRQLLPG
ISL2B_ONCTS     CSECSQYLDETTCFVRDGKTYCKRDYVRLFGIKCAKCGFCSSDLVMRARDNVYHMECFRCSVCSRQLVPG
LMO3_XENLA      CACCDCRLGEVGLYTKANLILCRRDYLRLFGVNCAACSKLIPAMVMRAKENVYHLDCFACQLCNQRFCVG
LMO3_DANRE      CACCDCRLGEVGLYTKANLILCRRDYLRLFGVNCAACSKLIPAMVMRAKENVYHLDCFACQLCNQRFCVG
LHX5_XENLA      CCECKCNLTEK-CFSREGKLYCKTDFFRRFGTKCAGCGISPSDLVRKARNKVFHLNCFTCMVCNKQLSTG
ISL2_RAT        CAECSQYLDETTCFVRDGKTYCKRDYVRLFGIKCAQCGFSSSDLVMRARDSVYHIECFRCSVCSRQLLPG
ISL2_MOUSE      CAECSQYLDETTCFVRDGKTYCKRDYVRLFGIKCAQCGFSSSDLVMRARDSVYHIECFRCSVCSRQLLPG
ISL2_HUMAN      CAECSQYLDETTCFVRDGKTYCKRDYVRLFGIKCAKCGFSSSDLVMRARDSVYHIECFRCSVCSRQLLPG
RBTN1_XENLA     CACCDCRLGEVGLYTKANLILCRRDYLRLFGTNCAACSKLIPAMVMRARDNVYHLDCFACQLCNQRFCVG
RBTN1_MOUSE     CACCDCRLGEVGLYTKANLILCRRDYLRLFGTNCAACSKLIPAMVMRARDNVYHLDCFACQLCNQRFCVG
RBTN1_HUMAN     CACCDCRLGEVGLYTKANLILCRRDYLRLFGTNCAACSKLIPAMVMRARDNVYHLDCFACQLCNQRFCVG
RBTN1_DANRE     CACCDCRLGEVGLYTKANLILCRRDYLRLFGTNCAACSKLIPAMVMRARDNVYHLDCFACQLCNQRFCVG
LMO3_RAT        CACCDCRLGEVGLYTKANLILCRRDYLRLFGTNCAACSKLIPAMVMRARDNVYHLDCFACQLCNQRFCVG
LHX3_CHICK      CSDCQTQLAEKCFSRGDGVY-CKEDFFKRFGTKCAACQQGIPPTQVVRRAQVYHLHCFACIVCKRQLATG
ISL2A_DANRE     CAECSQYLDETTCFVRDGKTYCKRDYVRLFGIKCAKCGFCSSDLVMRARDNVYHMECFRCSVCSRHLLPG
ISL1_DANRE      CAECNQYLDESTCFVRDGKTYCKRDYIRLYGIKCAKCGFSKNDFVMRARSKVYHIECFRCVACSRQLIPG
ISL1_CHICK      CAECNQYLDETTCFVRDGKTYCKRDYIRLYGIKCAKCGFSKNDFVMRARAKVYHIECFRCVACSRQLIPG
LHX3_DANRE      CSDCQSQLADKCFSRGDSVY-CKDDFFKRFGTKCAACQQGIPPTQVVRRAQVYHLHCFACIVCKRQLATG
ISL1_RAT        CAECNQYLDESTCFVRDGKTYCKRDYIRLYGIKCAKCGFSKNDFVMRARSKVYHIECFRCVACSRQLIPG
ISL1_MOUSE      CAECNQYLDESTCFVRDGKTYCKRDYIRLYGIKCAKCGFSKNDFVMRARSKVYHIECFRCVACSRQLIPG
ISL1_MESAU      CAECNQYLDESTCFVRDGKTYCKRDYIRLYGIKCAKCGFSKNDFVMRARSKVYHIECFRCVACSRQLIPG
ISL1_HUMAN      CAECNQYLDESTCFVRDGKTYCKRDYIRLYGIKCAKCGFSKNDFVMRARSKVYHIECFRCVACSRQLIPG
ISL2B_DANRE     CVECNQYLDETTCFVRDGKTYCKRDYVRLFGIKCAKCGFSSSDLVMRARDSVYHIECFRCSVCSRQLLPG
RBTN1_BOVIN     CACCDCRLGEVGLYTKANLILCRRDYLRLFGTNCAACSKLIPAMVMRARDNVYHLDCFACQLCNQRFCVG
LHX8_HUMAN      ----------------------------------------------------------------------
LHX8_MOUSE      ----------------------------------------------------------------------
LHX3_XENLA      CNDCQIQLAEKCFSRGDSVY-CKDDFFKRFGTKCAACQQGIPPTQVVRRAQVYHLHCFACIVCKRQLATG
LHX3_HUMAN      CSDCHTPLAERCFSRGESVY-CKDDFFKRFGTKCAACQLGIPPTQVVRRAQVYHLHCFACVVCKRQLATG
LHX9_RAT        -------------FAKDGSIYCKEDYYRRFSVRCH-LGISASEMVMRARDSVYHLSCFTCSTCNKTLTTG
LHX9_MOUSE      -------------FAKDGSIYCKEDYYRRFSVRCH-LGISASEMVMRARDSVYHLSCFTCSTCNKTLTTG
LHX9_HUMAN      -------------FAKDGSIYCKEDYYRRFSVRCH-LGISASEMVMRARDSVYHLSCFTCSTCNKTLTTG
LHX3_PIG        CSDCHTPLAERCF--SRGESLCKDDFFKRFGTKCAACQLGIPPTQVVRRAQVYHLHCFACVVCKRQLATG
LHX3_MOUSE      CSDCHVPLAERCFSRGESVY-CKDDFFKRFGTKCAACQLGIPPTQVVRRAQVYHLHCFACVVCKRQLATG
LHX9_BOVIN      -------------FAKDGSIYCKEDYYRRFSVRCH-LGISASEMVMRARDSVYHLSCFTCSTCNKTLTTG
LHX2_MOUSE      -------------FSKDGSIYCKEDYYRRFSVRCH-LGISASEMVMRARDLVYHLNCFTCTTCNKMLTTG
LHX2_HUMAN      -------------FSKDGSIYCKEDYYRRFSVRCH-LGISASEMVMRARDLVYHLNCFTCTTCNKMLTTG
LHX6_MOUSE      ----------------------------------------------------------------------
LHX6_HUMAN      ----------------------------------------------------------------------
APTE_DROME      CYACRQPLEESSCYSRDGNIYCKNDYYSFFGTRCSRCLASISSNVMRARNLVFHVNCFCCTVCHTPLTKG
LHX2_RAT        -------------FSKDGSIYCKEDYYRRFSVRCH-LGISESEMVMRARDLVYHLNCFTCTTCNKMLTTG
LHX9_ASTFA      -------------FAKDGSIYCKEDYYRRFSVRCH-LGISASEMVMRARDSVYHLSCFTCTSCNKTLTTG
ISL2_CHICK      CAECGQPLDETTCFLRDGKAYCKRDYGRLFGIKCAQCRAAFSSSVMRARDHVYHLECFRCAACGRQLLPG
LMO42_XENTR     CSCCQAQLGEIGTYTKSGMILCRNDYIRLFGNSCSACGQSIPASVMRAQGNVYHLKCFTCSTCRNRLVPG
LMX1B_CHICK     CAVCQQALTTSCYF-RDRKLYCKQDYQQLFAAKCSGCMEKIAPTVMRALECVYHLSCFCCCVCERQLRKG
LHX9_RANRU      -------------FAKDGSIYCKEDYYRRFSVRCH-LGISASEIVMRARESVYHLSCFTCTTCNKTLSTG
LMX1B_MOUSE     CAACQQALTTSCYF-RDRKLYCKQDYQQLFAAKCSGCMEKIAPTVMRALECVYHLGCFCCCVCERQLRKG
LMX1B_MESAU     CAACQQALTTSCYF-RDRKLYCKQDYQQLFAAKCSGCMEKIAPTVMRALECVYHLGCFCCCVCERQLRKG
LMX1B_HUMAN     CAACQQALTTSCYF-RDRKLYCKQDYQQLFAAKCSGCMEKIAPTVMRALECVYHLGCFCCCVCERQLRKG
LMO4_MOUSE      CSCCQAQLGDIGTYTKSGMILCRNDYIRLFGNSCSACGQSIPASVMRAQGNVYHLKCFTCSTCRNRLVPG
LMO4_HUMAN      CSCCQAQLGDIGTYTKSGMILCRNDYIRLFGNSCSACGQSIPASVMRAQGNVYHLKCFTCSTCRNRLVPG
LMO4_BOVIN      CSCCQAQLGDIGTYTKSGMILCRNDYIRLFGNSCSACGQSIPASVMRAQGNVYHLKCFTCSTCRNRLVPG
LMO4A_XENLA     CSCCQAQLGEIGTYTKSGMILCRNDYIRLFGNSCNACGQSIPASVMRAQGSVYHLKCFTCATCRNRLVPG
LMX1A_HUMAN     CASCKEPLETTCFY-RDKKLYCKYDYEKLFAVKCGGCFEAIAPNVMRAQKSVYHLSCFCCCVCERQLQKG
LIM_HALRO       CNDCSAQLSEK-CFSRGNLVFCKDDFFKRFGTKCTACGHGIPPTEVIAQDNVYHLECFCCFLCHEKMGTG
LHX9_XENLA      -------------FAKDGSIYCKEDYYRFSVKRCARCGISASEMVMRARESVYHLSCFTCTTCNKTLSTG
LMO4B_XENLA     CSCCQAQLGEIGTYTKSGMILCRNDYIRLFGNSCNACGQSIPASVMRAQGSVYHLKCFTCATCRNRLVPG
LMX1A_MOUSE     CASCKEPLETTCFY-RDKKLYCKYHYEKLFAVKCGGCFEAIAPNVMRAQKSVYHLSCFCCCVCERQLQKG
LMX1A_MESAU     CASCKEPLETTCFY-RDKKLYCKYHYEKLFAVKCGGCFEAIAPNVMRAQKSVYHLSCFCCCVCERQLQKG
RBTN2_MOUSE     ----------------------------------------------------------------------
RBTN2_HUMAN     ----------------------------------------------------------------------
RBTN2_BOVIN     ----------------------------------------------------------------------
RBTN2_XENTR     ----------------------------------------------------------------------
RBTN2_XENLA     ----------------------------------------------------------------------
RBTN2_DANRE     ----------------------------------------------------------------------
HM14_CAEEL      ----------------------------------------------------------------------
MEC3_CAEBR      ----------------------------------------------------------------------
LIMK_DICDI      ----------------------------------------------------------------------
MEC3_CAERE      ----------------------------------------------------------------------
MEC3_CAEEL      ----------------------------------------------------------------------
LMO41_XENTR     ----------------------------------------------------------------------
LMCD1_PIG       CAKCSEPLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFSEDYQRVDLAWHRKHFVCEGCEQQLGGR
LMCD1_HUMAN     CAKCSEPLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFAEDYQRVDLAWHRKHFVCEGCEQLLSGR
LMCD1_MOUSE     CIKCSEPLVDLIYFWKDGAPWCGRHYCESVRPRCSGCDEIIFSEDYQRVDLAWHRKHFICEGCEQLLSGR
PRIC4_HUMAN     ----------------------------------------------------------------------
PDLI3_CHICK     ----------------------------------------------------------------------
LMCD1_BOVIN     CAKCSEPLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFSEDYQRVDLAWHRKHFVCEGCEQQLGGR
PDLI3_RAT       ----------------------------------------------------------------------
PDLI3_PIG       ----------------------------------------------------------------------
PDLI3_MOUSE     ----------------------------------------------------------------------
PDLI3_BOVIN     ----------------------------------------------------------------------
PDLI3_HUMAN     ----------------------------------------------------------------------
PDLI4_RAT       ----------------------------------------------------------------------
PDLI4_RAT       ---------------------------------CTRCGHGIVGTIVKARDKLYHPECFMCSDC-------
PDLI4_MOUSE     ----------------------------------------------------------------------
PDLI4_MOUSE     ---------------------------------CTRCGHGIVGTIVKARDKLYHPECFMCSDC-------
PDLI4_HUMAN     ----------------------------------------------------------------------
PDLI4_HUMAN     ---------------------------------CTRCGHGIVGTIVKARDKLYHPECFMCSDC-------
PDLI4_BOVIN     ----------------------------------------------------------------------
PDLI4_BOVIN     ---------------------------------CTRCGHGIVGTIVKARDKLYHPECFMCSDC-------
PDLI4_CHICK     ----------------------------------------------------------------------
PDLI4_CHICK     ---------------------------------CTRCGNGIVGTIVKARDKLYHPECFMCDDC-------
PDLI3_XENLA     ----------------------------------------------------------------------
LIMA1_MOUSE     CSYCNNKLSLGTYASLHGRIYCKPHFNQLFKSK----GNYDEG---------------------------
LIMA1_HUMAN     CSYCNNKLSLGTYASLHGRIYCKPHFNQLFKSK----GNYDEG---------------------------
LIMD2_RAT       CKHCHTKLSLGSYAAMHGEFYCKPHFQQLFKSK----GNYDEG-----FGRKQHKELWA-----------
LIMD2_MOUSE     CKHCHTKLSLGSYAAMHGEFYCRPHFQQLFKSK----GNYDEG-----FGRKQHKELWA-----------
LIMD2_HUMAN     CKHCHTKLSLGSYAALHGEFYCKPHFQQLFKSK----GNYDEG-----FGRKQHKELWA-----------


                         +         .         .         .         .         *         .:210
query           DRVTFNGRDCLCQLCAQPMSSSPKETTFSSNCAGCGRDIKNGQALLALDKQWHLGCFKCKSCGKVLTGEY
ABLM1_HUMAN     DRVTFNGRDCLCQLCAQPMSSSPKETTFSSNCAGCGRDIKNGQALLALDKQWHLGCFKCKSCGKVLTGEY
ABLM1_MOUSE     DRVTFNGRDCLCQLCAQPMSSSPKEASCSSNCAGCGRDIKNGQALLALDKQWHLGCFKCKSCGKVLTGEY
ABLM3_HUMAN     DKVTFSGKECVCQTCSQSMASSPIKIRGPSHCAGCKEEIKHGQSLLALDKQWHVSCFKCQTCSVILTGEY
ABLM3_MOUSE     DKVTFSGKECVCQTCSQSMTSSPIKIRGPSHCAGCKEEIKHGQSLLALDKQWHVSCFKCQTCSVILTGEY
ABLM2_RAT       DRVTFNGKDCMCQKCSPPVGNSAHVAQGLRSCGGCGLEIKNGQALVALDKHWHLGCFKCKTCGKLLNAEY
ABLM2_HUMAN     DRVTFNGKECMCQKCSLPVSSSAHLSQGLRSCGGCGTEIKNGQALVALDKHWHLGCFKCKSCGKLLNAEY
ABLM2_MOUSE     DRVTFNGKECMCQKCSPPLGNSAHVAQGLRSCGGCGLEIKNGQALVALDKHWHLGCFKCKTCGKLLNAEY
DEMA_BOVIN      ----------------------------------------------------------------------
DEMA_PONAB      ----------------------------------------------------------------------
DEMA_HUMAN      ----------------------------------------------------------------------
DEMA_MOUSE      ----------------------------------------------------------------------
PXL1_CAEEL      ------GEDGFHEKNGQTYCKRDFFRLFAPKCNGCSQPI-TSNFITALGTHWHPDCFVCQHCGVSFNGSF
PAXB_DICDI      NFFERDGR---------PYCEADFYSTFAVRCGGCNSPIR-GECINALGTQWHPEHFVCQYCQKSFTGQF
PAXI_PONAB      G---FHEKD------GKAYCRKDYFDMFAPKCGGCARAILENY-ISALNTLWHPECFVCRECTPFVNGSF
PAXI_HUMAN      G---FHEKD------GKAYCRKDYFDMFAPKCGGCARAILENY-ISALNTLWHPECFVCRECTPFVNGSF
PAXI_CHICK      G---FHEKD------GKAYCRKDYFDMFAPKCGGCARAILENY-ISALNTLWHPECFVCRECTPFINGSF
PAXI_RAT        G---FHEKD------GKAYCRKDYFDMFAPKCGGCARAILENY-ISALNTLWHPECFVCRECTPFVNGSF
PAXI_MOUSE      G---FHEKD------GKAYCRKDYFDMFAPKCGGCARAILENY-ISALNTLWHPECFVCRECTPFVNGSF
LPXN_HUMAN      ------GAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLENY-LSAMDTVWHPECFVCGDCTSFSTGSF
TGFI1_XENLA     ------GEEGFHEKDGEQYCSDDYFRLFGAVCAGCTEAVKESY-ISALGGLWHPQCFVCHVCTPFINGSF
LPXN_MOUSE      ------GAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLENY-LSAMNTVWHPECFVCGDCXXXXXXXX
FHL3_BOVIN      SFVPDKGAH-YCVPC--------YENKFAPRCARCSKTLTQG-GVTYRDQPWHRECLVCTGCQTPLAGQF
LIMS2_HUMAN     KELTAEARELKGELYCLPCHDKMGVPI----CGACRRPIE-GRVVNALGKQWHVEHFVCAKCEKPFLGHH
LIMS2_BOVIN     KELTAEARELKGELYCLPCHDKMGVPI----CGACRRPIE-GRVVNALGKQWHVEHFVCAKCEKPFLGHH
TGFI1_HUMAN     DE-GFHERE------GRPYCRRDFLQLFAPRCQGCQGPILDNY-ISALSALWHPDCFVCRECFAPFSGSF
TGFI1_BOVIN     DE-GFHERE------GRPYCRRDFLQLFAPRCQGCQGPILDNY-ISALSALWHPDCFVCRECFAPFSGSF
FHL3_HUMAN      SFVPDKGAH-YCVPC--------YENKFAPRCARCSKTLTQG-GVTYRDQPWHRECLVCTGCQTPLAGQF
FHL3_MOUSE      SFVPDKGAH-YCVPC--------YENKFAPRCARCSKTLTQG-GVTYRDQPWHRECLVCTGCKTPLAGQF
FHL2_RAT        SFIPKENQN-FCVPC--------YEKQYALQCVQCKKPITTG-GVTYRDQPWHRECFVCTACKKQLSGQF
LIMS2_MOUSE     EKAKGLGK-FICQRCEQPLSNCGKELTSDARCGACRRPIE-GRVVNALGKQWHVEHFVCAKCEKPFLGHH
FHL2_MOUSE      SFIPKENQN-FCVPC--------YEKQYALQCVQCKKPITTG-GVTYREQPWHKECFVCTACKKQLSGQF
FHL1_RAT        SFFP-KGEDFYCVTC--------HETKFAKHCVKCNKAITSG-GITYQDQPWHAECFVCVTCSKKLAGQF
FHL1_MOUSE      SFFP-KGEDFYCVTC--------HETKFAKHCVKCNKAITSG-GITYQDQPWHAECFVCVTCSKKLAGQF
LIMS1_MOUSE     GFVKNAGRHLICQKCHAIIDEQPKNDPYHPNCANCGKELTEGRVVNAMGKQWHVEHFVCAKCEKPFLGHH
LIMS1_HUMAN     GFVKNAGRHLICQKCHAIIDEQPKNDPYHPNCANCGKELTEGRVVNAMGKQWHVEHFVCAKCEKPFLGHH
UNC97_CAEEL     SREV-NG-ELYCLRCHDTMGIPI--------CGACHRPIEE-RVIAALGKHWHVEHFVCSVCEKPFLGHH
FHL5_RAT        PLISKESGN-YCVPCF--------EKEFAHYCNFCKKVITSG-GITFRDQIWHKECFLCSGCRKELYEEF
FHL2_HUMAN      DNQNF------CVPC--------YEKQHAMQCVQCKKPITTG-GVTYREQPWHKECFVCTACRKQLSGQF
FHL5_MOUSE      PLISKESGN-YCVPCF--------EKEFAHYCNFCKKVITSG-GITFRDQIWHKECFLCSGCRKELYEEF
TGFI1_RAT       XXXXYCRRDFL--------------QLFAPRCQGCQGPILDNY-ISALSALWHPDCFVCRECAPFSGGSF
FHL2_BOVIN      DSENF------CVPC--------YERQYALQCVQCKKPITTG-GVTYREQPWHRECFVCTACKKPLSGQF
FHL5_BOVIN      PLISKESGN-YCVPCF--------EKEFAHYCSFCKKVITSG-GITFRDQPWHKECFLCSGCRKELEEEF
PDLI7_CHICK     NRAFYMEE-------GQPYCERDYEKMFGTKCRGCDFKIDAGDRFLALGFSWHDTCFVCAICQTNLEGKF
PDLI7_MOUSE     GFFEEKGA-IFCPSCY--------DVRYAPNCAKCKKKI-TGEIMHALKMTWHVHCFTCAACKTPIRNRF
LIMK1_CHICK     -----------CTWRDEPMGE--EEGTDLPVCASCGQGIFDGQYLQALNADWHADCFRCGECGASLSHQY
FHL5_HUMAN      PLISKESGN-YCVPCF--------EKEFAHYCNFCKKVITSG-GITFCDQLWHKECFLCSGCRKDLCEEF
FHL5_MACFA      PLISKESGN-FCVPCF--------EKEFAHYCNFCKKVITSG-GITFCDQLWHKECFLCSGCRKDLCEEF
PDLI7_XENLA     GFFEEKG-SIFCPCCY--------DARFAPNCAKCKKKI-TGEIMHALKMTWHVPCFTCAYCKTPIRNRF
LIMK2_CHICK     ------------------MAGPPGEEVW--RCLGCGDLIAAGQRLYRMNEAWHISCFRCSECQDPLTNWY
PDLI7_RAT       GFFEEKGA-IFCPSCY--------DVRYAPSCAKCKKKI-TGEIMHALKMTWHVPCFTCAACKTPIRNRF
PDLI7_BOVIN     GFFEEKGA-IFCPPCY--------DVRYAPSCAKCKKKI-TGEVMHALKTTWHVHCFTCAACAPIRNRAF
PIN2_CAEEL      ARTIKD--DLFCPRC------------FDFKCEVCFDDPQVEQSIFTMNKHWHTDHFRCATCARPFFGEH
PDLI7_DANRE     GFFEEKG-SIYCSKCY--------DNRYSPNCAKC-KKIITGEIMHALKMTYHVQCFLCAACKLPIRNQF
PDLI5_RAT       ---VFHLED------GEPYCETDYYALFGTICRGCEFPIEAGDMFLALGSTWHDTCFVCSVCCESLEGQF
PDLI7_HUMAN     GFFEEKGA-IFCPPCY--------DVRYAPSCAKCKKKI-TGEIMHALKMTWHVHCFTCAACKTPIRNRF
PDLI5_MOUSE     GFVEEKGA-LYCELCY--------EKFFAPECGRCQRKIL-GEVINALKQTWHVSCFVCVACGKPIRNNV
PDLI5_HUMAN     GFVEEKGA-LYCELCY--------EKFFAPECGRCQRKIL-GEVINALKQTWHVSCFVCVACGKPIRNNV
LIMK1_XENLA     -------------------------------CASCGQSIYDGCYLQALALDWHSDCFRCSDCGVSLSHRY
FHL1_HUMAN      SFFP-KGEDFYCVTC--------HETKFAKHCVKCNKAITSG-GITYQDQPWHADCFVCVTCSKKLAGQF
LIMK1_MOUSE     -------------------------------CASCGQRIYDGQYLQALNADWHADCFRCCECSVSLSHQY
LIMK1_HUMAN     -------------------------------CASCGQRIYDGQYLQALNADWHADCFRCCDCSASLSHQY
LIMK1_RAT       -------------------------------CASCSQSIYDGQYLQALNADWHADCFRCCECSTSLSHQY
LDB3_HUMAN      ------GNSLFHMEDGEPYCEKDYINLFSTKCHGCDFPVEAGDKFIALGHTWHDTCFICAVCHVNLEGQF
LIMB_DICDI      DGEVY------CNTC--KIARQKRLAAKSEICSKCKLPI-TGEYIILQGQPVHSEHYRCEECGEFNVGKT
LIMK2_RAT       -------------------------------CRGCGNYVPLSQRLYTANEAWHSSCFRCSECQESLTNWY
WTIP_DANRE      DGVPFNNIYCV----------KDYHTVFAPKCASCNQPILPAQGVVSMDKDYHVDCYHCEDCGLQLNDE-
LIMK2_BOVIN     -------------------------------CQGCGDYVAPNQRLYTVSEAWPTSCFRCSECQDSLTNWY
LIMK2_HUMAN     -------------------------------CPGCGDHIAPSQIWYTVNETWHGSCFRCSECQDSLTNWY
LDB3_MOUSE      ------GNSLFHMEDGEPYCEKDYINLFSTKCHGCDFPVEAGDKFIALGHTWHDTCFICAVCHVNLEGQF
LIMK2_MOUSE     -------------------------------CRGCGTYVPLSQRLYTANEAWHGSCFRCSECQESLTNWY
ZYX_MOUSE       ----LEGTSFIVDQANQPHSVPDYHKQYAPRCSVCSEPIDETVRVVALDKNFHMKCYKCEDCGKPLS---
ZYX_HUMAN       SFIVANRPHCVCSVCSEPIMPEP------------GRD--ETVRVVALDKNFHMKCYKCEDCGKPLS---
YOCC_SCHPO      IPCIYRDDLYWCQTC--------YDNKYAVKCKKCRKPIL-GISVKGSDGEYHSQCWTCGACNALLGDEY
LHX4_MOUSE      ----------LPEMLGVPMQQIPQ-------CAGCNQHILDKFILKVLDRHWHSSCLKCADCQMQLADRC
LHX4_HUMAN      ----------LPEMLGVPMQQIPQ-------CAGCNQHILDKFILKVLDRHWHSSCLKCADCQMQLADRC
TGFI1_MOUSE     XXXXXXXXX----YCRRDFLQ-----LFAPRCQGCQGPILDNY-ISALSALWHPDCFVCRECLAPFSGSF
FBLI1_PONAB     DESFALGSQCLCSICENPIIPRDGKDAFKIECMG---------------RSFHENCYRCEDCRILLSVEP
FBLI1_BOVIN     DESSQNEVYCLCSICENPIIPRDGKDAFKIECMG---------------RNFHENCYRCEDCRVLLSVEP
WTIP_HUMAN      DGVPFTVDVENNIYCVRDY-----HTVFAPKCASCARPILPAQGVVSMDRDYHVACYHCEDCGLQLSGE-
FBLI1_HUMAN     DESFALGSQCLCSICENPIIPRDGKDAFKIECMG---------------RNFHENCYRCEDCRILLSVEP
LIMK1_DROME     --------------------------------------------VMALGQQWHCDCFRCSVCEGHLHNWY
WTIP_XENLA      DGVPFNNIYCV----------KDYHTVFAPKCASCNQPILPAQGVVSMDKDYHVECYHCEDCQLQLNDE-
FBLI1_MOUSE     SFALDSQNQVVCSICENPIIPRDGKDAFKIECMG---------------RNFHENCYRCEDCSVLLSVE-
LIMCH_DICDI     EDFTEVDNEPFCNPCASQLNKQPKQSPFSDRCVVCVKPL-NGEVAKIFDSFYHKGCFKCKSCNAPLLTGY
LIMD1_MOUSE     DGVPFTVDSENKIYCVRDY-----HKVLAPKCAACGLPILPPEGVVSMDRDYHVECYHCEDCGLELNDE-
LIMD1_HUMAN     DGVPFTVDSENKIYCVRDY-----HKVLAPKCAACGLPILPPEGVVSMDRDYHVECYHCEDCGLELNDE-
Y6787_DICDI     SRCE-EGPDGFAY-CSKDLLDK-----FAPKCQKCKQAII-GQTTNAVGKTYHPEHFQCETCNMVLTGNY
LHX1_SAIBB      ------------------------------HCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKC
LHX1_RAT        ------------------------------HCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKC
LHX1_PANTR      ------------------------------HCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKC
LHX1_MOUSE      ------------------------------HCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKC
LHX1_MESAU      ------------------------------HCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKC
LHX1_HUMAN      ------------------------------HCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKC
LHX1_DANRE      ------------------------------HCAGCERPILDRFLLNVLDRAWHIKCVQCCECKCNLTEKC
LHX1_CHICK      ------------------------------HCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKC
WTIP_MOUSE      DGVPFTVDVDNNIYCVRDY-----HTVFAPKCASCARPILPAQGVVSMDRDYHVECYHCEDCGLQLSGE-
LHX1_XENLA      ------------------------------HCAGCERPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKC
LPP_RAT         DGIPFTVDACGLIHCIEDFHKK-----FAPRCSVCKEPIEETVRIVALDRDFHVHCYRCEDCGGLLS---
LMO3_PONAB      ---------------------SVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCGEVGSTLY
LMO3_MOUSE      ---------------------SVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCGEVGSTLY
LMO3_HUMAN      ---------------------SVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCGEVGSTLY
LMO3_BOVIN      ---------------------SVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCGEVGSTLY
LHX5_RAT        ------------------------------HCAGCERPILDRFLLNVLDRAWHIKCVQCCECKTNLSEKC
LHX5_MOUSE      ------------------------------HCAGCERPILDRFLLNVLDRAWHIKCVQCCECKTNLSEKC
LHX5_HUMAN      ------------------------------HCAGCERPILDRFLLNVLDRAWHIKCVQCCECKTNLSEKC
LHX5_DANRE      ------------------------------HCAGCERPILDRFLLNVLDRAWHAKCVQCCECNCNLTEKC
ISL3_ONCTS      ------------------MGDHSKKKSGFAMCVGCGSQIHDQYILVSPDLEWHAACLKCAECSQYLTCTC
ISL2B_ONCTS     -------------------------------CVGCGSQIHDQYILVAPDLEWHAACLKCSECSQYLTCTC
LPP_MOUSE       DGIPFTVDACGLIHCIEDFHKK-----FAPRCSVCKEPIEETVRIVALDRDFHVHCYRCEDCGGLLS---
JUB_RAT         ---CLDGVPFTVDFSNQVYCVTDYHKNYAPKCAACGQPILPSEGVISMDRDYHFECYHCEDCRMQLSDE-
JUB_MOUSE       ---CLDGVPFTVDFSNQVYCVTDYHKNYAPKCAACGQPILPSEGVISMDRDYHFECYHCEDCRMQLSDE-
JUB_HUMAN       ---CLDGIPFTVDFSNQVYCVTDYHKNYAPKCAACGQPILPSEGVISMDRDYHFECYHCEDCRMQLSDE-
LMO3_XENLA      ---------------------SVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCGEVGSTLY
LMO3_DANRE      ---------------------SVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCGEVGSTLY
LHX5_XENLA      -----------------------------AHCAGCERPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKC
ISL2_RAT        ------------------MGDHSKKKPGTAMCVGCGSQIHDQFILVSPDLEWHAACLKCAECSQYLTCTC
ISL2_MOUSE      ------------------MGDHSKKKPGTAMCVGCGSQIHDQFILVSPDLEWHAACLKCAECSQYLTCTC
ISL2_HUMAN      ------------------MGDHSKKKPGTAMCVGCGSQIHDQFILVSPDLEWHAACLKCAECSQYLTCTC
ISL2A_ONCTS     ------------------MGDHSKKKSGIAMCVGCGSQIHDQYILVAPDLEWHAACLKCAECSQYLTCTC
RBTN1_XENLA     -------------------------------CAGCNRKIKDRYLLKALDKYWHEDCLKCACCGEVGSTLY
RBTN1_MOUSE     -------------------------------CAGCNRKIKDRYLLKALDKYWHEDCLKCACCGEVGSTLY
RBTN1_HUMAN     -------------------------------CAGCNRKIKDRYLLKALDKYWHEDCLKCACCGEVGSTLY
RBTN1_DANRE     -------------------------------CAGCNRKIKDRYLLKALDKYWHEDCLKCACCGEVGSTLY
LMO3_RAT        -------------------------------CAGCNRKIKDRYLLKALDKYWHEDCLKCACCGEVGSTLY
LHX3_CHICK      ------GSEKAAELC--PFPRSPEIPL----CAGCNQHIVDRFILKVLDRHWHSKCLKCSDCQTQLAEKC
ISL2A_DANRE     ------------------MGDHSKKKSGIAMCVGCGSQIHDQYILVSPDLEWHAACLKCAECSQYLTCTC
ISL1_DANRE      ------------------MGDPPKKKRLISLCVGCGNQIHDQYILVSPDLEWHAACLKCAECNQYLDESC
ISL1_CHICK      ------------------MGDPPKKKRLISLCVGCGNQIHDQYILVSPDLEWHAACLKCAECNQYLTCTC
LHX3_DANRE      -------------------------------CAGCNQHIVDRFILKVLDRHWHSKCLKCSDCQSQLADKC
ISL1_RAT        ------------------MGDPPKKKRLISLCVGCGNQIHDQYILVSPDLEWHAACLKCAECNQYLDESC
ISL1_MOUSE      ------------------MGDPPKKKRLISLCVGCGNQIHDQYILVSPDLEWHAACLKCAECNQYLDESC
ISL1_MESAU      ------------------MGDPPKKKRLISLCVGCGNQIHDQYILVSPDLEWHAACLKCAECNQYLDESC
ISL1_HUMAN      ------------------MGDPPKKKRLISLCVGCGNQIHDQYILVSPDLEWHAACLKCAECNQYLDESC
ISL2B_DANRE     ------------------MGDHSKKKSGLAMCVGCGSQIHDQYILVSPDLEWHAACLKCVECNQYLTCTC
RBTN1_BOVIN     -------------------------------CAGCNRKIKDRYLLKALDQYWHEDCLKCACCGEVGSTLY
LPP_CHICK       DGIPFGNIHCICSVCKEPIMPAPGQ--------------EETVRIVALDRDFHVQCYRCEDCGGLLS---
LHX8_HUMAN      EEFALVEEKVLCRVHYDCMLDNLKREVENGN---------------------------------------
LPP_HUMAN       IPFTVDAGGLICSVCKEPIMPAPGQ--------------EETVRIVALDRDFHVHCYRCEDCGGLLS---
ZYX_XENLA       --CSLQGEPFIVDDNKLPHCVNDYHRRYAPRCCVCGDPIDETVRVVALEKNFHMMCYKCEDCGCPLS---
LHX8_MOUSE      EEFALVEEKVLCRVHFDCMLDNLKREVENGN---------------------------------------
LHX3_XENLA      -------------------------------CAGCNQHIVDRFILKVLDRHWHSKCLKCNDCQIQLAEKC
LHX3_HUMAN      -------------------------------CAGCDQHILDRFILKALDRHWHSKCLKCSDCHTPLAERC
ZYX_XENTR       --CSLQGEPFIVDDNKLPHCVSDYHRRYAPRCTVCGDPIDETVRVVALEKNFHMMCYKCEDCGCPLSIE-
TES_XENTR       DMIYFNGK----LYCGRHYCDSEKP-----RCAGCDELIFSNEYTQAEGLNWHLKHFCCFDCDCVLAGEY
LHX9_RAT        -------------------------------CAGCGGKISDRYYLLAVDKQWHLXXXXXXXXXXXXXXTC
LHX9_MOUSE      -------------------------------CAGCGGKISDRYYLLAVDKQWHLXXXXXXXXXXXXXXTC
LHX9_HUMAN      -------------------------------CAGCGGKISDRYYLLAVDKQWHLXXXXXXXXXXXXXXTC
LHX3_PIG        -------------------------------CAGCDQHILDRFILKALDRHWHSKCLKCSDCHTPLAERC
LHX3_MOUSE      -------------------------------CAGCDQHILDRFILKALDRHWHSKCLKCSDCHVPLAERC
LHX9_BOVIN      -------------------------------CAGCGGKIADRYYLLAVDKQWHLXXXXXXXXXXXXXXTC
LHX2_MOUSE      -------------------------------CAGCGGKISDRYYLLAVDKQWHMXXXXXXXXXXXXXXTC
LHX2_HUMAN      -------------------------------CAGCGGKISDRYYLLAVDKQWHMXXXXXXXXXXXXXXTC
ZYX_CHICK       ----LEGASFIVDQANQPHCVDDYHRKYAPRCSVCSEPIDETVRVVALEKNFHMKCYKCEDCGRPLS---
LHX6_MOUSE      EEFGLVEEKVLCRIHYDTMIENLKKAAENGN---------------------------------------
LHX6_HUMAN      EEFGLVEEKVLCRIHYDTMIENLKRAAENGN---------------------------------------
APTE_DROME      --------------------SSPESTSDSKDCSGCGRQIQDRFYLSAVEKRWHASCLQCYACRQPLEREC
LHX2_RAT        -------------------------------CAGCGGKISDRYYLLAVDKQWHMXXXXXXXXXXXXXXTC
LIMA_DICDI      TEPSTNKIFCACQIVLNDLAKPKRDSL--GFCCSCYKFLTEEDDIIVIDKEYHNKCFKCSSCKEVIRGNN
LHX9_ASTFA      --VQMNGRET-----SMP-SVSPEKPAL---CAGCGSKISDRYYLLAVDKQWHLXXXXXXXXXXXXXXTC
PRIC1_XENTR     RYIMKDGRPFCCGCF---------ESHYAEYCESCGEHIGVDHAQMTYDGQWHATCFSCAQCKVSLLGPF
ISL2_CHICK      ------------------------------------------------DLEWHVACLKCAECGQPLTCTC
PRIC1_AEDAE     DLIYFHREARL--YCGRHHAE-----TLKPRCSACDEIILADECTEAEGRAWHIKHFACFECDKQLGGQY
PRI1B_XENLA     RYIMKDGRPFCCGCF---------ESHYAEYCESCGDHIGVDHAQMTYDGQWHATCFSCAQCKVSLLGPF
LMO42_XENTR     -------------------SSQPPPVTASTRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCGEIGTSCY
LMX1B_CHICK     -------------------------------CEGCQRPISDRFLMRVNESSWHEECLQCAVCQQALTTSC
LHX9_RANRU      ---------------------SPEKPTL---CAGCGGKISDRYYLLAVDKQWHLXXXXXXXXXXXXXXTC
PRIC1_DROME     DLIYFH-RD------GRMYCGRHHAETLKPRCSACDEIILADECTEAEGRAWHMNHFACHECDKQLGGQY
PRI1A_XENLA     RYIMKDGRPFCCGCF---------ESHYAEYCESCGEHIGVDHAQMTYDGQWHATCFSCAQCKVSLLGPF
LMX1B_MOUSE     -------------------------------CEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSC
LMX1B_MESAU     -------------------------------CEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSC
LMX1B_HUMAN     -------------------------------CEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSC
LIMF_DICDI      YFTDKETGDFYCAKCEVIRNDQSKPLRESLGCSLCYKYFRQNEDILTIDERYHIGCLKCTICKKGINNEM
LMO4_MOUSE      -------------------SSQPPPVTAGSRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCGDIGTSCY
LMO4_HUMAN      -------------------SSQPPPVTAGSRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCGDIGTSCY
LMO4_BOVIN      -------------------SSQPPPVTAGSRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCGDIGTSCY
LMO4A_XENLA     -------------------SSESTTTAVSSNCAGCGGKIGDRFLLYSMDRYWHTRCLKCSCCGEIGTSCY
PRIC1_DROPS     DLIYFH-RD------GRMYCGRHHAETLKPRCSACDEIILADECTEAEGRAWHMNHFACHECDKQLGGQY
ESN_DROPS       DLIYFQRDGNL--YCGRHHAETQKP-----RCSACDEIIFSDECTEAEGRTWHMKHFACQECEHQLGGQY
TES_RABIT       DMIYFNGK----LFCGRHYCDSEKP-----RCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDNILAGEY
LMX1A_HUMAN     -----------------------------SVCEGCQRVILDRFLLRLNDSFWHEQCVQCASCKEPLETTC
ESN_DROME       DLIYFQRDGNL--YCGRHHAETQKP-----RCSACDEIIFSDECTEAEGRTWHMKHFACQECEHQLGGQY
TRIP6_MOUSE     DGIPFT-VDATSQICIEDF-----HRKFAPRCSVCGGAIEPGQRIVALDRSFHIGCYK------------
RGA1_SCHPO      DSYYEYEGKVYCHY--------HYSTLFAARCCGCDGPIRNG-----VSQNWHVPC--------------
PRIC1_ANOGA     DLIYFHRENRL--YCGRHHAE-----TLKPRCSACDEIILADECTEAEGRAWHIKHFACFECDKQLGGQY
LIN11_CAEEL     -------------------TTQPHISEISGNCAACAQPILDRYVFTVLGKCWHQSCLRCCDCRAPMSMTC
LIM_HALRO       -------------------------------CTGCEHRIFDRFILKVQDKPWHSQCLKCNDCSAQLSEKC
TES_AOTNA       DMIYFWKNEKL--YCGRHYCDSEKP-----RCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEY
PRIC2_MOUSE     DLIYFYQDGKI--YCGRHHAECLKP-----RCAACDEIIFADECTEAEGRHWHMRHFCCFECETVLGGQY
LHX9_XENLA      -------------------SLNPEKPTL---CAGCGGKISDRYYLLAVDKQWHXXXXXXXXXXXXXXXXX
TES_SAIBB       DMIYFWKNEKL--YCGRHYCDSEKP-----RCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEY
TES_PIG         DMIYFWKNDKL--YCGRHYCDSEKP-----RCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDNILAGEY
TES_CALMO       DMIYFWKNEKL--YCGRHYCDSEKP-----RCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEY
TES_ATEGE       DMIYFWKNEKL--YCGRHYCDSEKP-----RCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEY
LMO4B_XENLA     -------------------------------CAGCGGKIADRFLLYSMDRYWHTRCLKCSCCGEIGTSCY
PRIC2_HUMAN     DLIYFYQDGKI--YCGRHHAECLKP-----RCAACDEIIFADECTEAEGRHWHMKHFCCFECETVLGGQY
TRIP6_BOVIN     DGIPFT-VDATSQICIEDF-----HRKFAPRCSVCGGAIEPGQRIVALDRSFHIGCYK------------
TES_XENLA       DMIYFNGK----LYCGRHYCDSEKP-----RCAGCDELIFSNEYTQAEGLNWHLKHFCCFDCDIVLAGEY
TES_PAPAN       DMIYFWKNEKL--YCGRHYCDSEKP-----RCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEY
TES_OTOGA       DMIYFWKNEKL--YCGRHYCDSEKP-----RCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDNVLAGEY
TES_NEONE       DMIYFNGK----LYCGRHYCDSEKP-----RCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDNILAGEY
TES_MUNRE       DMIYFNGK----LYCGRHYCDSEKP-----RCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDNILAGEY
TES_MUNMU       DMIYFNGK----LYCGRHYCDSEKP-----RCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDNILAGEY
TES_FELCA       DMIYFNGK----LYCGRHYCDSEKP-----RCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDNILAGEY
TES_EULMM       DMIYFWKDEKL--YCGRHYCDSEKP-----RCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDNILAGEY
TES_DASNO       DMIYFNGK----LYCGRHYCDSEKP-----RCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDNILAGEY
TES_CERAE       DMIYFWKNEKL--YCGRHYCDSEKP-----RCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEY
TES_ATEAB       DMIYFNGK----LYCGRHYCDSEKP-----RCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDNILAGEY
LMX1A_MOUSE     -----------------------------SVCEGCQRVISDRFLLRLNDSFWHEQCVQCASCKEPLETTC
LMX1A_MESAU     -----------------------------SVCEGCQRVISDRFLLRLNDSFWHEQCVQCASCKEPLETTC
TES_LOXAF       DMIYFNGK----LYCGRHYCDSEKP-----RCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDNILAGEY
TRIP6_HUMAN     DGIPFT-VDATSQICIEDF-----HRKFAPRCSVCGGAIEPGQRIVALDRSFHIGCYK------------
TES_SHEEP       DMIYFNGK----LYCGRHYCDSEKP-----RCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDNILAGEY
TES_PONAB       DMIYFWKNEKL--YCGRHYCDSEKP-----RCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEY
TES_PANTR       DMIYFWKNEKL--YCGRHYCDSEKP-----RCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEY
TES_HYLLE       DMIYFWKNEKL--YCGRHYCDSEKP-----RCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEY
TES_HUMAN       DMIYFWKNEKL--YCGRHYCDSEKP-----RCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEY
TES_HORSE       DMIYFNGK----LYCGRHYCDSEKP-----RCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEY
TES_COLGU       DMIYFWKNEKL--YCGRHYCDSEKP-----RCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEY
TES_CANFA       DMIYFNGK----LYCGRHYCDSEKP-----RCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDNILAGEY
TES_MUSPF       DMIYFWKKGKL--YCGRHYCDSEKP-----RCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDNILAGEY
TES_MONDO       DMIYFNGK----LFCGRHYCDSEKP-----RCAGCDELIFSNEYTQAEDQNWHLKHFCCFDCDSILAGEY
TES_CALJA       DMIYFWKNEKL--YCGRHYCDSEKP-----RCAGCDELIFSNEYTQAEKQSWHLKHFCCFACDGILAGDY
PRIC1_MOUSE     RYIMKDGRPFCCGCF---------ESLYAEYCETCGEHIGVDHAQMTYDGQWHAACFSCAQCKASLLGPF
PRIC1_HUMAN     RYIMKDGRPFCCGCF---------ESLYAEYCETCGEHIGVDHAQMTYDGQWHAACFSCAQCKASLLGPF
TES_MICMU       DMIYFWKDEKL--YCGRHYCDSEKP-----RCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDYILAGEY
RBTN2_MOUSE     DRYLLINSDIVCE---------------------------------------------------------
RBTN2_HUMAN     DRYLLINSDIVCE---------------------------------------------------------
RBTN2_BOVIN     DRYLLINSDIVCE---------------------------------------------------------
TES_BOVIN       DMIYFNGK----LYCGRHYCDSEKP-----RCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDNILAGEY
CRIP3_HUMAN     XXXXXXXXTGL----PQGKKSPPHMKTFTSLCPGCGEPVYFAEKVMSLGRNWHRPCLRCQRCHKTLTGSH
RBTN2_XENTR     DRYLLINSDIVCE---------------------------------------------------------
RBTN2_XENLA     DRYLLINSDIVCE---------------------------------------------------------
TES_RAT         DMIYFNGK----LYCGRHYCDSEKP-----RCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDNILAGKY
TES_MOUSE       DMIYFNGK----LYCGRHYCDSEKP-----RCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDHILAGKY
RBTN2_DANRE     DRYLLINSDIVCE---------------------------------------------------------
LIMG_DICDI      QFVTGSDGSAICKSC----SDKSKQV----NCFACKKPIDSTFTVVSGNK-YHPNCFVCSQCKGSLEKGY
CSRP2_RAT       TTVAIHDEEIYCRLGIKPESAQPHRPTTNPNCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTT
CRIP2_PONAB     PQVTGPIEVPAARAEERKASGPPKGTTFTNTCPRCSKKVYFAEKVTSLGKDWHRPCLHCERCGKTLTGGH
PRIC1_RAT       RYIMKDGRPFCCGCF---------ESLYAEYCETCGEHIGVDHAQMTYDGQWHAACFSCAQCKASLLGPF
CRIP2_HUMAN     GHAEHDGKPFCHKPCEKPLAEGPQVTTFTNTCPRCSKKVYFAEKVTSLGKDWHRPCLRCERCGKTLTGGH
TES_CHICK       DMIYFNGN----LYCGRHYCDSEKP-----RCAGCDELIFSNEYTQAEGQNWHLKHFCCFDCDCVLAGEY
TES_RHIFE       DMIYFNGK----LYCGRHYCDSEKP-----RCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDNILAGEY
CSRP2_MOUSE     TTVAIHDEEIYCRLGIKPESAQPHRPTTNPNCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTT
CRIP2_BOVIN     GHAEHDGKPFCHKPCEKPQVTGPIETTFTGECPRCNKRVYFAEKVTSLGKDWHRPCLRCERCGKTLTGGH
CSRP2_HUMAN     TTVAIHDEEIYCRLGIKPESVQPHRPTTNPNCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTT
CSRP2_BOVIN     TTVAIHDEEIYCRLGIKPESVQPHRPTTNPNCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTT
PRIC3_HUMAN     DLIYFHVGKVYCGRCLRPRCQACDEIIFSPECTE------------AEGRHWHMDHFCCFECEASLGGQY
CSRP3_MOUSE     AATTSN-----------PSKFSAKFGE-SEKCPRCGKSVYAAEKVMGGGKPWHKTCFRCAICGKSLESTN
CRIP2_MOUSE     GHAEHDGKPFCHKPCEKPQTEAPQVTTFTGECPRCNKRVYFAEKVTSLGKDWHRPCLRCERCSKTLTGGH
CSRP2_COTJA     TTVAIHDAEVYCRLGIKPESSSPHRPTTNPNCSRCGDSVYAAEKVIGAGKPWHKNCFRCAKCGKSLESTT
CSRP3_RAT       AATTSN-----------PSKFSAKFGE-SEKCPRCGKSVYAAEKVMGGGKPWHKTCFPCAICGKSLESTN
CSRP3_BOVIN     EHLGLQFQQSPKQARSATTSSNPSKFAKSEKCPRCGKSVYAAEKVMGGGKPWHKTCFRCAICGKSLESTN
CRIP2_RAT       GHAEHDGKPFCHKPCEAPQVTGPIETTFTGECPRCNKRVYFAEKVTSLGKDWHRPCLRCERCSKTLTGGH
HM14_CAEEL      E---------------------------------------------------------------------
CSRP3_HUMAN     SVTTSNP------------SKFTAKFGESEKCPRCGKSVYAAEKVMGGGKPWHKTCFRCAICGKSLESTN
CSRP2_CHICK     TTVAIHDAEVYCRLGIKPESTSPHRPTTNPNCSRCGDSVYAAEKVIGAGKPWHKNCFRCAKCGKSLESTT
MEC3_CAEBR      EQI-------------------------------------------------------------------
AWH_DROME       EQFALMDDRVLCK--AHYLETVEGGTTSSDE--GCDGD--------------------------------
LHX9_DANRE      ---------------AKTVQMNGRETTMPSMCAGCGGKISDRYYLLAVDKQWHLXXXXXXXXXXXXXXTC
Y1927_ARATH     ----------------------PRPITFQMDCAGCNMEIGHGRFLNCLNSLWHPECFRCYGCSQPISEEF
PXL1_YEAST      -------------------------------CRACGLEV-TGKRMFSLSGQWHRECFKCIECGIKFNKHY
PRIC3_MOUSE     DLIYFHAGKVYCGRCLRPRCQACDEIIFSPECTE------------AEGRHWHMGHFCCFECEASLGGQY
LIMK_DICDI      ----------------------------------------------------------------------
LIMC_DICDI      ----------------------------SSICPTCTKRVYAAEAVKACEKQYHKLCLQCFHCHKILLGQY
LHX9_CHICK      -------------------------------CAGCGGKISDRYYLLAVDKQWHLXXXXXXXXXXXXXXTC
MEC3_CAERE      EQI-------------------------------------------------------------------
ZN420_HUMAN     SQLTQH----------QRIHTGEK----PYQCKECGKAFNRG-SLLTRHQRIHTGPYECKECGKTFSGSE
CRIP1_RAT       -------------------------------CPKCDKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTGGH
CRIP1_MOUSE     -------------------------------CPKCDKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTGGH
CRIP1_HUMAN     -------------------------------CPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTGGH
CRIP1_BOVIN     -------------------------------CPKCSKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTGGH
MEC3_CAEEL      EQI-------------------------------------------------------------------
ZN571_HUMAN     SHLTYHQRPYICKLCASQLNEHQRIHTGEKECKECGKTFFRGSQL-TYHLRVHSGPYKCKECGKA----F
LRG1_YEAST      ----------------------------TDSCAGCNKYIQE-ECIQFYEHRWHIACFTCSSCHK------
ZN571_PONAB     SHLTYHQRPYICKLCASQLNEHQRIHTGEKECKECGKAFFRGSQL-TYHLRVHSGPYKCKECGKA----F
VILI_CHICK      ----------------------------------------------------------------------
CSRP1_RAT       TTVAVHGEEIYCEAPGHRPTTNPNASKFSERCPRCSQAVYAAEKVIGAGKSWHKSCFRCAKCGKGLESTT
CSRP1_MOUSE     TTVAVHGEEIYCEAPGHRPTTNPNASKFSERCPRCSQAVYAAEKVIGAGKSWHKSCFRCAKCGKGLESTT
CSRP1_HUMAN     TTVAVHGEEIYCEAPGHRPTTNPNASKFSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTT
CSRP1_BOVIN     TTVAVHGEEIYCEAPGHRPTTNPNTSKFSERCPRCSQAVYAAEKVIGAGKSWHKSCFRCAKCGKGLESTT
YS029_HUMAN     SRIHTGEKPYCCKECGKSFTFRSTRNRHQRNCKECGKSFASGSALLQ-HQRIHTGPYHCKECGKSFTSGL
RGA3_SCHPO      -------------------------------CFRCGQAFQRRETPISFGHMWHKDCFCCTKCDKGLEHSV
LMO41_XENTR     DRFHYVNGAIFCE---------------------------------------------------------
CSRP1_PONAB     TTVAVHGEEIYCXXXXXXXTTNPNASKFSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTT
CSRP1_COTJA     TTVAVHGDEIYCXXXXXXXSRMAQKVGGSDGCPRCGQAVYAAEKVIGAGKSWHKSCFRCAKCGKSLESTT
CSRP1_CHICK     TTVAVHGDEIYCXXXXXXXSRMAQKVGGSDGCPRCGQAVYAAEKVIGAGKSWHKSCFRCAKCGKSLESTT
MLP2_DROME      DTTSIKARD-------------------GEGCPRCGGAVFAAEQQLSKGKVWHKKCYNCADCHRPLDSVL
LMCD1_PIG       -------------------------------------------------KQWHPACFVCAKCSEPLVDLY
LMCD1_HUMAN     ------------------------------------------------NKQWHPTCFVCAKCSEPLVDLY
ZFP59_MOUSE     YQVHTDGKPYQCKECGKCFRQRSKLTEHESQCEACGKSLAN--TLLIHHQKSHSGPFECKECGKLLPSQL
LMCD1_MOUSE     -------------------------------------------------KQWHPTCFQCIKCSEPLVDLY
ZSC12_PONPY     ---SFSRRSILTQHQGVHTGAKPYE------CNECGKAFVYNSSLVSHQEIHHKECYQCKECGK-----S
ZSC12_MACNE     ---SFSRRSILTQHQGVHTGAKPYE------CNECGKAFVYNSSLVSHQEIHHKECYQCKECGK-----S
PRIC4_HUMAN     RYALPGGSPC-CPSC-------------------------------------------------------
ZSC12_PANTR     ---SFSRRSILTQHQGVHTGAKPYE------CNECGKAFVYNSSLVSHQEIHHKECYQCKECGK-----S
PDLI3_CHICK     ----------------------------------------------------------------------
LMCD1_BOVIN     -------------------------------------------------KQWHPACFVCAKCSEPLVDLY
ZSC12_PANPA     ---SFSRRSILTQHQGVHTGAKPYE------CNECGKAFVYNSSLVSHQEIHHKECYQCKECGK-----S
ZSC12_HUMAN     ---SFSRRSILTQHQGVHTGAKPYE------CNECGKAFVYNSSLVSHQEIHHKECYQCKECGK-----S
ZSC12_GORGO     ---SFSRRSILTQHQGVHTGAKPYE------CNECGKAFVYNSSLVSHQEIHHKECYQCKECGK-----S
ZN479_HUMAN     SNLTRHKRPYACEECGQAFSLSSNLMRHRRTCEECGQDFRRSSAL-TIHKRIHTGPYKCEECGKVFSLSS
ZN141_HUMAN     SRIHTGEKPYKCEECGKAFNRSTTLTKHKRTCEECGKAFRQSSKLNE-HKKVHTGPYKCDECGKAFGRSR
ZN734_HUMAN     SNLTRHKR----------IHTGEKPYT----CEECGQDFRRSSAL-TIHKRIHTGPYKCEECGKVFSLSS
ZN345_BOVIN     SALTRHQRPYVCKECGKAFNSGSDLTQHQRECKECEKAFRSGSKLIQ-HQRMHTGPYECKECGKA----F
ZN774_HUMAN     SHLVTHQR------------THTGERPF--KCENCGKGFADSSALIK-HQRIHTGPYKCGECGKSFSSHF
ZN733_HUMAN     SNLTRHKR----------IHTGEKPYTYEE----CGQDFRRSSAL-TIHKRIHTGPYKCEECGKVFSLSS
ZN540_HUMAN     FYLTEH----------QRIHTGEK----PYKCKECGKAIRRGNLKEHLKIHSGLKPYDCKECGKSFSGQF
PDLI3_RAT       ----------------------------------------------------------------------
ZN283_MACFA     YQLTFNCGSSLIQHARIHTGEKPYE------CKECGKAFSRGYH-LSQHQKIHTGPFECKECGKAFSGSS
VILI_HUMAN      ----------------------------------------------------------------------
PDLI3_PIG       ----------------------------------------------------------------------
PDLI3_MOUSE     ----------------------------------------------------------------------
PDLI3_BOVIN     ----------------------------------------------------------------------
LASP1_CAEEL     ----------------------------SKKCADCGKTVYPVEELKCLDKVWHKQCFKCTVCGMTLNKNY
ZN594_HUMAN     SHLATH----------QKIHTGEKPY----QCSECGNAFRR-RSLLIQHRRLHSGPYECKECGKLFMWHT
PDLI3_HUMAN     ----------------------------------------------------------------------
AVIL_MOUSE      ----------------------------------------------------------------------
ZO71_XENLA      SDLTFHHRSCSCGKCYSKKSSHTGEKPFS--CSKCDKCFASSSE-LNIHQRTHTGAFSCSECGKCFT---
ZN615_PONAB     SDLIVHQRPYICNDCGKGFTVKSRQRTHTGECGECGKGFPAKIRLMG-HQRTHTGPYICDECGKGFT---
VILI4_ARATH     ----------------------------------------------------------------------
LASP1_MOUSE     ------------------------------NCARCGKIVYPTEKVNCLDKYWHKACFHCETCKMTLNKNY
ZNF81_HUMAN     AHL----------IAHQRIHTGEK----PYECSDCGKSFPS-KSQLQMHKRIHTGPYICTECGKAFT---
ZN615_HUMAN     SDLIVHQRPYICNDCGKGFTVKSRQRTHTGECGECGKGFPAKIRLMG-HQRTHTGPYICNECGKGFT---
ZN595_HUMAN     SHLAKHKR----------IHTGEKPYT----CEECGKAF-NQSSTLILHKRIHSGQYKCEECGKAFTRST
ZN540_PONAB     FYLTEH----------QRIHTGEK----PYKCKECGKAIRRGNLKEHLKIHSGLKPYDCKECGKSFSGQF
CRIP3_MOUSE     ----------------------------SWTCPRCQQPVYFAEKVSSLGKNWHRFCLKCERCHSILSGGH
ZN836_HUMAN     SRIHTGEKPYKCNICGKSFSQSSNQTVHSGNCDECGKTFKRSSSLLARHQRSHTGPYKCNECGKVFTSHL
ZN267_HUMAN     ERIHTGEKPYKCKECAFPYSSHTGEKPY--KCKACSKSFSDSSG-LSVHRRTHTGPYTCKECGKAFS---
LASP1_RAT       ------------------------------NCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNKNY
LASP1_RABIT     ------------------------------NCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNKNY
LASP1_PONAB     ------------------------------NCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNKNY
LASP1_HUMAN     ------------------------------NCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNKNY
ZN260_HUMAN     ENLIIHQR--------IHTGEKPYE------CKGCGKAFIQKSSLIRHQRS-HTGPYTCKECGKAFSG--
LASP1_DROME     ----------------------------NKTCARCQKVVYPIEELKCLDKTWHKTCFKCTECGMTLNMKY
ZN222_HUMAN     -RSSLN-RHCMVHTAEKLYKSEKYGRGFIDNCKECGKSFKWSSYLL-VHQRVHTGPYKCEECGK----GY
ZN155_HUMAN     FNLDLHQR---VHTGERPY-----------NCKECGKNFSRASSIL---NHKRLHCFKCEDCGKRLVHRT
ZNF28_HUMAN     SRIHTGEKPYKCKVCAQHQRVHTGEKPY--KCNECGKTFRQTSSLI-IHRRLHTGPYKCNECGKT----F
ZN676_HUMAN     S--TLNTHKAICEECGKASNSSSKLMEHKRKCEECGKAFSWSSSLTE-HKRIHAGPYKCEECGKAFTSSF
ZN283_HUMAN     YHLTQH----------QKIHIGVK----SYKCKECGKAFFWGSSL-AKHEIIHTGPYKCKECGKAFSRGY
VILI_BOVIN      ----------------------------------------------------------------------
ZN546_HUMAN     THLTQHHRPYECTECGKTFSRHYHLTQHHRGHTGEKPYICNGNAFLTLHQRIHTGPYECKECGKTFSRRY
ZN275_HUMAN     SELTKHRR---IHTGEKPYA-----------CGQCGKAFRQSSSLLE-HARIHSGPYACGECGKAFRG--
ZN268_HUMAN     ---AFNRKDQLISHQRTHAGEKPY------GCSECGKAFSS-KSYLIIHMRTHSGPYECNECGKA----F
ZBT41_HUMAN     SRVHHDDKRYECDECGKTFIRHDHLTKHAHQCEECGKCFGRRDHLTVHYKSVHLGFHQCDVCKKIFKG--
QUAI_DROME      ----------------------------------------------------------------------
PDLI4_RAT       ----------------------------------------------------------------------
PDLI4_MOUSE     ----------------------------------------------------------------------
PDLI4_HUMAN     ----------------------------------------------------------------------
PDLI4_BOVIN     ----------------------------------------------------------------------
ZNF30_HUMAN     QRIHTGEKPYECKECGKAFISRHQLTVHQRECKECGKAFR-VHVHLTQHRKIHTDVYECKECGKTFSASY
ZN253_HUMAN     SNLTIHKRPYKCEECGKAFHLSSHLTTHKIRCRECGKAFNHSTTLFSHEKI-HTGPYKCDECGKTFTPSI
ZBT41_MOUSE     SRVHHDDKRYECDECGKTFIRHDHLTKHAHQCEECGKCFGRRDHLTVHYKSVHLGFHQCDVCKKIFKG--
VILI_MOUSE      ----------------------------------------------------------------------
PDLI4_CHICK     ----------------------------------------------------------------------
ZN737_HUMAN     SSLTTHKKPYKCEECGKAFNWSSHLTTHKRKCEECGEAFKYSSSLTT-HKIIHTGQFKCEECGKLTTHKR
ZN616_HUMAN     SNLTVHKKPYKCDVCGKAFRHRSNLVCHQYKCNECGK-VFSKRSSLAVHRRIHTPC-KCNECGKV----F
ZN287_PONPY     VHLT------------QHQRIHNGEKPFKCNI--CGKAYRQG-ANLTQHQRIHTGPYKCNECGKA----F
ZN287_HUMAN     VHLT------------QHQRIHNGEKPFKCNI--CGKAYRQG-ANLTQHQRIHTGPYKCNECGKA----F
ZN252_CANFA     STLTHNGKPYECGDCGKAFSQSAHLVRHRRECSDCGKAF-NVRSSLVQHHRIHTGPYECEKCGKAFSSQF
ZN197_HUMAN     KRMHSREKPYKCTECGKAFTQSAYLFDHQRECNECGKVFILKKSLI-LHQRFHTGLYECKDCGKVFGSNR
RGA1_YEAST      DFLVLGTGALICFDC-------------SDSCKNCGKKIDDLAIILSSSNEAYCSCFKCCKCGENIADLR
PDLI3_XENLA     ----------------------------------------------------------------------
LIMA1_MOUSE     --------------------SSPSKTAAKESCVECQKTVYPMERLLANQQVFHISCFRCSYCNKLSLGTY
ZN560_HUMAN     SDLTYEYKDCKCNACEKAYSRSCVLTQHTSECNACGNSFRNSMCFHRLKTLTKIKPYKCKDCGKAFT---
ZN287_MOUSE     VHLT------------QHQRIHNGEKPF--KCNTCGKAYRQG-ANLTQHQRVHTGPYKCHHCGKA----F
ZN271_MOUSE     SRVHTGEKPYTCNLCSKSFSQSSDLTKHQRHCSSCNKAFRQSSDLI-LHHRVHTGPYACTQCPRSFSSDL
VILI1_ARATH     ----------------------------------------------------------------------
VILD_DICDI      ----------------------------------------------------------------------
ZN675_HUMAN     SNLTEYKKDYACEECGKAFNQSSHLTTHKYKCEECGKAF-NQFSNLTTHKKIHTGPYICEECGKAFT---
ZN493_HUMAN     STLSIHKKPYKCEECGKAFKRSSTLTIHKMKCEECGKAF-NRSSHLTTHKRIHTGHYKCKECGKLTKHKI
ZN347_HUMAN     SSLTTH----------QVIHTGEKPY----KCNECGK-VFTQNSHLARHRGIHTGPYKCNECGKVFRNSY
ZN225_HUMAN     SRIHSGEKPFKCEECGKRFTQNSQLYTHRRKCEECGKRFTQNSQLYS-HRRVHTGVYKCEECGK----GF
ZN160_HUMAN     SHLISHWR----------IHTGEKPY----KCNECGKAF-SVRSSLAIHQTIHTGPYKCNECGKVFRNSY
ZFP30_MOUSE     AHLTRHQRECRAFLCSTGLRLHHKLHTGEKDCKECGKAFRVRQQL-TLHERIHTGPFDCKECGKTFSRGY
PDLI1_HUMAN     ----------------------------------------------------------------------
PDLI1_BOVIN     ----------------------------------------------------------------------
LASP1_BOVIN     ------------------------------NCARCCKIVYPTEKVNCLDKFWHKACFHCETCKMTLNKNY
ZNF43_HUMAN     SNLTIEKKPYKCEECGKAFKWSSKLTEHKITCEECGKAF-NHFSILTKHKRIHTGPYKCEECGKAFT---
ZN429_HUMAN     STLTTHKRPYKCDECGKTFSIS---STFTKHCKECGKAF-NRSSTLTSHKRIHTGPYKCEECGKTLTKHK
ZFP82_HUMAN     AHLTLNSADRLYELCGSGLRVHHKLHTGEKECKECGKAFRVRQQL-TLHQRIHTGPYECKECGKTFSRGY
PRDM9_MOUSE     QRTHTGEKPYVCRECGRGFTAKSNQRTHTGECRECGRGF-TAKSVLIQHQRTHTGPYVCRECGRGFT---
OZF_MOUSE       SSLTVHVR------------SHTGEKPY--GCNECGKAFSQ-FSTLALHLRIHTGPYQCSECGKAFS---
OZF_BOVIN       SSLTVHVR------------SHTGEKPY--GCNECGKAFSQ-FSTLALHLRIHTGPYQCSECGKAFS---
NRAP_MOUSE      -------------------------------CSRCGYGVYPAEKISCIDQTWHKACFHCEVCKMMLSNNF
LIMA1_HUMAN     -------------------------------CVECQKTVYPMERLLANQQVFHISCFRCSYCNKLSLGTY
ZN841_HUMAN     TSLVYHQRRHTGEM--------------PYKCIECGK-VFNSTTTLARHRRIHTGPYKCNECGKV----F
ZN565_HUMAN     SQLTVHQRPYECKECGKGFIHSSEVTRHQRECKECGKAFRQ-HAQLTRHQRVHTGPYECKDCGKLIQHQR
ZN433_HUMAN     SLLQTHGRPYACKECGKPFSNHREEKPY--ECKGYGKTF-SLPSLFHRHERTHTGTYECKQCGR----SF
ZN208_HUMAN     -----------CEECGKTFSKVSTLTTHKAKCKECGKTFIK-VSTLTTHKAIHAGPYKCKECGKILTKHK
YS020_HUMAN     SGLTAH------------LVIHTGEKLYK--CNKCGK-VFNRNAHLTRHQRIHTGPYECKECGKVLTNHH
OZF_PONAB       SSLTVHVR------------SHTGEKPY--GCNECGKAFSQ-FSTLALHLRIHTGPYQCSECGKAFS---
OZF_HUMAN       SSLTVHVR------------SHTGEKPY--GCNECGKAFSQ-FSTLALHLRIHTGPYQCSECGKAFS---
ZNF85_HUMAN     -----------CKECGKAFNRSSTLTTHRKKCEECGKAFKQSSNLTT-HKIIHTGPYKCKKCGKLTTHEV
ZN620_HUMAN     QRMHTGEKPYECKECGKRLSSNTALTQHQRECKECGKAF-NQKITLIQHQRVHTGPYECKVCGKTFS---
ZFP30_MACFA     YHLTLHQR--------IHTGEKPYE------CKECQKFFRRYSELIS-HQGIHIGPYECKECGKALFSQL
ZFP28_MOUSE     SSLTVHQRPYECEICRKAFSH---------------------HASLTQHQRVHSGPFKCKECGKALASHW
Z354B_HUMAN     ERIHTGEKPYRCNECGKGFTSISRLNRHRYNCNECGKALSSHSTLI-IHERIHTGC-KCKVCGKAFSSAL
VILI3_ARATH     ----------------------------------------------------------------------
PDLI1_RAT       ----------------------------------------------------------------------
PDLI1_MOUSE     ----------------------------------------------------------------------
NRAP_HUMAN      -------------------------------CSRCGYGVYPAEKISCIDQIWHKACFHCEVCKMMLSNNF
AVIL_HUMAN      ----------------------------------------------------------------------
ZNF23_HUMAN     LRIHTGEKPYECNECGKAFSVNGKEKPF--ECNECGRCFTSKRNLLD-HHRIHTGPYQCKECGKAINAKL
ZN813_HUMAN     SALVIHKKRYKCNECGKTFSRISALVIHTAKCNECGKGF-NRKTHLACHHRLHTGPYKCNECGKV----F
ZN778_HUMAN     CGLTYTCKDCGKAFCTSSGLTEHVRTHTGEKCKDCGKSFTVSSSLTE-HARIHTGPYECKQCGKAFTG--
ZN623_HUMAN     QRIHTGERPYVCNECGKRFSQTSNFTQHQRECNECGKAFFLSSYLIRHQK-IHTGVYECKECGKA----F
ZN471_HUMAN     RRIHTGEKPYKCGVCGKTFSSGSSRTVHQRECDICGKDFSH-HASLTQHQRVHSGPYECKECGKAFNVHL
ZN432_HUMAN     RYL----------IVHQQIHTEEK----SCICSECGRGFAK-ETELALHKQVHTGPYGCNECGKGFT---
ZN136_HUMAN     ERTHTGEKPYECKECGEAFSCIPKHTGEGPKCKVCGKPF-HSLSPFRIHERTHTGPYVCKHCGKA----F
ZG48_XENLA      SRLTEH-RKCVCSECGKSFAQSPQEKPFS--CSDCGKCFTQ-RADLNVHRRTHTGPFTCSVCGKGFT---
ZO22_XENLA      ---CFSNQSCL----RVHQRTHTGENLFS--CSECGKSFVTSSKLASHQRQTHTGPVSCSECGKCFT---
ZNF7_PONAB      TQLTIHERPYKCNECGKAFSQN--STLFQHECSECGKAFSRSSYLIE-HQRIHTRAQWFYEYGNALEGSF
ZNF7_HUMAN      TQLTIHERPYKCNECGKAFSQN--STLFQHECSECGKAFSRSSYLIE-HQRIHTRAQWFYEYGNALEGSF
ZN721_HUMAN     KKIHTGEKPYKCEECGKAFNSSTNLTAHKRTCEDRGRAFGLSTNLNEY-KKIHTGDYKCKECGKAIHSLH
ZN519_HUMAN     SHLTQHQRHFKCKECGKAFNRGSHLTRHSFKCEECGKAFIWGSHLTQ-HQRVHTGFFKCKECGKAFT---
ZN506_HUMAN     STLT---KHEIIHTGEKPYK-----------CEECGKAF-NRSSNLTKHKRIHTGDYKCDECGKTFTWSS
ZFP62_MOUSE     ---SFNYSSVLDQHKRIHTGEKPYE------CGECGKAFRNSSG-LRVHKRIHTGPYECDTCGKT----F
ZFP60_MOUSE     QRIHTDGKPYQCKDCWEFFRRRSNFIEHQSECKDCGKVFRLNIHLIR-HQRFHSDPFECKECGKAF---H
XIRP2_MOUSE     -----------------------EESAFLSDCIICQKTVYPMECLIADKQNFHKSCFRCHHCSSKLSGNY
MILK1_MOUSE     -------------LSPDSLSEQGKQQPPSSACAACGQRVHLVQRYLAEGRLYHRHCFRCRQCSSTLVGSY
ZN584_HUMAN     SKLTFNRKDALVHTGERPYECSKCGKTFSVECTECGKFFKYNNSFI-LHQRVHTGPFECKQCGK----GY
ZN502_HUMAN     THLIHHQRIHTGEICSECGSSFRKHSNLTQHCDECGKTFQT-KANLSQHQRIHSGPYKCKECGKAFSPSL
ZN417_HUMAN     QRVHTGERPYKCGECGKSFGQKGNLVQHQRECKECGKSFRY-RSHLTEHQRLHTGPYNCRECGKLFNRKY
ZN192_PANTR     SRIHTGEKPYECDECGKTFRRSSHLIGHQRSCNECGRAFSQKSGLIE-HQRIHTGPYKCKECGKAFNG--
ZN192_PANPA     SRIHTGEKPYECDECGKTFRRSSHLIGHQRSCNECGRAFSQKSGLIE-HQRIHTGPYKCKECGKAFNG--
ZN192_HUMAN     SRIHTGEKPYECDECGKTFRRSSHLIGHQRSCNECGRAFSQKSGLIE-HQRIHTGPYKCKECGKAFNG--
ZN136_PONAB     ERTHTGEKPYECKECGEAFSCIPKHTGEGPKCKVCGKPF-HSLSPFRVHERTHTGPYVCKHCGKA----F
ZN107_HUMAN     SNLTEHKK----------IHTGEKPY----KCEECGKAF-NRFSTLTKHKRIHTGPYKCEECGKAFNQSY
ZN708_HUMAN     SHLTTHKRPYKCEECGKAFSVFSTLTKHKIKCEECGKAF-NRSSHLTNHKVIHTGPYKCEECGKAFT---
ZN418_HUMAN     QRGHTSERPYECEECGKCFSQKGTLTEHHRECGECGKSFSR-KGHLRNHQRGHTGPYECGECGK----SF
ZN343_HUMAN     QRTHLDEKPYVCRECGRGFCDKSHERTHSGECGECGRGFSR-KSLLLVHQRTHSGHYVCRECRRGFSQKY
ZFP30_HUMAN     YHLTLHQR--------IHTGEKPYE------CKECQKFFRRYSELIS-HQGIHIGPYECKECGKALFSQL
LIMD2_RAT       -------------------------------CAACQKTVYPMERLVADKLIFHNSCFCCKHCTKLSLGSY
ZN620_PONAB     SSFTVHQR--------MHTGEKPYE------CKECGKRLSSNTA-LTQHQRIHTGPFECKECGK------
ZN473_MOUSE     CRKSFNWRSSLIKHQAIHKGEKPYK------CDECGKAF-NHSSTLKIHQRIHSGPHKCSECGKA----F
ZN439_HUMAN     GSFRYHERTHTCKQCGKAFRSAPNLQLHGRQCKECGKAFRSA-SQLRIHRRIHTGPYECKKCGK------
ZN383_MACFA     SRIHTGEKPYECKECGKAFTQSSKLVQHQRECKECGKAFSSGSA-LTNHQRIHTGPYDCKECGKAFT---
ZN175_HUMAN     AHLIVHQR------------SHTGEKPY--QCHNCGKSFIS-KSQLDIHHRIHTGPYECSDCGKTFT---
ZIK1_HUMAN      QRVHTGERPYKCGECGNSFSQSAHTGAKPYECGQCGKSFSQ-KATLIKHQRVHTGPYKCGDCGKLIQHRR
TALB_DICDI      ----------------------------------------------------------------------
LIMD2_MOUSE     -------------------------------CAACQKTVYPMERLVADKLIFHNSCFCCKHCTKLSLGSY
LIMD2_HUMAN     -------------------------------CAACQKTVYPMERLVADKLIFHNSCFCCKHCTKLSLGSY
ZNF91_HUMAN     STLTIHAGEKLCEECGKAFNRSSNLTIHKFKCEECGKAF-NWSSSLTKHKRFHTRPFKCKECGK----GF
ZNF83_HUMAN     SRNSYLAQHLIIHAGEKPYKCDECDKAFSQNCDECGK-VFSQNSYLAYHWRIHTGAYKCNECGKV----F
ZN846_HUMAN     SYLTKHVRIYLCKACGKAFTRSSGLVLHMRTCKECGKAFNNS-SMLSQHVRIHTGPYECKECGKAFT---
ZN568_HUMAN     QRIHTGEKPYACTVCGKAFSQKSNLTEHEKHCNQCGKAFSQRQNLLEHEKI-HTGPFKCNECGKALTLHV
ZN331_PONAB     DELTQHQRDYECKDCGKTFSRVYKLIQHKRECKDCGKAFICGSSLIQ-HKRIHTGPYECQECGKAFTRNY
ZN331_HUMAN     DELTQHQRDYECKDCGKTFSRVYKLIQHKRECKDCGKAFICGSSLIQ-HKRIHTGPYECQECGKAFTRNY
ZN132_HUMAN     ---AFNNNSNLAQHQKVHTGERPFE------CSECGRDFSQSSHLLRHQKV-HTGPFECCDCGKAFS---
ZNF25_HUMAN     LRTHAGEKPYECNQCEKSFYQKPHLTEHQKECTECGK-FFYVKAYLMVHQKTHTGPYECKECGKA----F
ZN790_HUMAN     SHLTQHQRSHECKECGKAFIRGSNLAQHQNKCEKCGKAYI-WSSHLARHQRIHTGRYECKQCGKTFTASY
ZN484_HUMAN     ERIHTGEKPYECSICGKSFTKKSQLHVHQQRCAECGKAFTDRSNLFTHQKI-HTGPYKCSDCGKAFT---
ZN224_HUMAN     QRIHTGEKPFKCDICGKSFCGRSRLNRHSMRCDTCDKSFRQRSALNS-HRMIHTGPYKCEECGKLYTHHM
ADCE_DICDI      ----------------------------------------------------------------------
ZN813_PONAB     SALVIHKKRYKCNECGKTFSRISALVIHTAKCNECGKGFYR-KAHLVCHHRLHTGPYKCNECGKV----F
ZN679_HUMAN     SSLTYHKR----------IHTGEKPYT----CEKCGKAF-NCSSTLKKHKIIHTGPYKCKECGKAFTHKR
ZIK1_MOUSE      RRIHTGVKPYECRECGK--SFSQKATLIKHKCSECGKSFSQ-SSILIQHRRIHTGAYECSQCGK----SF
ZG66_XENLA      SQLMAHQQQVHIEVKPFSCSECGKYFLYRAHCFECGKCFATSLQLIAHQQQVHMEVFSCSECGK------
PDLI2_RAT       ----------------------------------------------------------------------
PDLI2_MOUSE     ----------------------------------------------------------------------
PDLI2_MACFA     ----------------------------------------------------------------------
PDLI2_HUMAN     ----------------------------------------------------------------------
PDLI2_BOVIN     ----------------------------------------------------------------------
ZNF80_CERAE     D----NPRECDSQGTSKDTLVREGKTY---KCKECGKDLFNKNSLLVRHHQIHAGTYECQECGKAF---H
ZN383_HUMAN     SRIHTGEKPYECKECGKAFTQSSKLVQHQRECKECGKAFSSGSA-LTNHQRIHTGPYDCKECGKAFT---
ZN260_MOUSE     QNIHSGKKPFKCNECGKAFSQKENLIIHQRECKGCGKAFIQKSSLIRHQRS-HTGPYTCKECGKAFSG--
ZN235_MOUSE     E--CGKGFSHASSLQAH-HSVHTGEKPF--KCNVCQKQFSKTSNLQA-HQRVHTGPYKCDTCGKA----F
ZN221_HUMAN     ---------CRRDFCKHQMVHTGEKPY---NCKECGKTFRWSSCLLN-HQQVHSGSFKCEECGK---GFY
ZIM3_HUMAN      QRIHTGEKPYKCSICEKAFSQKSNVIDHEKECDLCGNTFIQKKNLIQ-HKKIHTGPYECNRCGKA----F
Z780B_HUMAN     SNIHTGEKPYECKECGKALQLSQHEKTHTGECKECGKFFRRG-SNLNQHRSIHTGPFECKECGKLIRHQK
Z354B_MOUSE     SRMHTGERPYKCNECGKTFSLSNHQRTHTGECQECGMSFGQSAALIQ-HRRIHTGPFKCNTCGKSFSSSL
ZNF74_HUMAN     SRLTLHQR------------THTGEKPFK--CADCGKGF-SCHAYLLVHRRIHSGPFKCNECGKAFSSHL
ZNF35_HUMAN     SNLTVHEKTFKCNECEKAFSYSSQITEKCYECNECGKTFTRSSNLI-VHQRIHTGPFACNDCGKAFTANL
ZN823_HUMAN     ---TFYHHTSFRRHMIRHTGDGPHKCKICGKGFDCPSSVRNHETTHTGEKP-----YECKQCGKVLS---
ZN730_HUMAN     SHLTTHKRPYKCEECGRAFNQSSTLTTHKRECEECGKAF-NRSSTLTTHKIIHSGIYKCKECGK------
ZN682_HUMAN     -------------------------------CEDCGRAF-NRHSHLTKHKTIHTGKYKCKECGKAFNHCS
ZN678_HUMAN     SNLTQHKRPYKCKECGKAFNKFSSLTQHRRKCEECGKVFKQCSHLTS-HKRIHTGPYKCKECGKAFQSSI
ZN607_HUMAN     GRLTRH----------QGIHSGKKPY----ECNKCGKSFRLNSSL-KIHQNIHTGPYKCKECGKA----F
ZN551_HUMAN     ---SFRQRSGLIQHRRLHTGERPYE------CSECGKSFSQSASLIQ-HQRVHTGPYECSECGK----SF
ZN234_HUMAN     SHLNFRRRSALNNHCMVHTGEKPYKCEDCGKCFTCSSNLRIHQRVHTGEKP-----YKCEECGKIHTGEY
ZFP28_HUMAN     SSLTVHQRI--------HTGEKPYE------CDVCRKAFSH-HASLTQHQRVHSGPFKCKECGKAFRQHL
Z354A_MOUSE     SRMHTGERPYKCNECGKTFSLSNHQRTHTGECQECGMSFGQSSALIQ-HRRIHTGPFKCNTCGK------
YS033_HUMAN     STLTQHKRPYKCEECGKAFNTSSHLTTHKRKCEECGKAF-NQFSQLTTHKIIHTGPYKCKECGKALTEHR
RBAK_MOUSE      THLTLHQR------------NHSGERPYP--CNECGKSFSRKSALND-HQRTHTGLYKCNECGK----SY
ZNF66_HUMAN     -----------CEDCGKAFNRSSNLTTHKKKCEECGKAFKRS-SILTTHKRIHTGPYKCEECGKVF--KY
ZN587_HUMAN     EGKSFGQKGNLVHHQRGHTGERPYE------CKECGKSFRY-RSHLTEHQRLHTGPYNCRECGKLFNRKY
ZN501_HUMAN     ---TFRKQAHLSEHYRIHTGEKPYE------CVGCGKSFRHSSALL------------------------
ZN260_RAT       ENLIIHQRI--------HTGEKPYE------CKGCGKAFIQKSSLIRHQRS-HTGPYTCKECGKAFSG--
ZFP11_MOUSE     SRIHSGEKPYICKECGKAFNCTSYLTKHQRICQECGKAF-NCSSYLSKHQRIHIGLYKCKECGK------
Z585A_PONAB     SALTVHQR----------IHTGEK----SYICMKCGLAFIQKAHLIA-HQIIHTGPYKCGHCGKLFT---
XFIN_XENLA      SRVHTGEKPFKCLLCKKSFSQNSDEKPFP--CYTCDKSFTERSALIKHHRT-HTGPHKCSVCQK----GF
LIME_DICDI      ----------------------------SVKCGACAKTAYPLESVVANNNSYHKGCFKCSTCNSTLNVKF
ZNF14_PONAB     SSLTHTGKPYECKQCGKTFSFSSSERTHNAECKQCGKAFRCS-SYFRIHERSHTGPYECKQCGKV----F
ZN860_HUMAN     ---TFHHNSALVIHKAIHTGEKPYK------CNECGKTFRHNSALV-IHKAIHTGPYKCNECGKVFNQQT
ZN665_HUMAN     SHLASHRKPYKCDECGKAFSQTSQLARHPYKCNECGKAF-SVHSSLTIHQTIHTGQYKCNDCGKVFRNSY
ZN599_HUMAN     SNVTHTGKPFLCKECGKTFCLNSSFTQHMRECGECGKAFTHRSTFIR-HKRTHTGPFECKECGKA-----
ZN573_HUMAN     SRIHKGGKPYECKECKKTFTLYRNLTRH--------QNIHTGEKL-----------FECKQCGKTTTGSK
ZN528_HUMAN     SDLTAHEKPYECKECGKVFRYKSSLTSHHRKCNRCGKVFSRSSNLVCHQKI-HTGPYKCNQCGKVLTRHQ
ZN510_HUMAN     SRIHTGEKSFQCNQCGKTFGQKSNEKTY--QCNECEKSFWRKDHLIQHQKT-HTGPFKCNECGKT----F
ZN501_PONAB     ---TFRKQAHLSEHYRIHTGEKPYE------CFGCGKSFRHSSALL------------------------
ZN420_BOVIN     SHLT------------QHQSIHTGEKPYE--CKQCGKAFSR-DSQLSLHQRLHTGPYACKECGKAFTSQL
ZN337_HUMAN     DKSSYNEKRFFCRDCGRGFTLKPNLTIHQRTCKQCEKSFSLKANLLR--HQWHSGPFNCKDCGR----GF
ZN256_HUMAN     SRIHTGMRPYECSECGKSFIHSSSLITHQRMCSECGKSFSQSCHLIK-HRRLHIGPYECSECGKLFT--Y
ZN235_HUMAN     QRVHTGEKPYKCDTCGKAFSQRSNEKPF--KCEECGKEF-SWSAGLSAHQRVHTGPYTCQQCGK------
ZG26_XENLA      QRISLQNH----------FKIHTGEKPFS--CTECGKCFTIKSTLQSHLKRTHTGPFTCTECGKSFT---
ZFP2_HUMAN      SSLTVHEKPYECNECGKAFSQSAYLIEHQRECDQCGKAIKNSS--LTVHQRTHTGPYQCNECGKAFS---
MILK2_HUMAN     ----------------------------SSTCGVCGKHVHLVQRHLADGRLYHRSCFRCKQCSCTLHSGA
LIMD_DICDI      -------------------------------CTRCQKTVYSQEGFIAVKVPFHRSCFKCEVCNQLVLTNY
LIMK2_CHICK     D---------------------------------------------------------------------
LIMK1_XENLA     ETYALVERSCYYQFSVTPVIDSP-----------------------------------------------
LIMK1_MOUSE     DTYT------------------------------------------------------------------
LIMK1_HUMAN     DTYT------------------------------------------------------------------
LIMK1_RAT       DTYT------------------------------------------------------------------
LIMK2_RAT       D---------------------------------------------------------------------
LIMK2_BOVIN     D---------------------------------------------------------------------
LIMK2_HUMAN     D---------------------------------------------------------------------
LIMK2_MOUSE     D---------------------------------------------------------------------
LHX4_MOUSE      D---------------------------------------------------------------------
LHX4_HUMAN      D---------------------------------------------------------------------
LIMK1_DROME     ESYALVERSKLCGQCYGKRSCQPADAKARITTAG------------------------------------
LHX1_DANRE      EEL-------------------------------------------------------------------
LHX1_XENLA      EELIIDENKFVCKEDYLNNNNAAKENSFIS----------------------------------------
LMO3_PONAB      DKFFLKNNMILCQ---------------------------------------------------------
LMO3_MOUSE      DKFFLKNNMILCQ---------------------------------------------------------
LMO3_HUMAN      DKFFLKNNMILCQ---------------------------------------------------------
LMO3_BOVIN      DKFFLKNNMILCQ---------------------------------------------------------
LHX5_RAT        EEL-------------------------------------------------------------------
LHX5_MOUSE      EEL-------------------------------------------------------------------
LHX5_HUMAN      EEL-------------------------------------------------------------------
LHX5_DANRE      EEL-------------------------------------------------------------------
ISL3_ONCTS      DEFSLRDEELLCR---------------------------------------------------------
ISL2B_ONCTS     DEFSLRDEELLCR---------------------------------------------------------
LMO3_XENLA      DKFFLKNNMILCQ---------------------------------------------------------
LMO3_DANRE      DKFFLKNNMILCQ---------------------------------------------------------
LHX5_XENLA      EEL-------------------------------------------------------------------
ISL2_RAT        DEFSLREHELLCR---------------------------------------------------------
ISL2_MOUSE      DEFSLREHELLCR---------------------------------------------------------
ISL2_HUMAN      DEFSLREHELLCR---------------------------------------------------------
RBTN1_XENLA     DKFFLKNNMILCQM--------------------------------------------------------
RBTN1_MOUSE     DKFFLKNNMILCQV--------------------------------------------------------
RBTN1_HUMAN     DKFFLKNNMILCQM--------------------------------------------------------
RBTN1_DANRE     DKFFLKNNMILCQM--------------------------------------------------------
LMO3_RAT        DKFFLKNNMILCQ---------------------------------------------------------
LHX3_CHICK      D---------------------------------------------------------------------
ISL2A_DANRE     DEFSLRDEELLCR---------------------------------------------------------
ISL1_DANRE      DEFALREDGLFCR---------------------------------------------------------
ISL1_CHICK      DEFALREDGLFCR---------------------------------------------------------
LHX3_DANRE      D---------------------------------------------------------------------
ISL1_RAT        DEFALREDGLFCR---------------------------------------------------------
ISL1_MOUSE      DEFALREDGLFCR---------------------------------------------------------
ISL1_MESAU      DEFALREDGLFCR---------------------------------------------------------
ISL1_HUMAN      DEFALREDGLFCR---------------------------------------------------------
ISL2B_DANRE     DEFSVRDEELLCR---------------------------------------------------------
RBTN1_BOVIN     DKFFLKNNMILCQM--------------------------------------------------------
LHX8_HUMAN      -------------------------------CNSCGLEIVDKYLLKVNDLCWHVRCLSCSVCRTSLTSCY
LHX8_MOUSE      -------------------------------CSSCGLEIVDKYLLKVNDLCWHVRCLSCSVCRTSLTSCY
LHX3_XENLA      D---------------------------------------------------------------------
LHX3_HUMAN      D---------------------------------------------------------------------
LHX9_RAT        DH--FGMKDSL-----------------------------------------------------------
LHX9_MOUSE      DH--FGMKDSL-----------------------------------------------------------
LHX9_HUMAN      DH--FGMKDSL-----------------------------------------------------------
LHX3_PIG        D---------------------------------------------------------------------
LHX3_MOUSE      D---------------------------------------------------------------------
LHX9_BOVIN      DH--FGMKDSL-----------------------------------------------------------
LHX2_MOUSE      DHFGMKDSLVYCRL--------------------------------------------------------
LHX2_HUMAN      DHFGMKDSLVYCRL--------------------------------------------------------
LHX6_MOUSE      -------------------------------CSSCGLEILDRYLLKVNNLIWHVRCLECSVCRTSLRQQY
LHX6_HUMAN      -------------------------------CSSCGLEILDRYLLKVNNLIWHVRCLECSVCRTSLRQQY
APTE_DROME      DQ--------------------------------------------------------------------
LHX2_RAT        DHFGMKDSLVYCRL--------------------------------------------------------
LHX9_ASTFA      D---------------------------------------------------------------------
ISL2_CHICK      DQFCLRERDLLC----------------------------------------------------------
LMO42_XENTR     DRFHYINGSLFCE---------------------------------------------------------
LMX1B_CHICK     DEFVLKEGQLLCK---------------------------------------------------------
LHX9_RANRU      D---------------------------------------------------------------------
LMX1B_MOUSE     DEFVLKEGQLLCK---------------------------------------------------------
LMX1B_MESAU     DEFVLKEGQLLCK---------------------------------------------------------
LMX1B_HUMAN     DEFVLKEGQLLCK---------------------------------------------------------
LMO4_MOUSE      DRFHYINGSLFCE---------------------------------------------------------
LMO4_HUMAN      DRFHYINGSLFCE---------------------------------------------------------
LMO4_BOVIN      DRFHYINGSLFCE---------------------------------------------------------
LMO4A_XENLA     DRFHYVNGTIFCE---------------------------------------------------------
LMX1A_HUMAN     DEFVLKEGQLLCK---------------------------------------------------------
LIM_HALRO       DQ--------------------------------------------------------------------
LHX9_XENLA      DQFGMKENLVYCRI--------------------------------------------------------
LMO4B_XENLA     DRFHYVNGTIFCE---------------------------------------------------------
LMX1A_MOUSE     DEFVLKEGQLLCK---------------------------------------------------------
LMX1A_MESAU     DEFVLKEGQLLCK---------------------------------------------------------
RBTN2_MOUSE     -------------------------------CGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRL-GEL
RBTN2_HUMAN     -------------------------------CGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRL-GEL
RBTN2_BOVIN     -------------------------------CGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRL-GEL
RBTN2_XENTR     -------------------------------CGGCQQSIGDRYFLKAIDQYWHEDCLSCDLCGCRL-GEL
RBTN2_XENLA     -------------------------------CGGCQQSIGDRYFLKAIDQYWHEDCLSCDLCGCRL-GEL
RBTN2_DANRE     -------------------------------CGGCQQSIGDRFFLKAIEQYWHEDCLSCDLCGCRL-GEL
HM14_CAEEL      -------------------------------CSLCDKKIRDRFVSKVNGRCYHSSCLRCSTCKDELGATC
MEC3_CAEBR      -----------------------------NKCYCCNEQIFDRFICRMDNRSYHENCVKCAICESPLAEKC
LIMK_DICDI      ----------------------------TNNCGVCKTIVNPGERVKAGTSVFHAKCFVCKECKNELESFI
MEC3_CAERE      -----------------------------NKCNCCNEQIYDRFIYRMDNHSYHENCVKCTICESPLAEKC
MEC3_CAEEL      ------------------------------------------------NRSYHENCVKCTICESPLAEKC
LMO41_XENTR     --------------------------------------------LYSMERYWHTRCLKCSCCGEIGTSCY
LMCD1_PIG       AYIITKGQ-LLCPTCSK-----------------------------------------------------
LMCD1_HUMAN     AYIVTKGQ-LLCPTCSKSKRS-------------------------------------------------
LMCD1_MOUSE     AYIVTKGQ-LLCPTCSKSKRS-------------------------------------------------
PRIC4_HUMAN     -------------------------------CEKCRELLKPGEARAGEQRCWHQPCFACQACGQALINIY
PDLI3_CHICK     ----------------------------------------------------------------------
LMCD1_BOVIN     AYIVTMGQ-LLCPTCSKSKRS-------------------------------------------------
PDLI3_RAT       ----------------------------------------------------------------------
PDLI3_PIG       ----------------------------------------------------------------------
PDLI3_MOUSE     ----------------------------------------------------------------------
PDLI3_BOVIN     ----------------------------------------------------------------------
PDLI3_HUMAN     ----------------------------------------------------------------------
PDLI4_RAT       ----------------------------------------------------------------------
PDLI4_RAT       ----------------------------------------------------------------------
PDLI4_MOUSE     ----------------------------------------------------------------------
PDLI4_MOUSE     ----------------------------------------------------------------------
PDLI4_HUMAN     ----------------------------------------------------------------------
PDLI4_HUMAN     ----------------------------------------------------------------------
PDLI4_BOVIN     ----------------------------------------------------------------------
PDLI4_BOVIN     ----------------------------------------------------------------------
PDLI4_CHICK     ----------------------------------------------------------------------
PDLI4_CHICK     ----------------------------------------------------------------------
PDLI3_XENLA     ----------------------------------------------------------------------
LIMA1_MOUSE     ----------------------------------------------------------------------
LIMA1_HUMAN     ----------------------------------------------------------------------
LIMD2_RAT       ----------------------------------------------------------------------
LIMD2_MOUSE     ----------------------------------------------------------------------
LIMD2_HUMAN     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ISKDGAPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHP
ABLM1_HUMAN     ISKDGAPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHP
ABLM1_MOUSE     ISKDGSPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHP
ABLM3_HUMAN     ISKDGVPYCESDYHAQFGIKCETCDRYISGRVLEAGGKHYHPTCARCVRCHQMFTEGEEMYLTGSEVWHP
ABLM3_MOUSE     ISKDGVPYCESDYHSQFGIKCETCDRYISGRVLEAGGKHYHPTCARCVRCHQMFTEGEEMYLTGSEVWHP
ABLM2_RAT       ISKDGLPYCEADYHTKFGIRCDGCEKYITGRVLEAGEKHYHPSCALCVRCGQMFSEGEEMYLQGSSIWHP
ABLM2_HUMAN     ISKDGLPYCEADYHAKFGIRCDSCEKYITGRVLEAGEKHYHPSCALCVRCGQMFAEGEEMYLQGSSIWHP
ABLM2_MOUSE     ISKDGLPYCEADYHSKFGIRCDGCEKYITGRVLEAGEKHYHPSCALCVRCGQMFSEGEEMYLQGSSIWHP
DEMA_BOVIN      ----------------------------------------------------------------------
DEMA_PONAB      ----------------------------------------------------------------------
DEMA_HUMAN      ----------------------------------------------------------------------
DEMA_MOUSE      ----------------------------------------------------------------------
PXL1_CAEEL      FEHNGAPLCERHYHESRGSICSQCRGAINGRCVAAMGRKFHPEHFRCSYCNHQLTKG-------------
PAXB_DICDI      FEFGGKPYCDVHYHQQAGSVCSGCGKAVSGRCVDALDKKWHPEHFVCAFCMNPLAGGSYTANNGK----P
PAXI_PONAB      FEHDGQPYCEVHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKG-------------
PAXI_HUMAN      FEHDGQPYCEVHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKG-------------
PAXI_CHICK      FEHDGQPYCEVHYHERRGSLCSGCQKPITGRCITAMGKKFHPEHFVCAFCLKQLNKG-------------
PAXI_RAT        FEHDGQPYCEVHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKG-------------
PAXI_MOUSE      FEHDGQPYCEVHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKG-------------
LPXN_HUMAN      FELDGRPFCELHYHHRRGTLCHGCGQPITGRCISAMGYKFHPEHFVCAFCLTQLSKG-------------
TGFI1_XENLA     FEHEGLPLCETHYHSRRGSLCAGCEQPITGRCVTAMGKKFHPQHLNCTFCLRQLNKG-------------
LPXN_MOUSE      XXEDGRPFCELHYHHRRGTLCHDCGQPITGRCISAMGHKFHPEHFVCAFCLTQLPKG-------------
FHL3_BOVIN      TSREDDPYCVTCFGELFAPKCSSCKRPITGKYVSFEDRHWHHSCFSCARCSTSLV-GQGFVPDGDQVLCQ
LIMS2_HUMAN     YEKKGLAYCETHYNQLFGDVCYNCSHVIEGDVVSALNKAWCVSCFSCSTCNSKLT---------------
LIMS2_BOVIN     YEKKGLAYCETHYNQLFGDVCYTCSHVIEGDVVSALNKAWCVHCFSCSTCNSRLT---------------
TGFI1_HUMAN     FEHEGRPLCENHFHARRGSLCATCGLPVTGRCVSALGRRFHPDHFTCTFCLRPLTKGSFQERAGKPYCQP
TGFI1_BOVIN     FEHEGRPLCENHFHARRGSLCATCGLPVTGRCVSALGRRFHPDHFTCTFCLRPLTKGSFQERAGKPYCQP
FHL3_HUMAN      TSRDEDPYCVACFGELFAPKCSSCKRPIVGKYVSFEDRHWHHNCFSCARCSTSLV-GQGFVPDGDQVLCQ
FHL3_MOUSE      TSRDDDPYCVACFGELFAPKCSSCNRPITXKYVSFEDRHWHHSCFSCARCSTSLV-GQGFVPDGDQVLCQ
FHL2_RAT        TARDEFPYCLTCFCDLYAKKCAGCTNPISGKYISFEERQWHNDCFNCKKCS-LSLVGRGFLTERDDILCP
LIMS2_MOUSE     YEKKGLAYCETHYNQLFGDVCYNCSHVIEGDVVSALSKAWCVNCFSCSTCNMKLT---------------
FHL2_MOUSE      TARDEFPYCLTCFCDLYAKKCAGCTNPISGKYISFEERQWHNDCFNCKKCS-LSLVGRGFLTERDDILCP
FHL1_RAT        TAVEDQYYCVDCYKNFVAKKCAGCKNPITGSVVAYEGQSWHDYCFHCKKCS-VNLANKRFVFHNEQVYCP
FHL1_MOUSE      TAVEDQYYCVDCYKNFVAKKCAGCKNPITGSVVAYEGQSWHDYCFHCKKCS-VNLANKRFVFHNEQVYCP
LIMS1_MOUSE     YERKGLAYCETHYNQLFGDVCFHCNRVIEGDVVSALNKAWCVSCFACSTCNTKLT---------------
LIMS1_HUMAN     YERKGLAYCETHYNQLFGDVCFHCNRVIEGDVVSALNKAWCVNCFACSTCNTKLT---------------
UNC97_CAEEL     YERKGLPYCEQHFHKLFGNLCFKCGDPCCGEVFQALQKTWCVKCFSCSFCDKKLDQKTKFY---------
FHL5_RAT        MSKDDFPFCLDCYNHLYAKKCAACTKPITGKFICFQDRQWHSECFNCGKCSVSLV-GEGFLTQNMEILCR
FHL2_HUMAN      TARDDFAYCLNCFCDLYAKKCAGCTNPISGKYISFEERQWHNDCFNCKKCS-LSLVGRGFLTERDDILCP
FHL5_MOUSE      MSKDDFPFCLDCYNHLYAKKCAACTKPITGKFICFQDRQWHSECFNCGKCS-------------------
TGFI1_RAT       FEHEGRPLCENHFHAQRGSLCATCGLPVTGRCVSALGRRFHPDHFTCTFCLRPLTKG-------------
FHL2_BOVIN      TSRDEFAYCLGCFCDLYAKKCAGCANPISGKYISFEERQWHNDCFNCKKCS-LSLVGRGFLTERDDILCP
FHL5_BOVIN      MSRDDYPFCLDCYNHLYAKKCAACTKPITGKFICFQDRQWHSECFNCGKCSVSLV-GEGFLTHNKEIFCR
PDLI7_CHICK     YSKKDKPLCK------------------------------------------------------------
PDLI7_MOUSE     YMEEGAPYCERDYEKMFGTKCRGCDFKIDARFLEALGFSWHDTCFVCAIC-QINLEGKTFY---------
LIMK1_CHICK     YEKDGRLYCKKDYWARFGELCHGCAEQITGLVMVAGEQKYHPECFSCLNCRAFIGDGD------------
FHL5_HUMAN      MSRDDYPFCVDCYNHLYANKCVACSKPISGKFICFQDSQWHSECFNCGKCSVSLV-GKGFLTQNKEIFCQ
FHL5_MACFA      MSRDDYPFCVDCYNHLYANKCVACSKPISGKFICFQDSQWHSECFNCGKCSGFLTQNKEIFCQ-------
PDLI7_XENLA     YMEDGKPYCEKDYEQMFGTKCRGCDFKIDARFLEALGFSWHDTCFVCAIC-QINLEGKTFY---------
LIMK2_CHICK     YEKDGKLYCHKDYWGKFGESCHGCSLLMTGPVMVAGEYKYHPECFACMSCKVIIEDGDTYALQHSTLYCG
PDLI7_RAT       YMEEGAPYCERDYEKMFGTKCRGCDFKIDARFLEALGFSWHDTCFVCAIC-QINLEGKTFY---------
PDLI7_BOVIN     YMEEGAPYCEPDYEKMFGTKCRGCDFKIDARFLEALGFSWHDTCFVCAIC-QINLEGKTFY---------
PIN2_CAEEL      YEKNGKAYCRDDFLELIGHHCFICDRNVGGGMVHVFGKAFCPECYRCRGCDKV-----------------
PDLI7_DANRE     YMEEGEPYCERDYEKMFGTKCHGCDFKIDARFLEALGYSWHDTCFVCAIC-QINLEGKTFY---------
PDLI5_RAT       FSKKDKPLCKK-----------------------------------------------------------
PDLI7_HUMAN     YMEEGVPYCERDYEKMFGTKCHGCDFKIDARFLEALGFSWHDTCFVCAIC-QINLEGKTFY---------
PDLI5_MOUSE     FHEDGEPYCETDYYALFGTICRGCEFPIEAMFLEALGYTWHDTCFVCSVCCESL-EGQTFF---------
PDLI5_HUMAN     FHEDGEPYCETDYYALFGTICHGCEFPIEAMFLEALGYTWHDTCFVCSVCCESL-EGQTFF---------
LIMK1_XENLA     YEKDGRLFCKKHYWTRFGGMCQGCSENITGLVMVAGEHKYHPECFMCSRCKAYIGDGE------------
FHL1_HUMAN      TAVEDQYYCVDCYKNFVAKKCAGCKNPITGK---------------------------------------
LIMK1_MOUSE     YEKDGQLFCKKDYWARYGESCHGCSEHITGLVMVAGELKYHPECFICLACGNFIGDGD------------
LIMK1_HUMAN     YEKDGQLFCKKDYWARYGESCHGCSEQITGLVMVAGELKYHPECFICLTCGTFIGDGD------------
LIMK1_RAT       YEKDGQLFCKKDYWARYGESCHGCSEHITGLVMVGGELKYHPECFICLACGNFIGDGD------------
LDB3_HUMAN      YSKKDRPLCKK-----------------------------------------------------------
LIMB_DICDI      CHEEGRLYCYEDYQKQILNICGACSKPIVGRSITALGKVWHPEHFTCTTCQVPF----------------
LIMK2_RAT       YEKDGKLYCHKDYWAKFGEFCHGCSLLMTGPAMVAGEFKYHPECFACMSCKVIIEDGDAYALQHATLYCG
WTIP_DANRE      ----------------------------------------------------------------------
LIMK2_BOVIN     YEKDGKLYCHKDYWGKFGEFCHGCSLLMTGPVMVAGEFKYHPECFACMSCKVIIEDGDAYALQHATLYCG
LIMK2_HUMAN     YEKDGKLYCPKDYWGKFGEFCHGCSLLMTGPFMVAGEFKYHPECFACMSCKVIIEDGDAYALQHATLYCG
LDB3_MOUSE      YSKKDKPLCKK-----------------------------------------------------------
LIMK2_MOUSE     YEKDGKLYCHKDYWAKFGEFCHGCSLLMTGPAMVAGEFKYHPECFACMSCKVIIEDGDAYALQHATLYCG
ZYX_MOUSE       --------IEADDNGCFHVLCRKCH---------------------------------------------
ZYX_HUMAN       --------IEADDNGCFHVLCRKCH---------------------------------------------
YOCC_SCHPO      FMIENTPIC-------------------------------------------------------------
LHX4_MOUSE      FSRAGSVYCKEDFFKRFGTKCTACQQGITQVVRKAQDFVYHLHCFACIICNRQLATGDEFYLDGRLVCKE
LHX4_HUMAN      FSRAGSVYCKEDFFKRFGTKCTACQQGITQVVRKAQDFVYHLHCFACIICNRQLATGDEFYLDGRLVCKE
TGFI1_MOUSE     FEHEGRPLCENHFHAQRGSLCATCGLPVTGRCVSALGRRFHPDHFTCTFCLRPLTKG-------------
FBLI1_PONAB     TDQGCYPLNNRLF-------CKPCH---------------------------------------------
FBLI1_BOVIN     TDQGCYPLNNRLF-------CKPCH---------------------------------------------
WTIP_HUMAN      ----------------------------------------------------------------------
FBLI1_HUMAN     TDQG----CYPLNNHLF---CKPCH---------------------------------------------
LIMK1_DROME     FEREGLLYCREDYYGRFGDACQQCMAVITGPVMVAGEHKFHPECFCCTACGSFIGEGESYAL--------
WTIP_XENLA      ----------------------------------------------------------------------
FBLI1_MOUSE     -PTDQGCYPLNDH--LF---CKPCH---------------------------------------------
LIMCH_DICDI     FPHDKKPYCQKIQQSTTTDHCAKCSKIIEGSILKVAGKVYHKSC--------------------------
LIMD1_MOUSE     ---DG-HRCYPLEDHLF---CHSCH---------------------------------------------
LIMD1_HUMAN     ---DG-HRCYPLEDHLF---CHSCH---------------------------------------------
Y6787_DICDI     HTDDGTPFCEKHYYEKIGFLCRHCDKIISGKCITVGTTRFHPEHFFCQFCKSNLS-GVGYKKQGDKCYCN
LHX1_SAIBB      FSREGKLYCKNDFFRCFGTKCAGCAQGISPSVRRARSKVFHLNCFTCMMCNKQLSTGEELYI--------
LHX1_RAT        FSREGKLYCKNDFFRCFGTKCAGCAQGISPSVRRARSKVFHLNCFTCMMCNKQLSTGEELYI--------
LHX1_PANTR      FSREGKLYCKNDFFRCFGTKCAGCAQGISPSVRRARSKVFHLNCFTCMMCNKQLSTGEELYI--------
LHX1_MOUSE      FSREGKLYCKNDFFRCFGTKCAGCAQGISPSVRRARSKVFHLNCFTCMMCNKQLSTGEELYI--------
LHX1_MESAU      FSREGKLYCKNDFFRCFGTKCAGCAQGISPSVRRARSKVFHLNCFTCMMCNKQLSTGEELYI--------
LHX1_HUMAN      FSREGKLYCKNDFFRCFGTKCAGCAQGISPSVRRARSKVFHLNCFTCMMCNKQLSTGEELYI--------
LHX1_DANRE      FSREGKLYCKNDFFRRFGTKCAGCAQGISPNVRRARSKVFHLNCFTCMMCNKQLSTGEELYI--------
LHX1_CHICK      FSREGKLYCKNDFFRCFGTKCAGCAQGISPSVRRARSKVFHLNCFTCMMCNKQLSTGEELYI--------
WTIP_MOUSE      ----------------------------------------------------------------------
LHX1_XENLA      FSREGKLYCKNDFFRRFGTKCAGCAQGISPSVRRARSKVFHLNCFTCMMCNKQLSTGEELYI--------
LPP_RAT         ---------EGDNQGCYHILCKSCN---------------------------------------------
LMO3_PONAB      -TKANLILCRRDYLRLFGVNCAACSKLIPAMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMI---
LMO3_MOUSE      -TKANLILCRRDYLRLFGVNCAACSKLIPAMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMI---
LMO3_HUMAN      -TKANLILCRRDYLRLFGVNCAACSKLIPAMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMI---
LMO3_BOVIN      -TKANLILCRRDYLRLFGVNCAACSKLIPAMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMI---
LHX5_RAT        FSREGKLYCKNDFFRRFGTKCAGCAQGISPSVRKARSKVFHLNCFTCMVCNKQLSTGEELYV--------
LHX5_MOUSE      FSREGKLYCKNDFFRRFGTKCAGCAQGISPSVRKARSKVFHLNCFTCMVCNKQLSTGEELYV--------
LHX5_HUMAN      FSREGKLYCKNDFFRRFGTKCAGCAQGISPSVRKARSKVFHLNCFTCMVCNKQLSTGEELYV--------
LHX5_DANRE      FSRDGKLYCKIDFFRRFGTKCAGCLQGISPSVRRARSKVFHLNCFTCMVCNKQLSTGEELYV--------
ISL3_ONCTS      FVRDGKTYCKRDYVRLFGIKCAKCNLGFSSSVMRARDNVYHIECFRCSVCSRQLLPGDEFSLR-------
ISL2B_ONCTS     FVRDGKTYCKRDYVRLFGIKCAKCNIGFCSSVMRARDNVYHMECFRCSVCSRQLVPGDEFSLR-------
LPP_MOUSE       ---------EGDNQGCYHILCKTCN---------------------------------------------
JUB_RAT         ----------------------------------------------------------------------
JUB_MOUSE       ----------------------------------------------------------------------
JUB_HUMAN       ----------------------------------------------------------------------
LMO3_XENLA      -TKANLILCRRDYLRLFGVNCAACSKLIPAMVMRAKENVYHLDCFACQLCNQRFCVGDKFFLKNNMI---
LMO3_DANRE      -TKANLILCRRDYLRLFGVNCAACSKLIPAMVMRAKENVYHLDCFACQLCNQRFCVGDKFFLKNNMI---
LHX5_XENLA      FSREGKLYCKTDFFRRFGTKCAGCSLGISPSVRKARNKVFHLNCFTCMVCNKQLSTGEELYI--------
ISL2_RAT        FVRDGKTYCKRDYVRLFGIKCAQCQVGFSSSVMRARDSVYHIECFRCSVCSRQLLPGDEFSLR-------
ISL2_MOUSE      FVRDGKTYCKRDYVRLFGIKCAQCQVGFSSSVMRARDSVYHIECFRCSVCSRQLLPGDEFSLR-------
ISL2_HUMAN      FVRDGKTYCKRDYVRLFGIKCAKCQVGFSSSVMRARDSVYHIECFRCSVCSRQLLPGDEFSLR-------
ISL2A_ONCTS     FVRDGKTYCKRDYVRLFGIKCANCNIGFCSSVMRARDNVYHMECFRCSVCSRHLLPGDEFSLR-------
RBTN1_XENLA     -TKANLILCRRDYLRLFGTNCAACSKLIPAMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMI---
RBTN1_MOUSE     -TKANLILCRRDYLRLFGTNCAACSKLIPAMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMI---
RBTN1_HUMAN     -TKANLILCRRDYLRLFGTNCAACSKLIPAMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMI---
RBTN1_DANRE     -TKANLILCRRDYLRLFGTNCAACSKLIPAMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMI---
LMO3_RAT        -TKANLILCRRDYLRLFGTNCAACSKLIPAMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMI---
LHX3_CHICK      FSRGDGVYCKEDFFKRFGTKCAACQQGITQVVRRAQDFVYHLHCFACIVCKRQLATGDEFYL--------
ISL2A_DANRE     FVRDGKTYCKRDYVRLFGIKCAKCNIGFCSSVMRARDNVYHMECFRCSVCSRHLLPGDEFSLR-------
ISL1_DANRE      TCRDGKTYCKRDYIRLYGIKCAKCNIGFSKNVMRARSKVYHIECFRCVACSRQLIPGDEFALR-------
ISL1_CHICK      FVRDGKTYCKRDYIRLYGIKCAKCSIGFSKNVMRARAKVYHIECFRCVACSRQLIPGDEFALR-------
LHX3_DANRE      FSRGDSVYCKDDFFKRFGTKCAACQQGITQVVRRAQDFVYHLHCFACIVCKRQLATGDEYYL--------
ISL1_RAT        TCRDGKTYCKRDYIRLYGIKCAKCSIGFSKNVMRARSKVYHIECFRCVACSRQLIPGDEFALR-------
ISL1_MOUSE      TCRDGKTYCKRDYIRLYGIKCAKCSIGFSKNVMRARSKVYHIECFRCVACSRQLIPGDEFALR-------
ISL1_MESAU      TCRDGKTYCKRDYIRLYGIKCAKCSIGFSKNVMRARSKVYHIECFRCVACSRQLIPGDEFALR-------
ISL1_HUMAN      TCRDGKTYCKRDYIRLYGIKCAKCSIGFSKNVMRARSKVYHIECFRCVACSRQLIPGDEFALR-------
ISL2B_DANRE     FVRDGKTYCKRDYVRLFGIKCAKCTLGFSSSVMRARDSVYHIECFRCSVCSRQLLPGDE-----------
RBTN1_BOVIN     -TKANLILCRRDYLRLFGTNCAACSKLIPAMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMI---
LPP_CHICK       ---------EGDNQGCYHILCKTCN---------------------------------------------
LHX8_HUMAN      ----------------------------------------------------------------------
LPP_HUMAN       ---------EGDNQGCYHILCKTCN---------------------------------------------
ZYX_XENLA       --------IEADDAGCFHVLCKKCH---------------------------------------------
LHX8_MOUSE      ----------------------------------------------------------------------
LHX3_XENLA      FSRGDSVYCKDDFFKRFGTKCAACQQGITQVVRRAQEFVYHLHCFACIVCKRQLATGDEFYL--------
LHX3_HUMAN      FSRGESVYCKDDFFKRFGTKCAACQLGITQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYL--------
ZYX_XENTR       -ADDGGCFPLDGH-----VLCKKCH---------------------------------------------
TES_XENTR       VMVNDKPVCKLCYVKNHAVSCQGCHNAIDPEVQRVSYNGFHPECFICSCCSKCLIGQKFMPIQGMVFCSV
LHX9_RAT        FAKDGSIYCKEDYYRRFSVRCARCHLGISASVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSLVY--
LHX9_MOUSE      FAKDGSIYCKEDYYRRFSVRCARCHLGISASVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSLVY--
LHX9_HUMAN      FAKDGSIYCKEDYYRRFSVRCARCHLGISASVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSLVY--
LHX3_PIG        FSRGESLYCKDDFFKRFGTKCAACQLGITQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYL--------
LHX3_MOUSE      FSRGESVYCKDDFFKRFGTKCAACQLGITQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYL--------
LHX9_BOVIN      FAKDGSIYCKEDYYRRFSVRCARCHLGISASVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSLVY--
LHX2_MOUSE      FSKDGSIYCKEDYYRRFSVRCARCHLGISASVMRARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVY--
LHX2_HUMAN      FSKDGSIYCKEDYYRRFSVRCARCHLGISASVMRARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVY--
ZYX_CHICK       --------IEADENGCFHVLCMKCH---------------------------------------------
LHX6_MOUSE      ----------------------------------------------------------------------
LHX6_HUMAN      ----------------------------------------------------------------------
APTE_DROME      YSRDGNIYCKNDYYSFFGTRCSRCLASISSNVMRARNLVFHVNCFCCTVCHTPLTKGDQ-----------
LHX2_RAT        FSKDGSIYCKEDYYRRFSVRCARCHLGISESVMRARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVY--
LIMA_DICDI      FSREQMTSTSSNYSGRVD-KCAYCHGVILGVSMLAMGQNYHPKCFKCSTCH-------------------
LHX9_ASTFA      FAKDGSIYCKEDYYRRFSVRCARCHLGISASVMRARDSVYHLSCFTCTSCNKTLTTGDHFGMRENLVY--
PRIC1_XENTR     LPKKGRIYCSK-----------------------------------------------------------
ISL2_CHICK      FLRDGKAYCKRDYGRLFGIKCAQCRAAFSSSVMRARDHVYHLECFRCAACGRQLLPGDQFCLR-------
PRIC1_AEDAE     IMRDGKPYCLHCFDAMFAEYCDFCSEPIQGQMSHDG-QHWHDSCFACSTC--------------------
PRI1B_XENLA     LPKKGRIYCSK-----------------------------------------------------------
LMO42_XENTR     -TKSGMILCRNDYIRLFGNSCSACGQSIPASVMRAQGNVYHLKCFTCSTCRNRLVPGDRFYINGS-----
LMX1B_CHICK     YFRDRKLYCKQDYQQLFAAKCSGCMEKITEFVMRALECVYHLSCFCCCVCERQLRKGDEFVLK-------
LHX9_RANRU      FAKDGSIYCKEDYYRRFSVRCARCHLGISASVMRARESVYHLSCFTCTTCNKTLSTGDHFGMKENLVY--
PRIC1_DROME     IMREGKPYCLHCFDAMFAEYCDYCGEAIQGQMSHDG-QHWHATCFSCNTC--------------------
PRI1A_XENLA     LPKKGRIYCCK-----------------------------------------------------------
LMX1B_MOUSE     YFRDRKLYCKQDYQQLFAAKCSGCMEKITEFVMRALECVYHLGCFCCCVCERQLRKGDEFVLK-------
LMX1B_MESAU     YFRDRKLYCKQDYQQLFAAKCSGCMEKITEFVMRALECVYHLGCFCCCVCERQLRKGDEFVLK-------
LMX1B_HUMAN     YFRDRKLYCKQDYQQLFAAKCSGCMEKITEFVMRALECVYHLGCFCCCVCERQLRKGDEFVLK-------
LIMF_DICDI      TSKLSNYCCEDCFEKVD--KCNGCNSMTLGQTLLAMGKNYHANCFKCFKCSEI-----------------
LMO4_MOUSE      -TKSGMILCRNDYIRLFGNSCSACGQSIPASVMRAQGNVYHLKCFTCSTCRNRLVPGDRFYINGS-----
LMO4_HUMAN      -TKSGMILCRNDYIRLFGNSCSACGQSIPASVMRAQGNVYHLKCFTCSTCRNRLVPGDRFYINGS-----
LMO4_BOVIN      -TKSGMILCRNDYIRLFGNSCSACGQSIPASVMRAQGNVYHLKCFTCSTCRNRLVPGDRFYINGS-----
LMO4A_XENLA     -TKSGMILCRNDYIRLFGNSCNACGQSIPASVMRAQGSVYHLKCFTCATCRNRLVPGDRFHYVNGTIF--
PRIC1_DROPS     IMREGKPYCLHCFDAMFAEYCDYCGEAIQGQMSHDG-QHWHATCFSCNTC--------------------
ESN_DROPS       IMREGKPYCLGCFDTMFAEYCDYCGEVIQGQMSHDG-QHWHASCCTC-RCSLL---GRPFLPRRGTIYEP
TES_RABIT       VMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVVTYNDFSWHASCFLCSCCSKCLIGQKFMPVEGMVFCSV
LMX1A_HUMAN     FYRDKKLYCKYDYEKLFAVKCGGCFEAIAPNVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLKEGQLL--
ESN_DROME       IMREGKPYCLACFDTMFAEYCDYCGEVIQGQMSHDG-QHWHASCCTC-RCSLL---GRPFLPRRGTIYEP
TRIP6_MOUSE     ----------------------------------------------------------------------
RGA1_SCHPO      ----------------------------------------------------------------------
PRIC1_ANOGA     IMRDGKPYCLHCFDAMFAEYCDYCSEPIQGQMSHDG-QHWHATCFACSTC--------------------
LIN11_CAEEL     FSRDGLILCKTDFSRRYSQRCAGCDGKLEKEVRRARDKVFHIRCFQCSVCQRLLDTGDQLYIMEGNVCQS
LIM_HALRO       FSRGNLVFCKDDFFKRFGTKCTACGHGITEVIRRAQDNVYHLECFCCFLCHEKMGTGDQFYL--------
TES_AOTNA       VMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSV
PRIC2_MOUSE     IMKEGRPYCCHCFESLYAEYCDTCHIGIDQGQMTYDDQHWHETCFCCAHCKK------------------
LHX9_XENLA      FAKDGSIYCKEDYYRFSVKRCARCHLGISASVMRARESVYHLSCFTCTTCNKTLSTGDQFGMKENLVY--
TES_SAIBB       VMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSV
TES_PIG         VMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSV
TES_CALMO       VMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSV
TES_ATEGE       VMVSDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSV
LMO4B_XENLA     -TKSGMILCRNDYIRLFGNSCNACGQSIPASVMRAQGSVYHLKCFTCATCRNRLVPGDRFHYVNGTIF--
PRIC2_HUMAN     IMKEGRPYCCHCFESLYAEYCDTCAQHIQGQMTYDG-QHWHETCFCCAHCKK------------------
TRIP6_BOVIN     ----------------------------------------------------------------------
TES_XENLA       VMVNDKAVCKPCYVKNHAVSCQGCHNAIDPEVQRVSYNGFHPECFICSCCSKCLIGQKFMPIEGMVFCSV
TES_PAPAN       VMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVSSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSV
TES_OTOGA       VMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSV
TES_NEONE       VMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSV
TES_MUNRE       VMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVSSWHASTECFLCSCCSRCLIGQKFMPVEGMVFCSV
TES_MUNMU       VMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVSSWHASTECFLCSCCSRCLIGQKFMPVEGMVFCSV
TES_FELCA       VMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSV
TES_EULMM       VMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSV
TES_DASNO       VMVNEKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSV
TES_CERAE       VMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVSSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSV
TES_ATEAB       VMVNDKPVCKPCYVKNHAVICQGCHNAIDPEVQRVTSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSL
LMX1A_MOUSE     FYRDKKLYCKYHYEKLFAVKCGGCFEAIAPNVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLKEGQLL--
LMX1A_MESAU     FYRDKKLYCKYHYEKLFAVKCGGCFEAIAPNVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLKEGQLL--
TES_LOXAF       VMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSV
TRIP6_HUMAN     ----------------------------------------------------------------------
TES_SHEEP       VMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSV
TES_PONAB       VMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSV
TES_PANTR       VMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSV
TES_HYLLE       VMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSV
TES_HUMAN       VMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSV
TES_HORSE       VMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSV
TES_COLGU       VMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSV
TES_CANFA       VMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSV
TES_MUSPF       VMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSV
TES_MONDO       VMVDNKPICKPCYVRNHAVICQGCHNAIDPEVQRVTNWHATEECFLCSCCSKCLIGQKFIPIEAMLFCSV
TES_CALJA       VMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSV
PRIC1_MOUSE     LPKQGQIYCSK-----------------------------------------------------------
PRIC1_HUMAN     LPKQGQIYCSK-----------------------------------------------------------
TES_MICMU       VMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSV
RBTN2_MOUSE     ----------------------------------------------------------------------
RBTN2_HUMAN     ----------------------------------------------------------------------
RBTN2_BOVIN     ----------------------------------------------------------------------
TES_BOVIN       VMVNDKPVCKPCYVKNHAEVCQGCHNAIDPEVQRVTSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSV
CRIP3_HUMAN     AEHDGVPYCHVPCYGLFGPK--------------------------------------------------
RBTN2_XENTR     ----------------------------------------------------------------------
RBTN2_XENLA     ----------------------------------------------------------------------
TES_RAT         VMVRDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSV
TES_MOUSE       VMVTDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSV
RBTN2_DANRE     ----------------------------------------------------------------------
LIMG_DICDI      IEKDG-PVCGK-----------------------------------------------------------
CSRP2_RAT       LTKEGEIYCKGCYAKNFGPK--------------------------------------------------
CRIP2_PONAB     AEHDGQPYCHKPCYGLFGPK--------------------------------------------------
PRIC1_RAT       LPKQGQIYCSK-----------------------------------------------------------
CRIP2_HUMAN     AEHDGQPYCHKPCYGLFGPK--------------------------------------------------
TES_CHICK       VMVNDKPVCRPCYVKKHAAICQGCHNAIDPEVQRVTNWHATQECFLCSCCSKCLIGQKFMPVEGMVFCSV
TES_RHIFE       VMVDDKPVCKPCYVKNHAVVCQGCHNAIDPEV--------------------------------------
CSRP2_MOUSE     LTKEGEIYCKGCYAKNFGPK--------------------------------------------------
CRIP2_BOVIN     AEHDGQPYCHKPCYGLFGPK--------------------------------------------------
CSRP2_HUMAN     LTKEGEIYCKGCYAKNFGPK--------------------------------------------------
CSRP2_BOVIN     LTKEGEIYCKGCYAKNFGPK--------------------------------------------------
PRIC3_HUMAN     VMRQSRPHCCACYEARHAEYCDGCGEHIQGQMAYEG-QHWHASCFCCSRC--------------------
CSRP3_MOUSE     VTKDGELYCKVCYAKNFG----------------------------------------------------
CRIP2_MOUSE     AEHDGQPYCHKPCYGLFGPK--------------------------------------------------
CSRP2_COTJA     LTKEGEIYCKGCYAKNFGPK--------------------------------------------------
CSRP3_RAT       VTKDGELYCKVCYAKNFG----------------------------------------------------
CSRP3_BOVIN     VTKDGELYCKVCYAKNFG----------------------------------------------------
CRIP2_RAT       AEHDGQPYCHKPCYGLFGPK--------------------------------------------------
HM14_CAEEL      ----------------------------------------------------------------------
CSRP3_HUMAN     VTKDGELYCKVCYAKNFG----------------------------------------------------
CSRP2_CHICK     LTKEGEIYCKGCYAKNFGPK--------------------------------------------------
MEC3_CAEBR      ----------------------------------------------------------------------
AWH_DROME       ----------------------------------------------------------------------
LHX9_DANRE      FAKDGSIYCKEDYYRRFSVRCARCHLGISASVMRARDSVYHLS---------------------------
Y1927_ARATH     STSGNYPFHKACYRERYHPKCDVCSHFIPTNVQKYCPSHEHDATPRCCSCERM-----------------
PXL1_YEAST      ILGD-EPYCQKHYHEENHSICKVCSNFIEGECLE-NDKRFHVDCLNCFLCKTAIT---------------
PRIC3_MOUSE     VMRQSRPHCCACYEARHAEYCDGCGEHIQGQMAYEG-QHWH-----------------------------
LIMK_DICDI      ----------------------------------------------------------------------
LIMC_DICDI      SERDGQPYCKTDYDRLF-----------------------------------------------------
LHX9_CHICK      FAKDGSIYCKEDYYRRFSVRCARCHLGISASVMRARESVYHLS---------------------------
MEC3_CAERE      ----------------------------------------------------------------------
ZN420_HUMAN     LTQH-----ERIHTGEKPYECKECKSFIRGSQLHTGEKPY-----ECKECRMAFTQSSHL----------
CRIP1_RAT       AEHEGKPYCNHPYSAMFGPK--------------------------------------------------
CRIP1_MOUSE     AEHEGKPYCNHPYSAMFGPK--------------------------------------------------
CRIP1_HUMAN     AEHEGKPYCNHPYAAMFGPK--------------------------------------------------
CRIP1_BOVIN     AEHEGKPYCNHPYAAMFGPK--------------------------------------------------
MEC3_CAEEL      ----------------------------------------------------------------------
ZN571_HUMAN     ISNSNLIQHQRIHTGEKPYKCKECGKFICGKQLSEHQRHTGEKPFECKECGKAFTQHEKIHGEK----HY
LRG1_YEAST      ----------------------------------------------------------------------
ZN571_PONAB     ISNSNLIQHQRIHTGEKPYKCKECGKFICGKQLSEHQRHTGEKPFECKECGKAFTQHEKIHGEK----HY
VILI_CHICK      ----------------------------------------------------------------------
CSRP1_RAT       LAKDGEIYCKGCY---------------------------------------------------------
CSRP1_MOUSE     LAKDGEIYCKGCY---------------------------------------------------------
CSRP1_HUMAN     LAKDGEIYCKGCY---------------------------------------------------------
CSRP1_BOVIN     LAKDGEIYCKGCY---------------------------------------------------------
YS029_HUMAN     IGHQAVHTGEKPYD------CKECGKSFTSRSIHTGEKPYH-----CKECGKSFTVGSTLHQQIHTGEKP
RGA3_SCHPO      QTSDGRPVCSSCAH-----TCTACRMRIKDYALMSGYDSYHRECFRCHDCRKQIID-SNFKRDNRTIFCN
LMO41_XENTR     ----------------------------------------------------------------------
CSRP1_PONAB     LAKDGEIYCKGCY---------------------------------------------------------
CSRP1_COTJA     LAKDGEIYCKGCY---------------------------------------------------------
CSRP1_CHICK     LAKDGEIYCKGCY---------------------------------------------------------
MLP2_DROME      AGPDGDIHCRACYGKLFGPKGESTIQFPDGRPL-AGPK----TSGGCPRCGFAVFAAEQM-ISKTRIWHK
LMCD1_PIG       FWKDGAPWCGRHYCESLRPRCSGCDEIIFSEDYQVEDLAWHRKHFVCEGCEQQL-GGRAYIITKGQLLCP
LMCD1_HUMAN     FWKDGAPWCGRHYCESLRPRCSGCDEIIFAEDYQVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLC-P
ZFP59_MOUSE     NSHKIVHTSKRPFE------CKVCGKSFESNLIQHGAVHAGVKSYECSECGKGFIDRSSLF---------
LMCD1_MOUSE     FWKDGAPWCGRHYCESVRPRCSGCDEIIFSEDYQVEDLAWHRKHFICEGCEQLLSGRAYIVTKGQLLC-P
ZSC12_PONPY     FSQSGLIQHQRIHTGEKPYKCEVCEKAFIQRTIHTGERPY-----KCDKCGKAFTQ--------------
ZSC12_MACNE     FSQSGLIQHQRIHTGEKPYKCEVCEKAFIQRTIHTGERPY-----KCDKCGKAFTQ--------------
PRIC4_HUMAN     ----------------------------------------------------------------------
ZSC12_PANTR     FSQSGLIQHQRIHTGEKPYKCDVCEKAFIQRTIHTGERPY-----KCDKCGKAFTQ--------------
PDLI3_CHICK     ----------------------------------------------------------------------
LMCD1_BOVIN     FWKDGAPWCGRHYCESLRPRCSGCDEIIFSEDYQVEDLAWHRKHFVCEGCEQQLGGRAYIVTMGQLLC-P
ZSC12_PANPA     FSQSGLIQHQRIHTGEKPYKCDVCEKAFIQRTIHTGERPY-----KCDKCGKAFTQ--------------
ZSC12_HUMAN     FSQSGLIQHQRIHTGEKPYKCDVCEKAFIQRTIHTGERPY-----KCDKCGKAFTQ--------------
ZSC12_GORGO     FSQSGLIQHQRIHTGEKPYKCDVCEKAFIQRTIHTGERPY-----KCDKCGKAFTQ--------------
ZN479_HUMAN     TLTDH----KRIHTGERPYKCEECGKAFSHKRIHTGERPYTEECGKAFNCSSTLMQHKRIHTGEKPYKCE
ZN141_HUMAN     VLNEH----KKIHTGEKPYKCEECGKAFQHKKIHSADKPY-----KCKECDKAFKQ--------------
ZN734_HUMAN     TLTDH----KRIHTGERPYKCEECGKAFSHKRIHTGERPYTEECGKAFNCSSTLMQHKRIHTGEKPYKCE
ZN345_BOVIN     SSGSDLTQHQRIHTGEKPYECKECSKLIQHQLIHTGEKPY-----ECRECRKSFSSGSALHQRIHTGQKP
ZN774_HUMAN     ITHQRIHLGDRPY------RCPECSHFLTHQRTHTGEKPFH-----CSKCNKSFRQKAHLLCHQNT----
ZN733_HUMAN     TLTDH----KRIHTGERPYKCEECGKAFSHKRIHTGERPYTEECGKAFNCSSTLMQHKRIHTGEKPYKCE
ZN540_HUMAN     TEH------QKIHTGVKPYKCKECGKAFSRSVIHTGEKPYEKQCGKAFRLNSHLTEHQRIH---------
PDLI3_RAT       ----------------------------------------------------------------------
ZN283_MACFA     LVKH-----ERVHTGEKSHECKECYQLTRHQVFHTGEKPY-----ECKECGKAFNCGSSL----------
VILI_HUMAN      ----------------------------------------------------------------------
PDLI3_PIG       ----------------------------------------------------------------------
PDLI3_MOUSE     ----------------------------------------------------------------------
PDLI3_BOVIN     ----------------------------------------------------------------------
LASP1_CAEEL     KGYDKRPYCDPHY---------------------------------------------------------