[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for huge0:KIAA0101

[Show Plain Result]


## Summary of Sequence Search
    1::130
    1::111     7e-54 100%  111 aa  PAF_HUMAN RecName: Full=PCNA-associated factor;AltName:
    1::111     4e-50  82%  111 aa  PAF_BOVIN RecName: Full=PCNA-associated factor;AltName:
    1::110     8e-47  91%  110 aa  PAF_RAT RecName: Full=PCNA-associated factor;AltName:
    1::110     9e-46  88%  110 aa  PAF_MOUSE RecName: Full=PCNA-associated factor;AltName:
    1::130

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxMVRTKADSVPGTYRKVVAARAPRKVLGXXXXXXXXXXXXXRKAENKYAGGN
PAF_HUMAN       -------------------MVRTKADSVPGTYRKVVAARAPRKVLGXXXXXXXXXXXXXRKAENKYAGGN
PAF_BOVIN       -------------------MVRTKANSVPGSYRKVVASRAPRKVLGSSTSAANSTPLSSRKAENKYAGGN
PAF_RAT         -------------------MVRTKANYVPGAYRKVVASQAPRKVLXXXXXXXXXXXXX-RKAENKYAGGN
PAF_MOUSE       -------------------MVRTKANYVPGAYRKAVASQAPRKVLGXXXXXXXXXXXX-RKAENKYAGGN


                         .         .         *         .         .         .         .:140
query           PVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
PAF_HUMAN       PVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
PAF_BOVIN       PVCVRPTPKWQKGIGEFFSLSPKDSEKENRIPEEAGSSGLGKAKRKACPLPPDHTDDEKE
PAF_RAT         PVCVRPTPKWQKGIGEFFRLSPKDSKKENQIPEEAGSSGLGKAKRKACPLQPDHRDDENE
PAF_MOUSE       PVCVRPTPKWQKGIGEFFRLSPKESKKENQAPEEAGTSGLGKAKRKACPLQPDHRDDENE