[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for huge0:KIAA0113

[Show Plain Result]


## Summary of Sequence Search
    1::636
    1::636       0.0 100%  636 aa  TNIP1_HUMAN RecName: Full=TNFAIP3-interacting protein 1;AltName:
    1::647       0.0  75%  647 aa  TNIP1_MOUSE RecName: Full=TNFAIP3-interacting protein 1;AltName:
   33::92      7e-14  44%  319 aa  TNIP3_HUMAN RecName: Full=TNFAIP3-interacting protein 3;AltName:
  171::425     4e-10  29%  462 aa  CEP55_RAT RecName: Full=Centrosomal protein of 55 kDa;       
  171::425     4e-10  28%  462 aa  CEP55_MOUSE RecName: Full=Centrosomal protein of 55 kDa;       
 1370::1595    8e-10  25% 2363 aa  TPR_HUMAN RecName: Full=Nucleoprotein TPR;
  777::913     4e-09  32% 1818 aa  HMW2_MYCPN RecName: Full=Cytadherence high molecular weight protein
  170::373     4e-09  31%  464 aa  CEP55_HUMAN RecName: Full=Centrosomal protein of 55 kDa;       
  363::525     8e-09  31%  991 aa  MPP9_MOUSE RecName: Full=M-phase phosphoprotein 9;
  272::457     1e-08  24%  498 aa  HMMR_RAT RecName: Full=Hyaluronan-mediated motility
  415::545     4e-08  31%  911 aa  IMH1_YEAST RecName: Full=Golgin IMH1;AltName: Full=Integrins and
  781::939     5e-08  28%  955 aa  CCD46_HUMAN RecName: Full=Coiled-coil domain-containing protein 46;
  769::938     7e-08  29%  954 aa  CCD46_MOUSE RecName: Full=Coiled-coil domain-containing protein 46;
  348::551     7e-08  22%  693 aa  CCD41_HUMAN RecName: Full=Coiled-coil domain-containing protein
  390::736     9e-08  24% 1101 aa  CC150_HUMAN RecName: Full=Coiled-coil domain-containing protein
  121::320     1e-07  33%  430 aa  TNIP2_MOUSE RecName: Full=TNFAIP3-interacting protein 2;AltName:
  339::468     1e-07  27%  624 aa  MOEH_ANOGA RecName: Full=Moesin/ezrin/radixin homolog 1;
  652::973     1e-07  24% 1438 aa  CLIP1_HUMAN RecName: Full=CAP-Gly domain-containing linker protein
  991::1122    2e-07  24% 2363 aa  SPTB2_MOUSE RecName: Full=Spectrin beta chain, brain 1;AltName:
  991::1122    2e-07  24% 2364 aa  SPTB2_HUMAN RecName: Full=Spectrin beta chain, brain 1;AltName:
  214::317     2e-07  37% 1191 aa  SMC3_RAT RecName: Full=Structural maintenance of chromosomes
  214::317     2e-07  37% 1217 aa  SMC3_PONAB RecName: Full=Structural maintenance of chromosomes
  214::317     2e-07  37% 1217 aa  SMC3_MOUSE RecName: Full=Structural maintenance of chromosomes
  214::317     2e-07  37% 1217 aa  SMC3_HUMAN RecName: Full=Structural maintenance of chromosomes
  214::317     2e-07  37% 1218 aa  SMC3_BOVIN RecName: Full=Structural maintenance of chromosomes
  120::253     3e-07  30%  254 aa  SYCP3_MOUSE RecName: Full=Synaptonemal complex protein 3;       
  222::353     3e-07  26%  484 aa  RUD3_YEAST RecName: Full=GRIP domain-containing protein
  145::459     3e-07  24%  692 aa  MYSP_DERFA RecName: Full=Paramyosin;AltName: Full=Antigen
  115::312     3e-07  31%  464 aa  IFE_BRALA RecName: Full=Non-neuronal cytoplasmic intermediate
  489::846     3e-07  28% 1219 aa  FKB15_HUMAN RecName: Full=FK506-binding protein 15;AltName:
  683::885     4e-07  28% 2055 aa  CTRO_MOUSE RecName: Full=Citron Rho-interacting kinase;       
 1034::1285    4e-07  29% 2439 aa  CE290_DANRE RecName: Full=Centrosomal protein of 290 kDa;       
  933::1075    5e-07  25% 1487 aa  GOGA3_MOUSE RecName: Full=Golgin subfamily A member 3;AltName:
  301::452     5e-07  33%  586 aa  EZRI_RABIT RecName: Full=Ezrin;AltName: Full=p81;AltName:
 1863::2033    5e-07  31% 3674 aa  DMD_PIG RecName: Full=Dystrophin;
 1867::2037    5e-07  31% 3685 aa  DMD_HUMAN RecName: Full=Dystrophin;
 1379::1661    5e-07  25% 2442 aa  CP250_HUMAN RecName: Full=Centrosome-associated protein
  450::553     6e-07  25% 1255 aa  DIAP1_MOUSE RecName: Full=Protein diaphanous homolog 1;AltName:
  120::319     8e-07  34%  429 aa  TNIP2_HUMAN RecName: Full=TNFAIP3-interacting protein 2;AltName:
 1081::1280    8e-07  31% 1385 aa  KIF15_RAT RecName: Full=Kinesin-like protein KIF15;AltName:
 1058::1191    1e-06  26% 1959 aa  MYH9_CHICK RecName: Full=Myosin-9;AltName: Full=Myosin heavy chain
 1541::1684    1e-06  24% 1790 aa  USO1_YEAST RecName: Full=Intracellular protein transport protein
  363::507     1e-06  25% 1957 aa  SPO15_SCHPO RecName: Full=Sporulation-specific protein 15;
   99::444     1e-06  28%  564 aa  M12_STRPY RecName: Full=M protein, serotype 12;Flags: Precursor;
 1041::1164    1e-06  34% 2009 aa  CROCC_MOUSE RecName: Full=Rootletin;AltName: Full=Ciliary rootlet
  863::1064    1e-06  19% 1433 aa  CLIP1_CHICK RecName: Full=CAP-Gly domain-containing linker protein
  959::1139    2e-06  32% 1403 aa  QN1_RAT RecName: Full=Protein QN1 homolog;
 2856::3052    2e-06  25% 3259 aa  GOGB1_HUMAN RecName: Full=Golgin subfamily B member 1;AltName:
 1869::2039    2e-06  33% 3680 aa  DMD_CANFA RecName: Full=Dystrophin;
  777::930     2e-06  24% 1153 aa  CING_SORAR RecName: Full=Cingulin;
  875::1001    2e-06  22% 1460 aa  CE164_HUMAN RecName: Full=Centrosomal protein of 164 kDa;       
   72::223     2e-06  27%  547 aa  SGM1_SCHPO RecName: Full=Protein sgm1;
  112::234     2e-06  34%  615 aa  NF70_LOLPE RecName: Full=70 kDa neurofilament protein;AltName:
  112::234     2e-06  34%  511 aa  NF60_LOLPE RecName: Full=60 kDa neurofilament protein;AltName:
  904::1024    2e-06  20% 1969 aa  MYO3_CAEBR RecName: Full=Myosin-3;AltName: Full=Myosin heavy chain A;
 1028::1154    2e-06  36% 1526 aa  MYO2_SCHPO RecName: Full=Myosin type-2 heavy chain 1;AltName:
 1703::1845    2e-06  25% 1937 aa  MYH8_MOUSE RecName: Full=Myosin-8;AltName: Full=Myosin heavy chain
  480::623     2e-06  31%  728 aa  GOGA5_RAT RecName: Full=Golgin subfamily A member 5;AltName:
  392::554     2e-06  31%  731 aa  GOGA5_HUMAN RecName: Full=Golgin subfamily A member 5;AltName:
  378::525     2e-06  32% 2230 aa  GOGA4_HUMAN RecName: Full=Golgin subfamily A member 4;AltName:
  274::404     2e-06  31% 1135 aa  FIL1L_HUMAN RecName: Full=Filamin A-interacting protein
    5::123     3e-06  25%  284 aa  TPM2_SCHMA RecName: Full=Tropomyosin-2;AltName: Full=Tropomyosin
  123::256     3e-06  30%  257 aa  SYCP3_RAT RecName: Full=Synaptonemal complex protein 3;       
  416::580     3e-06  28% 1415 aa  SMC4_DICDI RecName: Full=Structural maintenance of chromosomes
  255::384     3e-06  24%  627 aa  SAS6_DANRE RecName: Full=Spindle assembly abnormal protein 6
  804::1008    3e-06  27% 1875 aa  MLP1_YEAST RecName: Full=Protein MLP1;AltName: Full=Myosin-like
  571::691     3e-06  23%  794 aa  HMMR_MOUSE RecName: Full=Hyaluronan mediated motility
   38::188     3e-06  27%  524 aa  CNPD_PELLD RecName: Full=2',3'-cyclic-nucleotide
  111::252     4e-06  24%  286 aa  PU92_SCICO RecName: Full=Puff II/9-2 protein;Flags: Precursor;
 1703::1845    4e-06  25% 1937 aa  MYH8_HUMAN RecName: Full=Myosin-8;AltName: Full=Myosin heavy chain
  391::703     4e-06  28% 1931 aa  HMW2_MYCGA RecName: Full=Cytadherence high molecular weight protein
  317::410     4e-06  32%  485 aa  GCOM1_XENTR RecName: Full=GRINL1A complex locus protein 1;
   55::262     4e-06  22%  711 aa  CEP63_CHICK RecName: Full=Centrosomal protein of 63 kDa;       
  405::675     4e-06  28% 1110 aa  CC150_MOUSE RecName: Full=Coiled-coil domain-containing protein
 2008::2210    4e-06  28% 3214 aa  BPA1_HUMAN RecName: Full=Bullous pemphigoid antigen 1, isoforms
  593::784     4e-06  27% 1727 aa  ALM1_SCHPO RecName: Full=Abnormal long morphology protein
  100::233     5e-06  30%  234 aa  SYCP3_MESAU RecName: Full=Synaptonemal complex protein 3;       
 1714::1847    5e-06  24% 1939 aa  MYH8_CANFA RecName: Full=Myosin-8;AltName: Full=Myosin heavy chain
 1710::1889    5e-06  25% 1940 aa  MYH3_MOUSE RecName: Full=Myosin-3;AltName: Full=Myosin heavy chain 3;
  651::823     5e-06  35% 1343 aa  KIF7_HUMAN RecName: Full=Kinesin-like protein KIF7;
 1151::1319    5e-06  32% 1387 aa  KIF15_MOUSE RecName: Full=Kinesin-like protein KIF15;AltName:
 1869::1983    5e-06  31% 3678 aa  DMD_MOUSE RecName: Full=Dystrophin;
  104::350     5e-06  25% 1424 aa  CUX2_HUMAN RecName: Full=Homeobox protein cut-like 2;       
   38::175     5e-06  27%  524 aa  CNPD_PROVI RecName: Full=2',3'-cyclic-nucleotide
  370::554     5e-06  28% 1051 aa  APSB_EMENI RecName: Full=Anucleate primary sterigmata protein B;
  249::379     7e-06  27%  640 aa  SAS6_CHICK RecName: Full=Spindle assembly abnormal protein 6
  440::562     7e-06  33%  944 aa  NUF1_YEAST RecName: Full=Protein NUF1;AltName: Full=Spindle poly
 1187::1377    7e-06  27% 1938 aa  MYO1_CAEEL RecName: Full=Myosin-1;AltName: Full=Myosin heavy chain D;
 1711::1873    7e-06  26% 1935 aa  MYH7_RAT RecName: Full=Myosin-7;AltName: Full=Myosin heavy chain
   20::182     7e-06  26%  244 aa  MYH7_PAPHA RecName: Full=Myosin-7;AltName: Full=Myosin heavy chain
 1711::1873    7e-06  26% 1935 aa  MYH7_MOUSE RecName: Full=Myosin-7;AltName: Full=Myosin heavy chain
 1710::1872    7e-06  26% 1934 aa  MYH7_MESAU RecName: Full=Myosin-7;AltName: Full=Myosin heavy chain
 1711::1873    7e-06  26% 1935 aa  MYH7_HUMAN RecName: Full=Myosin-7;AltName: Full=Myosin heavy chain
 1711::1873    7e-06  26% 1935 aa  MYH7_CANFA RecName: Full=Myosin-7;AltName: Full=Myosin heavy chain
 1710::1889    7e-06  25% 1940 aa  MYH3_RAT RecName: Full=Myosin-3;AltName: Full=Myosin heavy chain
 1710::1889    7e-06  25% 1940 aa  MYH3_HUMAN RecName: Full=Myosin-3;AltName: Full=Myosin heavy chain
  442::586     7e-06  26% 1711 aa  MRCKB_HUMAN RecName: Full=Serine/threonine-protein kinase MRCK
  509::630     7e-06  29% 1732 aa  MRCKA_HUMAN RecName: Full=Serine/threonine-protein kinase MRCK
  421::567     7e-06  29% 1031 aa  MPP9_HUMAN RecName: Full=M-phase phosphoprotein 9;
  282::445     7e-06  24%  887 aa  IMH1_ASHGO RecName: Full=Golgin IMH1;
   85::223     7e-06  23%  575 aa  IFA1_CAEEL RecName: Full=Intermediate filament protein
  656::802     7e-06  30% 1873 aa  GRDN_MOUSE RecName: Full=Girdin;AltName: Full=Girders of actin
  832::1005    7e-06  26% 1498 aa  GOGA3_HUMAN RecName: Full=Golgin subfamily A member 3;AltName:
  254::394     7e-06  34%  767 aa  GOGA1_HUMAN RecName: Full=Golgin subfamily A member 1;AltName:
  685::778     7e-06  35% 1216 aa  FKB15_MOUSE RecName: Full=FK506-binding protein 15;AltName:
 1478::1591    7e-06  31% 2414 aa  CP250_MOUSE RecName: Full=Centrosome-associated protein
  755::883     7e-06  26% 1302 aa  CGNL1_HUMAN RecName: Full=Cingulin-like protein 1;AltName:
  182::543     7e-06  25%  725 aa  BRE1_ASPFU RecName: Full=E3 ubiquitin-protein ligase bre1;       
  657::806     9e-06  30% 1415 aa  UACA_CANFA RecName: Full=Uveal autoantigen with coiled-coil domains
  317::490     9e-06  29%  586 aa  SWP70_CHICK RecName: Full=Switch-associated protein 70;       
  740::904     9e-06  23% 1197 aa  SMC2_HUMAN RecName: Full=Structural maintenance of chromosomes
   81::290     9e-06  30%  387 aa  NEMO_DROME RecName: Full=NF-kappa-B essential modulator;AltName:
  505::630     9e-06  27% 1732 aa  MRCKA_RAT RecName: Full=Serine/threonine-protein kinase MRCK alpha;
  566::700     9e-06  32%  820 aa  BRE1_CRYNE RecName: Full=E3 ubiquitin-protein ligase BRE1;       
  224::465     1e-05  26%  813 aa  TAXB1_PONAB RecName: Full=Tax1-binding protein 1 homolog;
  702::865     1e-05  30% 1225 aa  SMC1_YEAST RecName: Full=Structural maintenance of chromosomes
  921::1087    1e-05  20% 1935 aa  MYSS_CYPCA RecName: Full=Myosin heavy chain, fast skeletal muscle;
  874::1024    1e-05  20% 1969 aa  MYO3_CAEEL RecName: Full=Myosin-3;AltName: Full=Myosin heavy chain A;
 1752::1849    1e-05  36% 1961 aa  MYH9_RAT RecName: Full=Myosin-9;AltName: Full=Myosin heavy chain
 1751::1848    1e-05  36% 1960 aa  MYH9_MOUSE RecName: Full=Myosin-9;AltName: Full=Myosin heavy chain
  442::627     1e-05  24% 1713 aa  MRCKB_MOUSE RecName: Full=Serine/threonine-protein kinase MRCK
   97::223     1e-05  28%  444 aa  GFAP_DANRE RecName: Full=Glial fibrillary acidic protein;       
   18::145     1e-05  28%  365 aa  GFAP_CARAU RecName: Full=Glial fibrillary acidic protein;Flags:
  143::310     1e-05  27%  700 aa  EFG_ACIAC RecName: Full=Elongation factor G;         Short=EF-G;
  155::329     1e-05  28% 1411 aa  EEA1_HUMAN RecName: Full=Early endosome antigen 1;AltName:
  751::876     1e-05  32% 2058 aa  DAPLE_XENLA RecName: Full=Daple-like protein;AltName:
 1057::1187    1e-05  35% 2479 aa  CE290_HUMAN RecName: Full=Centrosomal protein of 290 kDa;       
  143::346     1e-05  26%  680 aa  CACO1_BOVIN RecName: Full=Calcium-binding and coiled-coil
  864::1089    1e-05  22% 2022 aa  ANT1_ONCVO RecName: Full=Major antigen;AltName: Full=Myosin-like
  228::448     1e-05  32%  660 aa  YNP9_CAEEL RecName: Full=GRIP and coiled-coil domain-containing
  120::236     1e-05  28%  466 aa  VIME_RAT RecName: Full=Vimentin;
  120::236     1e-05  28%  466 aa  VIME_MOUSE RecName: Full=Vimentin;
  119::235     1e-05  28%  465 aa  VIME_MESAU RecName: Full=Vimentin;
  102::218     1e-05  28%  448 aa  VIME_CRIGR RecName: Full=Vimentin;Flags: Fragment;
  120::236     1e-05  28%  466 aa  VIME_BOVIN RecName: Full=Vimentin;
  922::1125    1e-05  20% 2291 aa  SPTCB_DROME RecName: Full=Spectrin beta chain;
 1475::1692    1e-05  22% 2035 aa  NIN_MOUSE RecName: Full=Ninein;
 1483::1617    1e-05  32% 2057 aa  MYSN_DROME RecName: Full=Myosin heavy chain, non-muscle;AltName:
   36::209     1e-05  27% 1102 aa  MYSC_CHICK RecName: Full=Myosin heavy chain, cardiac muscle
 1167::1319    1e-05  31% 1947 aa  MYO2_CAEEL RecName: Full=Myosin-2;AltName: Full=Myosin heavy chain C;
 1712::1874    1e-05  25% 1938 aa  MYH6_RAT RecName: Full=Myosin-6;AltName: Full=Myosin heavy chain
  227::441     1e-05  24% 1202 aa  LIPA1_HUMAN RecName: Full=Liprin-alpha-1;AltName: Full=Protein
  170::304     1e-05  27%  623 aa  K1C9_HUMAN RecName: Full=Keratin, type I cytoskeletal 9;AltName:
  330::534     1e-05  29%  718 aa  HOOK3_MOUSE RecName: Full=Protein Hook homolog 3;       
  330::534     1e-05  30%  718 aa  HOOK3_HUMAN RecName: Full=Protein Hook homolog 3;       
  472::600     1e-05  30% 1805 aa  HMW2_MYCGE RecName: Full=Cytadherence high molecular weight protein
  380::514     1e-05  28% 1037 aa  HIP1_HUMAN RecName: Full=Huntingtin-interacting protein 1;       
  192::518     1e-05  26% 1871 aa  GRDN_HUMAN RecName: Full=Girdin;AltName: Full=Girders of actin
   77::214     1e-05  26% 1505 aa  GPTC8_MOUSE RecName: Full=G patch domain-containing protein 8;
   77::214     1e-05  26% 1502 aa  GPTC8_HUMAN RecName: Full=G patch domain-containing protein 8;
  323::586     1e-05  22% 1140 aa  CP135_HUMAN RecName: Full=Centrosomal protein of 135 kDa;       
   39::176     1e-05  27%  525 aa  CNPD_CHLPD RecName: Full=2',3'-cyclic-nucleotide
   42::132     1e-05  31%  375 aa  CASC4_CHICK RecName: Full=Protein CASC4;AltName: Full=Cancer
  541::636     2e-05  31%  825 aa  WAP_ARATH RecName: Full=WPP domain-associated protein;
  224::465     2e-05  26%  789 aa  TAXB1_HUMAN RecName: Full=Tax1-binding protein 1;AltName:
  116::235     2e-05  25%  236 aa  SYCP3_MACFA RecName: Full=Synaptonemal complex protein 3;       
  446::603     2e-05  26% 1388 aa  ROCK2_MOUSE RecName: Full=Rho-associated protein kinase 2;       
  105::218     2e-05  31%  342 aa  NDE1_CHICK RecName: Full=Nuclear distribution protein nudE homolog
   23::211     2e-05  25%  257 aa  MYH8_RAT RecName: Full=Myosin-8;AltName: Full=Myosin heavy chain
 1711::1873    2e-05  25% 1935 aa  MYH7_PIG RecName: Full=Myosin-7;AltName: Full=Myosin heavy chain
 1711::1873    2e-05  25% 1935 aa  MYH7_BOVIN RecName: Full=Myosin-7;AltName: Full=Myosin heavy chain
 1713::1875    2e-05  25% 1939 aa  MYH6_HUMAN RecName: Full=Myosin-6;AltName: Full=Myosin heavy chain
  505::630     2e-05  27% 1719 aa  MRCKA_MOUSE RecName: Full=Serine/threonine-protein kinase MRCK
  141::256     2e-05  30%  969 aa  LIPB1_MOUSE RecName: Full=Liprin-beta-1;AltName: Full=Protein
  694::920     2e-05  27%  975 aa  KINH_DROME RecName: Full=Kinesin heavy chain;
  283::444     2e-05  24%  618 aa  K1C9_RAT RecName: Full=Keratin, type I cytoskeletal 9;AltName:
  107::266     2e-05  26%  788 aa  GRIP_ARATH RecName: Full=Protein GRIP;         Short=AtGRIP;
  242::387     2e-05  33%  758 aa  GOGA1_MOUSE RecName: Full=Golgin subfamily A member 1;AltName:
  288::403     2e-05  28% 1131 aa  FIL1L_MOUSE RecName: Full=Filamin A-interacting protein
  363::672     2e-05  26%  794 aa  EVI5L_HUMAN RecName: Full=EVI5-like protein;AltName: Full=Ecotropic
 1292::1418    2e-05  27% 2871 aa  DESP_HUMAN RecName: Full=Desmoplakin;         Short=DP;AltName:
  634::819     2e-05  23% 1113 aa  CD158_HUMAN RecName: Full=Coiled-coil domain-containing protein
  149::321     2e-05  31%  770 aa  CCHCR_MOUSE RecName: Full=Coiled-coil alpha-helical rod protein
  347::492     2e-05  26%  692 aa  CCD41_RAT RecName: Full=Coiled-coil domain-containing protein 41;
  330::460     3e-05  26%  478 aa  YOND_BACSU RecName: Full=SPBc2 prophage-derived uncharacterized
  116::239     3e-05  27%  461 aa  VIME_ONCMY RecName: Full=Vimentin;
  295::425     3e-05  29% 1186 aa  SMC_BACSU RecName: Full=Chromosome partition protein smc;
  157::342     3e-05  23% 1203 aa  SMC2_XENLA RecName: Full=Structural maintenance of chromosomes
  524::716     3e-05  27%  717 aa  SKI_XENLA RecName: Full=Ski oncogene;AltName: Full=C-ski;
  339::460     3e-05  25% 1130 aa  SBCC_BACSU RecName: Full=Nuclease sbcCD subunit C;
  432::592     3e-05  24% 1116 aa  RB6I2_HUMAN RecName: Full=ELKS/RAB6-interacting/CAST family member
   93::213     3e-05  31%  453 aa  PLST_CARAU RecName: Full=Plasticin;
  276::465     3e-05  26%  556 aa  OPTN_CHICK RecName: Full=Optineurin;AltName: Full=Ag9-C5;AltName:
  597::772     3e-05  29%  864 aa  MYSP_MYTGA RecName: Full=Paramyosin;
  342::435     3e-05  27%  882 aa  MYSP_CAEEL RecName: Full=Paramyosin;AltName: Full=Uncoordinated
 1713::1875    3e-05  24% 1938 aa  MYH6_MOUSE RecName: Full=Myosin-6;AltName: Full=Myosin heavy chain
 1522::1660    3e-05  24% 2050 aa  MY18A_MOUSE RecName: Full=Myosin-XVIIIa;AltName: Full=Myosin
  442::629     3e-05  23% 1713 aa  MRCKB_RAT RecName: Full=Serine/threonine-protein kinase MRCK beta; 
  399::749     3e-05  23%  935 aa  KINH_SYNRA RecName: Full=Kinesin heavy chain;AltName: Full=Synkin;
  382::543     3e-05  23%  907 aa  EP15R_MOUSE RecName: Full=Epidermal growth factor receptor
  155::387     3e-05  26% 1411 aa  EEA1_MOUSE RecName: Full=Early endosome antigen 1;
  173::265     3e-05  30% 1273 aa  CUT_CAEEL RecName: Full=Homeobox protein cut-like ceh-44;       
  803::1121    3e-05  23% 1298 aa  CGNL1_MOUSE RecName: Full=Cingulin-like protein 1;AltName:
  183::305     3e-05  28%  692 aa  CCD41_MOUSE RecName: Full=Coiled-coil domain-containing protein 41;
  229::348     3e-05  24% 1454 aa  CCD18_HUMAN RecName: Full=Coiled-coil domain-containing protein
  159::299     3e-05  29%  621 aa  CC151_BOVIN RecName: Full=Coiled-coil domain-containing protein
  173::265     3e-05  30%  621 aa  CASP_CAEEL RecName: Full=Protein CASP;
  659::814     3e-05  22% 1162 aa  ATG11_PICST RecName: Full=Autophagy-related protein 11;
   57::178     3e-05  29%  401 aa  Y1002_CHLCV RecName: Full=UPF0242 protein CCA_01002;
  120::236     3e-05  28%  466 aa  VIME_PANTR RecName: Full=Vimentin;
  120::236     3e-05  28%  466 aa  VIME_MACFA RecName: Full=Vimentin;
  120::236     3e-05  28%  466 aa  VIME_HUMAN RecName: Full=Vimentin;
  120::236     3e-05  28%  466 aa  VIME_CERAE RecName: Full=Vimentin;
  771::848     3e-05  29% 1191 aa  SMC2_MOUSE RecName: Full=Structural maintenance of chromosomes
  289::489     3e-05  24%  584 aa  OPTN_MOUSE RecName: Full=Optineurin;
  236::480     3e-05  23%  517 aa  OPTN_DANRE RecName: Full=Optineurin;
   17::123     3e-05  24%  346 aa  NDE1_HUMAN RecName: Full=Nuclear distribution protein nudE homolog
 1144::1272    3e-05  25% 1742 aa  MYO5C_HUMAN RecName: Full=Myosin-Vc;
 1751::1848    3e-05  37% 1960 aa  MYH9_HUMAN RecName: Full=Myosin-9;AltName: Full=Myosin heavy chain
 1751::1848    3e-05  37% 1960 aa  MYH9_CANFA RecName: Full=Myosin-9;AltName: Full=Myosin heavy chain
 1402::1522    3e-05  30% 1938 aa  MYH13_HUMAN RecName: Full=Myosin-13;AltName: Full=Myosin heavy chain
  383::559     3e-05  22%  864 aa  EP15R_HUMAN RecName: Full=Epidermal growth factor receptor
  181::396     3e-05  27%  898 aa  DZIP1_DANRE RecName: Full=Zinc finger protein Dzip1;AltName:
  497::568     3e-05  26% 1272 aa  DIAP1_HUMAN RecName: Full=Protein diaphanous homolog 1;AltName:
  278::491     3e-05  23% 1109 aa  CD158_MOUSE RecName: Full=Coiled-coil domain-containing protein
  116::235     4e-05  24%  236 aa  SYCP3_HUMAN RecName: Full=Synaptonemal complex protein 3;       
 1379::1515    4e-05  28% 1938 aa  MYS_AEQIR RecName: Full=Myosin heavy chain, striated muscle;
 1711::1792    4e-05  24% 1935 aa  MYH7_HORSE RecName: Full=Myosin-7;AltName: Full=Myosin heavy chain
 1713::1875    4e-05  24% 1939 aa  MYH6_MESAU RecName: Full=Myosin-6;AltName: Full=Myosin heavy chain
 1715::1885    4e-05  25% 1940 aa  MYH13_CANFA RecName: Full=Myosin-13;AltName: Full=Myosin heavy chain
 1433::1668    4e-05  25% 2054 aa  MY18A_HUMAN RecName: Full=Myosin-XVIIIa;AltName: Full=Myosin
  333::442     4e-05  33%  572 aa  MOES_LYTVA RecName: Full=Moesin;
  664::812     4e-05  26% 1679 aa  MLP2_YEAST RecName: Full=Protein MLP2;AltName: Full=Myosin-like
  442::603     4e-05  24%  726 aa  MFP1_ARATH RecName: Full=MAR-binding filament-like protein 1;
  397::524     4e-05  28% 1026 aa  LRCC1_MOUSE RecName: Full=Leucine-rich repeat and coiled-coil
  728::836     4e-05  33% 1363 aa  KIF7_DANRE RecName: Full=Kinesin-like protein kif7;AltName:
  831::999     4e-05  28% 2238 aa  GOGA4_MOUSE RecName: Full=Golgin subfamily A member 4;AltName:
  334::443     4e-05  37% 1213 aa  FLIP1_HUMAN RecName: Full=Filamin-A-interacting protein 1;       
  163::296     6e-05  25%  707 aa  SGM1_YEAST RecName: Full=Protein SGM1;AltName: Full=Slow growth on
  437::594     6e-05  26% 1379 aa  ROCK2_RAT RecName: Full=Rho-associated protein kinase 2;       
   58::198     6e-05  27%  349 aa  NDE1_XENTR RecName: Full=Nuclear distribution protein nudE homolog
  302::502     6e-05  22%  880 aa  MYSP_BRUMA RecName: Full=Paramyosin;
 1007::1166    6e-05  20% 1928 aa  MYO1_YEAST RecName: Full=Myosin-1;AltName: Full=Type II myosin;
  540::711     6e-05  26% 1270 aa  ITSN1_XENLA RecName: Full=Intersectin-1;
  390::552     6e-05  29%  729 aa  GOGA5_MOUSE RecName: Full=Golgin subfamily A member 5;AltName:
  534::768     6e-05  26% 1679 aa  GCC2_MOUSE RecName: Full=GRIP and coiled-coil domain-containing
  292::450     6e-05  31% 1583 aa  GCC2_HUMAN RecName: Full=GRIP and coiled-coil domain-containing
  438::564     6e-05  30%  585 aa  ETP1_YEAST RecName: Full=RING finger protein ETP1;AltName:
   83::239     6e-05  29%  643 aa  CTK2_XENLA RecName: Full=Carboxy-terminal kinesin 2;AltName:
  355::501     6e-05  31%  974 aa  CC146_RAT RecName: Full=Coiled-coil domain-containing protein 146;
   41::169     7e-05  22%  605 aa  SPDLY_MACFA RecName: Full=Protein Spindly;AltName: Full=Coiled-coil
 1002::1125    7e-05  26% 1605 aa  RRBP1_MOUSE RecName: Full=Ribosome-binding protein 1;AltName:
   83::230     7e-05  31%  594 aa  RMUC_NEIMA RecName: Full=DNA recombination protein rmuC homolog;
  276::441     7e-05  30%  532 aa  OPTN_XENLA RecName: Full=Optineurin;
  345::432     7e-05  26%  463 aa  NUF2_EMENI RecName: Full=Probable kinetochore protein nuf2;
  498::670     7e-05  25%  876 aa  MYSP_SARSC RecName: Full=Paramyosin;
 1686::1806    7e-05  31% 1966 aa  MYO4_CAEEL RecName: Full=Myosin-4;AltName: Full=Myosin heavy chain B;
  334::446     7e-05  24%  572 aa  MOEH_CULQU RecName: Full=Moesin/ezrin/radixin homolog 1;
   60::156     7e-05  25%  704 aa  MAD1_YARLI RecName: Full=Spindle assembly checkpoint component
  807::890     7e-05  33% 1873 aa  KIF8_DICDI RecName: Full=Kinesin-related protein 8;AltName:
  641::744     7e-05  31% 1226 aa  KIF4_XENLA RecName: Full=Chromosome-associated kinesin KIF4;       
  161::289     7e-05  26%  570 aa  K1C10_MOUSE RecName: Full=Keratin, type I cytoskeletal 10;AltName:
  332::568     7e-05  23%  685 aa  HOOK_AEDAE RecName: Full=Protein hook;
  221::415     7e-05  30% 1224 aa  DCTN1_CHICK RecName: Full=Dynactin subunit 1;AltName: Full=150 kDa
 1668::1874    7e-05  23% 2474 aa  CENPE_MOUSE RecName: Full=Centromere-associated protein E;AltName:
  112::222     7e-05  33%  359 aa  CD72_HUMAN RecName: Full=B-cell differentiation antigen
  143::265     7e-05  24%  335 aa  CCD68_HUMAN RecName: Full=Coiled-coil domain-containing protein
  212::356     7e-05  33%  640 aa  CACO1_DANRE RecName: Full=Calcium-binding and coiled-coil
 1088::1295    7e-05  27% 1709 aa  ANR26_HUMAN RecName: Full=Ankyrin repeat domain-containing protein
  104::251     1e-04  33%  470 aa  XNIF_XENLA RecName: Full=Low molecular weight neuronal intermediate
  948::1063    1e-04  22% 1979 aa  TRIPB_HUMAN RecName: Full=Thyroid receptor-interacting protein 11;   
  100::235     1e-04  28%  284 aa  TPM_MIMNO RecName: Full=Tropomyosin;
  446::603     1e-04  25% 1388 aa  ROCK2_HUMAN RecName: Full=Rho-associated protein kinase 2;       
  447::592     1e-04  25% 1022 aa  PMFBP_MOUSE RecName: Full=Polyamine-modulated factor 1-binding
  569::701     1e-04  26%  822 aa  ODFP2_CHICK RecName: Full=Outer dense fiber protein 2;AltName:
  687::784     1e-04  29% 1837 aa  NU211_SCHPO RecName: Full=Nucleoporin nup211;AltName: Full=Nuclear
  599::736     1e-04  21% 1042 aa  NMCP_ARATH RecName: Full=Putative nuclear matrix constituent
  374::480     1e-04  28%  743 aa  NDC80_NEUCR RecName: Full=Probable kinetochore protein ndc-80;
   61::195     1e-04  38%  501 aa  MYSU_RABIT RecName: Full=Myosin heavy chain, embryonic smooth
  302::502     1e-04  22%  879 aa  MYSP_ONCVO RecName: Full=Paramyosin;
 1151::1250    1e-04  31% 1388 aa  KIF15_HUMAN RecName: Full=Kinesin-like protein KIF15;AltName:
 1174::1314    1e-04  24% 1774 aa  KI20B_MOUSE RecName: Full=Kinesin-like protein KIF20B;AltName:
  275::382     1e-04  25%  441 aa  K1C15_PROAT RecName: Full=Keratin, type I cytoskeletal 15;AltName:
  334::571     1e-04  24%  691 aa  HOOK_CULQU RecName: Full=Protein hook;
  507::658     1e-04  31%  719 aa  HOOK2_HUMAN RecName: Full=Protein Hook homolog 2;       
  741::867     1e-04  23% 1133 aa  FBF1_HUMAN RecName: Full=Fas-binding factor 1;         Short=FBF-1;
  204::329     1e-04  27% 1515 aa  CUX1_MOUSE RecName: Full=Homeobox protein cut-like 1;AltName:
  289::422     1e-04  20%  779 aa  CTGE5_MOUSE RecName: Full=Cutaneous T-cell lymphoma-associated
  135::255     1e-04  32%  639 aa  CT2NL_PONAB RecName: Full=CTTNBP2 N-terminal-like protein;
  135::255     1e-04  32%  639 aa  CT2NL_HUMAN RecName: Full=CTTNBP2 N-terminal-like protein;
   50::194     1e-04  23%  287 aa  CROL2_HUMAN RecName: Full=Ciliary rootlet coiled-coil protein-like
  131::274     1e-04  27% 1405 aa  CNTLN_HUMAN RecName: Full=Centlein;AltName: Full=Centrosomal
  352::448     1e-04  32% 1190 aa  CING_CANFA RecName: Full=Cingulin;
  263::347     1e-04  34%  851 aa  YD72_SCHPO RecName: Full=Uncharacterized protein C32A11.02c;
  284::418     1e-04  25%  627 aa  WIT2_ARATH RecName: Full=WPP domain-interacting tail-anchored
  561::705     1e-04  23% 1744 aa  TANA_XENLA RecName: Full=Tanabin;
   56::161     1e-04  28%  297 aa  STX4_BOVIN RecName: Full=Syntaxin-4;
   57::185     1e-04  21%  441 aa  ROCK1_BOVIN RecName: Full=Rho-associated protein kinase 1;       
  581::698     1e-04  21%  864 aa  RAD50_SULSO RecName: Full=DNA double-strand break repair rad50
  431::623     1e-04  26%  856 aa  PLPA_MYCGA RecName: Full=Fibronectin-binding protein plpA;AltName:
 1567::1675    1e-04  30% 2090 aa  NIN_HUMAN RecName: Full=Ninein;AltName: Full=hNinein;AltName:
  381::500     1e-04  27%  638 aa  MYSP_OPIFE RecName: Full=Paramyosin;Flags: Fragment;
  275::367     1e-04  26%  848 aa  MYSP_DIRIM RecName: Full=Paramyosin;Flags: Fragment;
  518::687     1e-04  24%  875 aa  MYSP_BLOTA RecName: Full=Paramyosin;AltName: Allergen=Blo t 11;
   80::222     1e-04  26%  440 aa  MTS1A_DANRE RecName: Full=Mitochondrial tumor suppressor 1 homolog
   89::204     1e-04  25%  776 aa  MEU1_SCHPO RecName: Full=Meiotic expression up-regulated protein
  626::817     1e-04  25% 1115 aa  MBO1_SCHPO RecName: Full=Microtubule organizer protein 1;AltName:
  125::315     1e-04  27%  674 aa  KIFC1_MOUSE RecName: Full=Kinesin-like protein KIFC1;
  327::514     1e-04  29%  719 aa  HOOK3_XENLA RecName: Full=Protein Hook homolog 3;
  469::623     1e-04  24%  718 aa  HOOK1_CHICK RecName: Full=Protein Hook homolog 1;
  112::260     1e-04  23%  466 aa  GCOM1_HUMAN RecName: Full=GRINL1A complex locus protein 1;AltName:
  706::904     1e-04  22% 1173 aa  FBF1_MOUSE RecName: Full=Fas-binding factor 1;         Short=FBF-1;
  619::730     1e-04  29% 1118 aa  CYTSA_TAKRU RecName: Full=Cytospin-A;AltName: Full=SPECC1-like
  133::213     1e-04  44%  442 aa  CCD91_RAT RecName: Full=Coiled-coil domain-containing protein
  552::747     1e-04  22% 1300 aa  ATG11_NEUCR RecName: Full=Autophagy-related protein 11;
 1701::1805    2e-04  28% 2285 aa  YOMI_BACSU RecName: Full=SPBc2 prophage-derived uncharacterized
  430::535     2e-04  22%  816 aa  YG3A_YEAST RecName: Full=Uncharacterized protein YGR130C;
   41::169     2e-04  22%  605 aa  SPDLY_HUMAN RecName: Full=Protein Spindly;AltName:
   18::126     2e-04  27%  239 aa  SPC25_CANAL RecName: Full=Probable kinetochore protein SPC25;
  446::603     2e-04  25% 1388 aa  ROCK2_BOVIN RecName: Full=Rho-associated protein kinase 2;       
   83::230     2e-04  31%  594 aa  RMUC_NEIMB RecName: Full=DNA recombination protein rmuC homolog;
  353::432     2e-04  28%  463 aa  NUF2_ASPFU RecName: Full=Probable kinetochore protein nuf2;
   64::183     2e-04  28%  412 aa  NEMO_RAT RecName: Full=NF-kappa-B essential modulator;       
  102::225     2e-04  30%  344 aa  NDE1_RAT RecName: Full=Nuclear distribution protein nudE homolog 1;
  915::1055    2e-04  32% 1084 aa  MYSS_RABIT RecName: Full=Myosin heavy chain, skeletal muscle;Flags:
  351::489     2e-04  27%  873 aa  MYSP_BOOMI RecName: Full=Paramyosin;
  685::821     2e-04  23% 1244 aa  MIX1_CAEEL RecName: Full=Mitotic chromosome and
  305::433     2e-04  26%  670 aa  LRC45_MOUSE RecName: Full=Leucine-rich repeat-containing protein
  465::762     2e-04  25%  963 aa  KINH_RAT RecName: Full=Kinesin-1 heavy chain;AltName:
  551::704     2e-04  25% 1225 aa  KIF4_CHICK RecName: Full=Chromosome-associated kinesin KIF4;       
 1262::1366    2e-04  28% 1820 aa  KI20B_HUMAN RecName: Full=Kinesin-like protein KIF20B;AltName:
  305::424     2e-04  20%  786 aa  K1C9_CANFA RecName: Full=Keratin, type I cytoskeletal 9;AltName:
  153::281     2e-04  25%  568 aa  K1C10_CANFA RecName: Full=Keratin, type I cytoskeletal 10;AltName:
   43::196     2e-04  19%  589 aa  IFEB_ASCSU RecName: Full=Intermediate filament protein B;       
  484::607     2e-04  23%  724 aa  HMMR_HUMAN RecName: Full=Hyaluronan mediated motility
  108::344     2e-04  27%  478 aa  GAS8_BOVIN RecName: Full=Growth arrest-specific protein 8;       
   88::204     2e-04  30%  330 aa  FIP37_ARATH RecName: Full=FKBP12-interacting protein of 37 kDa;    
 1053::1228    2e-04  23% 1455 aa  CCD18_MOUSE RecName: Full=Coiled-coil domain-containing protein 18;
  111::229     2e-04  26%  264 aa  APOA1_COTJA RecName: Full=Apolipoprotein A-I;         Short=Apo-AI;
   10::85      2e-04  32%   94 aa  Y451_HELPY RecName: Full=Putative uncharacterized protein HP_0451;
  105::229     2e-04  25%  450 aa  VIMB_CARAU RecName: Full=Vimentin beta;
   72::202     2e-04  34%  845 aa  SYCP1_MESAU RecName: Full=Synaptonemal complex protein 1;       
  139::229     2e-04  33%  770 aa  STAT3_RAT RecName: Full=Signal transducer and activator of
  139::229     2e-04  33%  770 aa  STAT3_PIG RecName: Full=Signal transducer and activator of
  139::229     2e-04  33%  770 aa  STAT3_MOUSE RecName: Full=Signal transducer and activator of
  139::229     2e-04  33%  770 aa  STAT3_HUMAN RecName: Full=Signal transducer and activator of
  395::523     2e-04  26%  606 aa  RUFY2_PONAB RecName: Full=RUN and FYVE domain-containing protein 2;
  444::572     2e-04  26%  655 aa  RUFY2_HUMAN RecName: Full=RUN and FYVE domain-containing protein
   76::229     2e-04  31%  757 aa  PIBF1_HUMAN RecName: Full=Progesterone-induced-blocking factor 1;
  654::777     2e-04  26% 1249 aa  PHLB2_MOUSE RecName: Full=Pleckstrin homology-like domain family B
  601::753     2e-04  32% 1253 aa  PHLB2_HUMAN RecName: Full=Pleckstrin homology-like domain family B
  639::783     2e-04  28%  825 aa  ODFP2_RAT RecName: Full=Outer dense fiber protein 2;AltName:
  425::552     2e-04  26%  642 aa  ODF2L_MOUSE RecName: Full=Outer dense fiber protein 2-like;
   18::124     2e-04  25%  345 aa  NDL1A_XENLA RecName: Full=Nuclear distribution protein nudE-like
  144::213     2e-04  29%  539 aa  MYS3_HYDAT RecName: Full=Myosin heavy chain, clone 203;Flags:
 1489::1616    2e-04  32% 1827 aa  LAMB4_DANRE RecName: Full=Laminin subunit beta-4;Flags: Precursor;
 1082::1326    2e-04  25% 1364 aa  KTN1_CHICK RecName: Full=Kinectin;
  695::899     2e-04  24%  956 aa  KIF5C_MOUSE RecName: Full=Kinesin heavy chain isoform 5C;AltName:
  639::753     2e-04  25% 1231 aa  KIF4_MOUSE RecName: Full=Chromosome-associated kinesin KIF4;       
  694::868     2e-04  29% 1394 aa  KIF27_MOUSE RecName: Full=Kinesin-like protein KIF27;
   91::275     2e-04  29%  429 aa  K1C20_RAT RecName: Full=Keratin, type I cytoskeletal 20;AltName:
  144::279     2e-04  24%  526 aa  K1C10_BOVIN RecName: Full=Keratin, type I cytoskeletal 10;AltName:
  234::418     2e-04  29% 1060 aa  F184B_HUMAN RecName: Full=Protein FAM184B;
  143::296     2e-04  27%  698 aa  EFG_AZOSB RecName: Full=Elongation factor G;         Short=EF-G;
  280::419     2e-04  24% 1265 aa  DCTN1_DROME RecName: Full=Dynactin subunit 1;AltName: Full=150 kDa
   32::134     2e-04  26%  514 aa  CNPD_ARCB4 RecName: Full=2',3'-cyclic-nucleotide
  836::942     2e-04  32% 1391 aa  CLIP1_MOUSE RecName: Full=CAP-Gly domain-containing linker protein
  995::1140    2e-04  26% 1338 aa  CENPJ_PANTR RecName: Full=Centromere protein J;         Short=CENP-J;
 2662::2779    2e-04  23% 3210 aa  CENPF_HUMAN RecName: Full=Centromere protein F;AltName:
  820::927     2e-04  24% 2701 aa  CENPE_HUMAN RecName: Full=Centromere-associated protein E;AltName:
  382::496     2e-04  28% 1468 aa  CE290_BOVIN RecName: Full=Centrosomal protein of 290 kDa;       
  283::444     2e-04  28%  801 aa  CCPG1_CHICK RecName: Full=Cell cycle progression protein 1;
  478::592     2e-04  31%  872 aa  CC147_HUMAN RecName: Full=Coiled-coil domain-containing protein
  143::350     2e-04  26%  691 aa  CACO1_RAT RecName: Full=Calcium-binding and coiled-coil
  561::667     2e-04  32%  908 aa  C3H41_ARATH RecName: Full=Zinc finger CCCH domain-containing
  211::308     2e-04  24%  643 aa  BRE1_ASHGO RecName: Full=E3 ubiquitin-protein ligase BRE1;       
   83::192     2e-04  22%  622 aa  ATG16_XENTR RecName: Full=Autophagy-related protein 16;AltName:
  457::574     3e-04  25%  590 aa  YQOE_CAEEL RecName: Full=Uncharacterized RING finger protein
 1043::1209    3e-04  24% 1700 aa  Y4A0_ENCCU RecName: Full=Probable myosin havy chain ECU04_1000;
  325::425     3e-04  29%  473 aa  TIG_PROM5 RecName: Full=Trigger factor;         Short=TF;
  345::474     3e-04  28%  813 aa  TAXB1_RAT RecName: Full=Tax1-binding protein 1 homolog;AltName:
 1173::1284    3e-04  22% 1343 aa  SYGP1_HUMAN RecName: Full=Ras GTPase-activating protein
  219::349     3e-04  30%  976 aa  SYCP1_HUMAN RecName: Full=Synaptonemal complex protein 1;       
  139::229     3e-04  33%  771 aa  STAT3_CHICK RecName: Full=Signal transducer and activator of
  751::885     3e-04  28% 1097 aa  SMC6_MOUSE RecName: Full=Structural maintenance of chromosomes
  437::619     3e-04  24%  828 aa  SLMAP_HUMAN RecName: Full=Sarcolemmal membrane-associated protein; 
  721::863     3e-04  25% 1403 aa  QN1_HUMAN RecName: Full=Protein QN1 homolog;
  272::490     3e-04  21%  585 aa  OPTN_RAT RecName: Full=Optineurin;AltName: Full=FIP-2-like protein;
  644::788     3e-04  29%  830 aa  ODFP2_MOUSE RecName: Full=Outer dense fiber protein 2;AltName:
   66::198     3e-04  26%  419 aa  NEMO_BOVIN RecName: Full=NF-kappa-B essential modulator;       
   18::124     3e-04  25%  346 aa  NDEL1_XENTR RecName: Full=Nuclear distribution protein nudE-like 1;
 1704::1892    3e-04  25% 1939 aa  MYH2_PIG RecName: Full=Myosin-2;AltName: Full=Myosin heavy chain
 1531::1670    3e-04  33% 1976 aa  MYH10_RAT RecName: Full=Myosin-10;AltName: Full=Myosin heavy chain
 1531::1670    3e-04  33% 1976 aa  MYH10_MOUSE RecName: Full=Myosin-10;AltName: Full=Myosin heavy chain
 1565::1758    3e-04  23% 2205 aa  KIF1_DICDI RecName: Full=Kinesin-related protein 1;AltName:
  383::506     3e-04  26%  837 aa  GRAP1_RAT RecName: Full=GRIP1-associated protein 1;       
  961::1081    3e-04  31% 1385 aa  FAT1_SCHPO RecName: Full=Actin-interacting protein 3 homolog;
  416::569     3e-04  31%  674 aa  DIXC1_RAT RecName: Full=Dixin;AltName: Full=DIX domain-containing
  186::379     3e-04  28% 1232 aa  DCTN1_XENLA RecName: Full=Dynactin subunit 1;
  175::316     3e-04  21% 1664 aa  CTTB2_RABIT RecName: Full=Cortactin-binding protein 2;       
  405::522     3e-04  25%  856 aa  CLPB_HELPY RecName: Full=Chaperone protein clpB;
   68::183     3e-04  32%  541 aa  CEP63_PONAB RecName: Full=Centrosomal protein of 63 kDa;       
   68::183     3e-04  32%  703 aa  CEP63_MACFA RecName: Full=Centrosomal protein of 63 kDa;       
   68::183     3e-04  32%  703 aa  CEP63_HUMAN RecName: Full=Centrosomal protein of 63 kDa;       
  202::369     3e-04  26%  943 aa  CENPC_HUMAN RecName: Full=Centromere protein C 1;       
   39::216     3e-04  28%  305 aa  CCD69_XENTR RecName: Full=Coiled-coil domain-containing protein 69;
  131::259     3e-04  31%  450 aa  CACO2_BOVIN RecName: Full=Calcium-binding and coiled-coil
   27::154     3e-04  25%  470 aa  BFR1_YEAST RecName: Full=Nuclear segregation protein BFR1;AltName:
 2032::2160    3e-04  24% 3911 aa  AKAP9_HUMAN RecName: Full=A-kinase anchor protein 9;       
 1178::1287    3e-04  30% 1395 aa  AGLZ_MYXXD RecName: Full=Adventurous-gliding motility protein Z;
  608::715     4e-04  31%  875 aa  ZIP1_YEAST RecName: Full=Synaptonemal complex protein ZIP1;
  811::903     4e-04  31% 1979 aa  YB145_PLAF7 RecName: Full=Uncharacterized protein PFB0145c;
  256::437     4e-04  28%  549 aa  YA046_HUMAN RecName: Full=Uncharacterized protein ENSP00000361571;
  114::236     4e-04  25%  460 aa  VIME_CHICK RecName: Full=Vimentin;
  658::752     4e-04  28% 1416 aa  UACA_HUMAN RecName: Full=Uveal autoantigen with coiled-coil domains
  200::281     4e-04  26%  299 aa  TNNT2_RAT RecName: Full=Troponin T, cardiac muscle;       
   84::234     4e-04  34%  316 aa  T4AF1_HUMAN RecName: Full=Putative TRAF4-associated factor 1;
  216::353     4e-04  30%  993 aa  SYCP1_MOUSE RecName: Full=Synaptonemal complex protein 1;       
  410::508     4e-04  25%  635 aa  RFIP4_MOUSE RecName: Full=Rab11 family-interacting protein 4;      
  430::658     4e-04  21%  896 aa  RAD50_THEAC RecName: Full=DNA double-strand break repair rad50
  853::953     4e-04  28% 1316 aa  RAD50_ARATH RecName: Full=DNA repair protein RAD50;       
 1576::1742    4e-04  27% 1955 aa  PUMA_PARUN RecName: Full=227 kDa spindle- and centromere-associated
   10::61      4e-04  37%  160 aa  PFDA_IGNH4 RecName: Full=Prefoldin subunit alpha;AltName: Full=GimC
  963::1179    4e-04  23% 1855 aa  MYO5A_HUMAN RecName: Full=Myosin-Va;AltName: Full=Dilute myosin heavy
 1531::1670    4e-04  33% 1976 aa  MYH10_HUMAN RecName: Full=Myosin-10;AltName: Full=Myosin heavy chain
 1531::1670    4e-04  33% 1976 aa  MYH10_BOVIN RecName: Full=Myosin-10;AltName: Full=Myosin heavy chain
  341::528     4e-04  27%  717 aa  MD1L1_MOUSE RecName: Full=Mitotic spindle assembly checkpoint
  924::1105    4e-04  28% 1463 aa  KIF15_STRPU RecName: Full=Kinesin-like protein KIF15;AltName:
  657::765     4e-04  25% 1674 aa  KI21A_HUMAN RecName: Full=Kinesin-like protein KIF21A;AltName:
  349::479     4e-04  26%  990 aa  GOGA2_HUMAN RecName: Full=Golgin subfamily A member 2;AltName:
  510::651     4e-04  21%  810 aa  EVI5_HUMAN RecName: Full=Ecotropic viral integration site 5 protein
  738::864     4e-04  25% 1251 aa  CING_XENTR RecName: Full=Cingulin;
  849::974     4e-04  25% 1360 aa  CING_XENLA RecName: Full=Cingulin;
   17::178     4e-04  28%  542 aa  CI117_RAT RecName: Full=Uncharacterized protein C9orf117 homolog;
  252::453     4e-04  27%  955 aa  CC146_HUMAN RecName: Full=Coiled-coil domain-containing protein
  324::431     4e-04  30% 1004 aa  CAR14_HUMAN RecName: Full=Caspase recruitment domain-containing
 1370::1566    4e-04  32% 2611 aa  BPAEA_MOUSE RecName: Full=Bullous pemphigoid antigen 1, isoform 5;   
  105::241     5e-04  29%  266 aa  ZWINT_RAT RecName: Full=ZW10 interactor;AltName:
   89::225     5e-04  31%  252 aa  ZWINT_MOUSE RecName: Full=ZW10 interactor;AltName:
  657::766     5e-04  27%  937 aa  YM92_CAEEL RecName: Full=Uncharacterized protein M01A8.2;
  412::582     5e-04  19%  782 aa  YL139_YARLI RecName: Full=Uncharacterized protein YALI0A18139g;
  291::417     5e-04  37%  550 aa  YA046_MOUSE RecName: Full=Uncharacterized protein ENSP00000361571
   97::207     5e-04  29%  463 aa  VIM4_XENLA RecName: Full=Vimentin-4;
   26::106     5e-04  27%  428 aa  SYS_SYNE7 RecName: Full=Seryl-tRNA synthetase;       
   31::106     5e-04  38%  421 aa  SYS_DESHY RecName: Full=Seryl-tRNA synthetase;       
 1393::1489    5e-04  32% 1500 aa  SYCP2_MOUSE RecName: Full=Synaptonemal complex protein 2;       
    2::134     5e-04  28%  197 aa  SPC24_HUMAN RecName: Full=Kinetochore protein Spc24;       
   80::239     5e-04  24%  447 aa  SHE9_ASHGO RecName: Full=Sensitive to high expression protein 9
  334::432     5e-04  34% 1857 aa  RIMB1_HUMAN RecName: Full=Peripheral-type benzodiazepine
  125::253     5e-04  29%  858 aa  RHG17_RAT RecName: Full=Rho GTPase-activating protein 17;AltName:
  125::253     5e-04  29%  846 aa  RHG17_MOUSE RecName: Full=Rho GTPase-activating protein 17;AltName:
   30::155     5e-04  27%  516 aa  P54_ENTFC RecName: Full=Protein P54;Flags: Precursor;
  644::803     5e-04  22%  829 aa  ODFP2_HUMAN RecName: Full=Outer dense fiber protein 2;AltName:
  118::246     5e-04  28%  455 aa  NFM_PIG RecName: Full=Neurofilament medium polypeptide;       
  117::245     5e-04  28%  916 aa  NFM_HUMAN RecName: Full=Neurofilament medium polypeptide;       
   19::130     5e-04  29%  317 aa  NDE1_DROME RecName: Full=Nuclear distribution protein nudE homolog;
 1706::1894    5e-04  25% 1941 aa  MYH2_HUMAN RecName: Full=Myosin-2;AltName: Full=Myosin heavy chain
 1702::1890    5e-04  24% 1937 aa  MYH2_HORSE RecName: Full=Myosin-2;AltName: Full=Myosin heavy chain
  904::1038    5e-04  29% 1210 aa  MTUS1_MOUSE RecName: Full=Mitochondrial tumor suppressor 1
  246::385     5e-04  30%  857 aa  MEDB_GIALA RecName: Full=Median body protein;
  188::300     5e-04  27%  670 aa  LCA5L_PAPAN RecName: Full=Lebercilin-like protein;AltName:
  232::354     5e-04  25%  763 aa  KLPA_EMENI RecName: Full=Kinesin-like protein klpA;
  156::290     5e-04  24%  526 aa  K1C10_RAT RecName: Full=Keratin, type I cytoskeletal 10;AltName:
  275::403     5e-04  23%  723 aa  HOOK_BRAFL RecName: Full=Protein Hook homolog;
  155::345     5e-04  25%  478 aa  GAS8_RAT RecName: Full=Growth arrest-specific protein 8;       
  353::485     5e-04  25%  564 aa  EZRA_BACLD RecName: Full=Septation ring formation regulator ezrA;
  154::294     5e-04  25%  702 aa  EFG_YERPY RecName: Full=Elongation factor G;         Short=EF-G;
  154::294     5e-04  25%  702 aa  EFG_YERPS RecName: Full=Elongation factor G;         Short=EF-G;
  154::294     5e-04  25%  702 aa  EFG_YERPP RecName: Full=Elongation factor G;         Short=EF-G;
  154::294     5e-04  25%  702 aa  EFG_YERPN RecName: Full=Elongation factor G;         Short=EF-G;
  154::294     5e-04  25%  702 aa  EFG_YERPG RecName: Full=Elongation factor G;         Short=EF-G;
  154::294     5e-04  25%  702 aa  EFG_YERPE RecName: Full=Elongation factor G;         Short=EF-G;
  154::294     5e-04  25%  702 aa  EFG_YERPB RecName: Full=Elongation factor G;         Short=EF-G;
  154::294     5e-04  25%  702 aa  EFG_YERPA RecName: Full=Elongation factor G;         Short=EF-G;
  154::294     5e-04  25%  702 aa  EFG_YERP3 RecName: Full=Elongation factor G;         Short=EF-G;
  449::545     5e-04  25%  596 aa  DEFI6_XENLA RecName: Full=Differentially expressed in FDCP 6
  164::265     5e-04  28%  473 aa  CWLO_BACSU RecName: Full=Peptidoglycan DL-endopeptidase cwlO;      
  934::1118    5e-04  28% 1164 aa  CP135_DANRE RecName: Full=Centrosomal protein of 135 kDa;       
 1337::1632    5e-04  23% 1893 aa  CK5P2_HUMAN RecName: Full=CDK5 regulatory subunit-associated protein
  255::406     5e-04  30%  610 aa  CCD93_XENTR RecName: Full=Coiled-coil domain-containing protein 93;
   81::173     5e-04  29%  192 aa  ATPF_DESDG RecName: Full=ATP synthase subunit b;AltName: Full=ATP
  105::228     6e-04  22%  578 aa  YDEM_CAEEL RecName: Full=Uncharacterized WD repeat-containing
  149::323     6e-04  25%  401 aa  YBAC_SCHPO RecName: Full=GRIP domain-containing protein C119.12;
  476::602     6e-04  26% 1050 aa  Y4862_ARATH RecName: Full=Uncharacterized protein At4g38062;
  369::537     6e-04  25% 1481 aa  Y147_TNAVC RecName: Full=Leucine-rich repeat structural protein
   96::206     6e-04  28%  458 aa  VIM1_XENLA RecName: Full=Vimentin-1/2;
  555::846     6e-04  28% 1401 aa  UACA_BOVIN RecName: Full=Uveal autoantigen with coiled-coil domains
  489::631     6e-04  27% 1091 aa  TMF1_MOUSE RecName: Full=TATA element modulatory factor;       
  224::474     6e-04  27%  817 aa  TAXB1_BOVIN RecName: Full=Tax1-binding protein 1 homolog;
  586::765     6e-04  21% 1354 aa  ROCK1_RABIT RecName: Full=Rho-associated protein kinase 1;       
 1088::1213    6e-04  26% 1588 aa  RBCC1_MOUSE RecName: Full=RB1-inducible coiled-coil protein
  115::243     6e-04  28%  848 aa  NFM_MOUSE RecName: Full=Neurofilament medium polypeptide;       
  117::245     6e-04  28%  926 aa  NFM_BOVIN RecName: Full=Neurofilament medium polypeptide;       
   59::219     6e-04  27%  349 aa  NDE1B_XENLA RecName: Full=Nuclear distribution protein nudE homolog
  477::639     6e-04  22%  660 aa  NDC80_ASHGO RecName: Full=Probable kinetochore protein NDC80;
  296::387     6e-04  23%  869 aa  MYSP_ANISI RecName: Full=Paramyosin;AltName: Allergen=Ani s 2;
  898::993     6e-04  27% 1962 aa  MYSA_DROME RecName: Full=Myosin heavy chain, muscle;
 1705::1893    6e-04  25% 1940 aa  MYH2_CANFA RecName: Full=Myosin-2;AltName: Full=Myosin heavy chain
 1754::1910    6e-04  30% 1972 aa  MYH11_MOUSE RecName: Full=Myosin-11;AltName: Full=Myosin heavy chain
  383::596     6e-04  27%  711 aa  MIP1_ARATH RecName: Full=MND1-interacting protein 1;       
   29::143     6e-04  18%  669 aa  MAD1_DEBHA RecName: Full=Spindle assembly checkpoint component
  102::231     6e-04  33%  457 aa  K2C7_RAT RecName: Full=Keratin, type II cytoskeletal 7;AltName:
  102::231     6e-04  33%  457 aa  K2C7_MOUSE RecName: Full=Keratin, type II cytoskeletal 7;AltName:
   93::290     6e-04  31%  431 aa  K1C20_MOUSE RecName: Full=Keratin, type I cytoskeletal 20;AltName:
  340::481     6e-04  34%  679 aa  HOOK_DROMO RecName: Full=Protein hook;
  371::495     6e-04  34%  570 aa  HAUS3_MOUSE RecName: Full=HAUS augmin-like complex subunit 3;
  134::238     6e-04  20%  632 aa  GG8L1_HUMAN RecName: Full=Golgin subfamily A member 8-like protein
  787::949     6e-04  24% 1132 aa  FBF1_CHICK RecName: Full=Fas-binding factor 1 homolog;       
  626::793     6e-04  29% 1381 aa  EDE1_YEAST RecName: Full=EH domain-containing and endocytosis
  767::839     6e-04  36% 2027 aa  CTRO_HUMAN RecName: Full=Citron Rho-interacting kinase;       
   15::158     6e-04  28%  521 aa  CNPD_PELPD RecName: Full=2',3'-cyclic-nucleotide
   67::169     6e-04  28%  522 aa  CNPD_NITSB RecName: Full=2',3'-cyclic-nucleotide
   38::175     6e-04  24%  524 aa  CNPD_CHLTE RecName: Full=2',3'-cyclic-nucleotide
  815::968     6e-04  22% 1191 aa  CING_MOUSE RecName: Full=Cingulin;
   10::177     6e-04  28%  523 aa  CI117_MOUSE RecName: Full=Uncharacterized protein C9orf117 homolog;
   35::180     6e-04  23%  520 aa  CI117_HUMAN RecName: Full=Uncharacterized protein C9orf117;
  148::368     6e-04  22%  678 aa  CASP_MOUSE RecName: Full=Protein CASP;
  353::480     6e-04  28%  547 aa  CAO1B_XENLA RecName: Full=Calcium-binding and coiled-coil
  305::456     6e-04  26%  691 aa  BRE1_DEBHA RecName: Full=E3 ubiquitin-protein ligase BRE1;       
  105::233     6e-04  28%  820 aa  BICD2_MOUSE RecName: Full=Protein bicaudal D homolog 2;       
  105::233     6e-04  28%  824 aa  BICD2_HUMAN RecName: Full=Protein bicaudal D homolog 2;       
   14::181     6e-04  26%  394 aa  AV71_ACAVI RecName: Full=Muscle cell intermediate filament protein
  111::229     6e-04  26%  264 aa  APOA1_CHICK RecName: Full=Apolipoprotein A-I;         Short=Apo-AI;
  293::440     6e-04  27%  985 aa  ANR24_MOUSE RecName: Full=Ankyrin repeat domain-containing protein
   83::192     6e-04  27%  607 aa  A16L1_MOUSE RecName: Full=Autophagy-related protein 16-1;AltName:
   59::207     8e-04  29%  419 aa  YIBP_ECOLI RecName: Full=Uncharacterized protein yibP;
   91::208     8e-04  20%  750 aa  YF82_SCHPO RecName: Full=GRIP and coiled-coil domain-containing
  186::267     8e-04  26%  285 aa  TNNT2_BOVIN RecName: Full=Troponin T, cardiac muscle;       
  203::420     8e-04  28% 1130 aa  TG278_CAEEL RecName: Full=Putative protein tag-278;
   56::161     8e-04  27%  298 aa  STX4_RAT RecName: Full=Syntaxin-4;
   56::161     8e-04  27%  298 aa  STX4_MOUSE RecName: Full=Syntaxin-4;
  118::356     8e-04  23% 2472 aa  SPTA2_HUMAN RecName: Full=Spectrin alpha chain, brain;AltName:
  276::386     8e-04  25% 1290 aa  SMC4_XENLA RecName: Full=Structural maintenance of chromosomes
  573::711     8e-04  25% 1369 aa  ROCK1_RAT RecName: Full=Rho-associated protein kinase 1;       
  321::436     8e-04  28% 1847 aa  RIMB1_RAT RecName: Full=Peripheral-type benzodiazepine
  326::486     8e-04  19%  577 aa  OPTN_HUMAN RecName: Full=Optineurin;AltName: Full=Optic
  116::244     8e-04  28%  846 aa  NFM_RAT RecName: Full=Neurofilament medium polypeptide;       
 1325::1406    8e-04  33% 2245 aa  MYOJ_DICDI RecName: Full=Myosin-J heavy chain;AltName:
 1412::1520    8e-04  43% 1937 aa  MYH4_PIG RecName: Full=Myosin-4;AltName: Full=Myosin heavy chain
 1415::1523    8e-04  36% 1940 aa  MYH2_BOVIN RecName: Full=Myosin-2;AltName: Full=Myosin heavy chain
 1770::1910    8e-04  30% 1939 aa  MYH1_HUMAN RecName: Full=Myosin-1;AltName: Full=Myosin heavy chain
 1109::1252    8e-04  26% 1327 aa  MYH11_RAT RecName: Full=Myosin-11;AltName: Full=Myosin heavy chain
 1754::1910    8e-04  27% 1972 aa  MYH11_HUMAN RecName: Full=Myosin-11;AltName: Full=Myosin heavy chain
  968::1113    8e-04  30% 1270 aa  MTUS1_PONAB RecName: Full=Mitochondrial tumor suppressor 1 homolog;
  306::410     8e-04  28%  952 aa  MCP3_SCHPO RecName: Full=Meiotic coiled-coil protein 3;AltName:
   51::178     8e-04  26%  388 aa  LEKR1_HUMAN RecName: Full=Leucine-, glutamate- and lysine-rich
  299::373     8e-04  23%  583 aa  LAML1_XENLA RecName: Full=Lamin-L(I);
  747::884     8e-04  29%  963 aa  KINH_HUMAN RecName: Full=Kinesin-1 heavy chain;AltName:
  647::749     8e-04  22% 1668 aa  KI21B_MOUSE RecName: Full=Kinesin-like protein KIF21B;AltName:
  646::748     8e-04  22% 1637 aa  KI21B_HUMAN RecName: Full=Kinesin-like protein KIF21B;
  858::972     8e-04  23% 1388 aa  KI15A_XENLA RecName: Full=Kinesin-like protein KIF15-A;AltName:
  163::403     8e-04  22%  584 aa  K1C10_HUMAN RecName: Full=Keratin, type I cytoskeletal 10;AltName:
   45::223     8e-04  25%  314 aa  ESIP1_RAT RecName: Full=Epithelial-stromal interaction protein 1;
  137::357     8e-04  22% 1505 aa  CUX1_HUMAN RecName: Full=Homeobox protein cut-like 1;AltName:
  129::247     8e-04  27% 1658 aa  CTTB2_FELCA RecName: Full=Cortactin-binding protein 2;       
   70::149     8e-04  35%  519 aa  CNPD_STAS1 RecName: Full=2',3'-cyclic-nucleotide
  411::574     8e-04  26%  859 aa  CLPB_CHRVO RecName: Full=Chaperone protein clpB;
  690::858     8e-04  23% 1047 aa  CLIP2_MOUSE RecName: Full=CAP-Gly domain-containing linker protein
 1337::1610    8e-04  22% 1893 aa  CK5P2_PANTR RecName: Full=CDK5 regulatory subunit-associated protein
  740::874     8e-04  23%  905 aa  CIP2A_HUMAN RecName: Full=Protein CIP2A;AltName: Full=Cancerous
  204::294     8e-04  30% 1016 aa  CCD57_MOUSE RecName: Full=Coiled-coil domain-containing protein 57;
  166::283     8e-04  27%  740 aa  CB039_HUMAN RecName: Full=UPF0407 protein C2orf39;
  148::368     8e-04  22%  678 aa  CASP_PONAB RecName: Full=Protein CASP;
  148::368     8e-04  22%  678 aa  CASP_HUMAN RecName: Full=Protein CASP;
  143::287     8e-04  27%  691 aa  CACO1_MOUSE RecName: Full=Calcium-binding and coiled-coil
  208::303     8e-04  28%  793 aa  ATK1_ARATH RecName: Full=Kinesin-1;AltName: Full=Kinesin-like
  666::834     8e-04  23% 1264 aa  ATG11_ASPFU RecName: Full=Autophagy-related protein 11;
   86::177     8e-04  32%  256 aa  AP1_ARATH RecName: Full=Floral homeotic protein APETALA 1;AltName:
    1::636

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEGRGPYRIYDPGGSVPSGEASAAFERLVKENSRLKEKMQGIKMLGELLEESQMEATRLRQKAEELVKDN
TNIP1_HUMAN     MEGRGPYRIYDPGGSVPSGEASAAFERLVKENSRLKEKMQGIKMLGELLEESQMEATRLRQKAEELVKDN
TNIP1_MOUSE     MEGRGPYRIYDPGGSTPLGEVSAAFERLVEENTRLKGKMQGIKMLGELLEESQMEASRLRQKAEELVKDS
TNIP3_HUMAN     ----------------------------------------------------------------------
CEP55_RAT       ----------------------------------------------------------------------
CEP55_MOUSE     ----------------------------------------------------------------------
TPR_HUMAN       ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
CEP55_HUMAN     ----------------------------------------------------------------------
MPP9_MOUSE      ----------------------------------------------------------------------
HMMR_RAT        ----------------------------------------------------------------------
IMH1_YEAST      ----------------------------------------------------------------------
CCD46_HUMAN     ----------------------------------------------------------------------
CCD46_MOUSE     ----------------------------------------------------------------------
CCD41_HUMAN     ----------------------------------------------------------------------
CC150_HUMAN     ----------------------------------------------------------------------
TNIP2_MOUSE     ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
CLIP1_HUMAN     ----------------------------------------------------------------------
SPTB2_MOUSE     ----------------------------------------------------------------------
SPTB2_HUMAN     ----------------------------------------------------------------------
SMC3_RAT        ----------------------------------------------------------------------
SMC3_PONAB      ----------------------------------------------------------------------
SMC3_MOUSE      ----------------------------------------------------------------------
SMC3_HUMAN      ----------------------------------------------------------------------
SMC3_BOVIN      ----------------------------------------------------------------------
SYCP3_MOUSE     ----------------------------------------------------------------------
RUD3_YEAST      ----------------------------------------------------------------------
MYSP_DERFA      ----------------------------------------------------------------------
IFE_BRALA       ----------------------------------------------------------------------
FKB15_HUMAN     ----------------------------------------------------------------------
CTRO_MOUSE      ----------------------------------------------------------------------
CE290_DANRE     ----------------------------------------------------------------------
GOGA3_MOUSE     ----------------------------------------------------------------------
EZRI_RABIT      ----------------------------------------------------------------------
DMD_PIG         ----------------------------------------------------------------------
DMD_HUMAN       ----------------------------------------------------------------------
CP250_HUMAN     ----------------------------------------------------------------------
DIAP1_MOUSE     ----------------------------------------------------------------------
TNIP2_HUMAN     ----------------------------------------------------------------------
KIF15_RAT       ----------------------------------------------------------------------
MYH9_CHICK      ----------------------------------------------------------------------
USO1_YEAST      ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
M12_STRPY       ----------------------------------------------------------------------
CROCC_MOUSE     ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
QN1_RAT         ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
DMD_CANFA       ----------------------------------------------------------------------
CING_SORAR      ----------------------------------------------------------------------
CE164_HUMAN     ----------------------------------------------------------------------
SGM1_SCHPO      ----------------------------------------------------------------------
NF70_LOLPE      ----------------------------------------------------------------------
NF60_LOLPE      ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYO2_SCHPO      ----------------------------------------------------------------------
MYH8_MOUSE      ----------------------------------------------------------------------
GOGA5_RAT       ----------------------------------------------------------------------
GOGA5_HUMAN     ----------------------------------------------------------------------
GOGA4_HUMAN     ----------------------------------------------------------------------
FIL1L_HUMAN     ----------------------------------------------------------------------
TPM2_SCHMA      ----------------------------------------------------------------------
SYCP3_RAT       ----------------------------------------------------------------------
SMC4_DICDI      ----------------------------------------------------------------------
SAS6_DANRE      ----------------------------------------------------------------------
MLP1_YEAST      ----------------------------------------------------------------------
HMMR_MOUSE      ----------------------------------------------------------------------
CNPD_PELLD      ----------------------------------------------------------------------
PU92_SCICO      ----------------------------------------------------------------------
MYH8_HUMAN      ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
GCOM1_XENTR     ----------------------------------------------------------------------
CEP63_CHICK     ----------------------------------------------------------------------
CC150_MOUSE     ----------------------------------------------------------------------
BPA1_HUMAN      ----------------------------------------------------------------------
ALM1_SCHPO      ----------------------------------------------------------------------
SYCP3_MESAU     ----------------------------------------------------------------------
MYH8_CANFA      ----------------------------------------------------------------------
MYH3_MOUSE      ----------------------------------------------------------------------
KIF7_HUMAN      ----------------------------------------------------------------------
KIF15_MOUSE     ----------------------------------------------------------------------
DMD_MOUSE       ----------------------------------------------------------------------
CUX2_HUMAN      ----------------------------------------------------------------------
CNPD_PROVI      ----------------------------------------------------------------------
APSB_EMENI      ----------------------------------------------------------------------
SAS6_CHICK      ----------------------------------------------------------------------
NUF1_YEAST      ----------------------------------------------------------------------
MYO1_CAEEL      ----------------------------------------------------------------------
MYH7_RAT        ----------------------------------------------------------------------
MYH7_PAPHA      ----------------------------------------------------------------------
MYH7_MOUSE      ----------------------------------------------------------------------
MYH7_MESAU      ----------------------------------------------------------------------
MYH7_HUMAN      ----------------------------------------------------------------------
MYH7_CANFA      ----------------------------------------------------------------------
MYH3_RAT        ----------------------------------------------------------------------
MYH3_HUMAN      ----------------------------------------------------------------------
MRCKB_HUMAN     ----------------------------------------------------------------------
MRCKA_HUMAN     ----------------------------------------------------------------------
MPP9_HUMAN      ----------------------------------------------------------------------
IMH1_ASHGO      ----------------------------------------------------------------------
IFA1_CAEEL      ----------------------------------------------------------------------
GRDN_MOUSE      ----------------------------------------------------------------------
GOGA3_HUMAN     ----------------------------------------------------------------------
GOGA1_HUMAN     ----------------------------------------------------------------------
FKB15_MOUSE     ----------------------------------------------------------------------
CP250_MOUSE     ----------------------------------------------------------------------
CGNL1_HUMAN     ----------------------------------------------------------------------
BRE1_ASPFU      -------------------------KKLAEEKGTIAELEKALAEKQQL--EESLEAASLRYMVAEKKLDR
UACA_CANFA      ----------------------------------------------------------------------
SWP70_CHICK     ----------------------------------------------------------------------
SMC2_HUMAN      ----------------------------------------------------------------------
NEMO_DROME      ----------------------------------------------------------------------
MRCKA_RAT       ----------------------------------------------------------------------
BRE1_CRYNE      ----------------------------------------------------------------------
TAXB1_PONAB     ----------------------------------------------------------------------
SMC1_YEAST      ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
MYH9_RAT        ----------------------------------------------------------------------
MYH9_MOUSE      ----------------------------------------------------------------------
MRCKB_MOUSE     ----------------------------------------------------------------------
GFAP_DANRE      ----------------------------------------------------------------------
GFAP_CARAU      ----------------------------------------------------------------------
EFG_ACIAC       ----------------------------------------------------------------------
EEA1_HUMAN      ----------------------------------------------------------------------
DAPLE_XENLA     ----------------------------------------------------------------------
CE290_HUMAN     ----------------------------------------------------------------------
CACO1_BOVIN     ----------------------------------------------------------------------
ANT1_ONCVO      ----------------------------------------------------------------------
YNP9_CAEEL      ----------------------------------------------------------------------
VIME_RAT        ----------------------------------------------------------------------
VIME_MOUSE      ----------------------------------------------------------------------
VIME_MESAU      ----------------------------------------------------------------------
VIME_CRIGR      ----------------------------------------------------------------------
VIME_BOVIN      ----------------------------------------------------------------------
SPTCB_DROME     ----------------------------------------------------------------------
NIN_MOUSE       ----------------------------------------------------------------------
MYSN_DROME      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
MYO2_CAEEL      ----------------------------------------------------------------------
MYH6_RAT        ----------------------------------------------------------------------
LIPA1_HUMAN     ----------------------------------------------------------------------
K1C9_HUMAN      ----------------------------------------------------------------------
HOOK3_MOUSE     ----------------------------------------------------------------------
HOOK3_HUMAN     ----------------------------------------------------------------------
HMW2_MYCGE      ----------------------------------------------------------------------
HIP1_HUMAN      ----------------------------------------------------------------------
GRDN_HUMAN      ----------------------------------------------------------------------
GPTC8_MOUSE     ----------------------------------------------------------------------
GPTC8_HUMAN     ----------------------------------------------------------------------
CP135_HUMAN     ----------------------------------------------------------------------
CNPD_CHLPD      ----------------------------------------------------------------------
CASC4_CHICK     ----------------------------------------------------------------------
WAP_ARATH       ----------------------------------------------------------------------
TAXB1_HUMAN     ----------------------------------------------------------------------
SYCP3_MACFA     ----------------------------------------------------------------------
ROCK2_MOUSE     ----------------------------------------------------------------------
NDE1_CHICK      ----------------------------------------------------------------------
MYH8_RAT        ----------------------------------------------------------------------
MYH7_PIG        ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
MYH6_HUMAN      ----------------------------------------------------------------------
MRCKA_MOUSE     ----------------------------------------------------------------------
LIPB1_MOUSE     ----------------------------------------------------------------------
KINH_DROME      ----------------------------------------------------------------------
K1C9_RAT        ----------------------------------------------------------------------
GRIP_ARATH      ----------------------------------------------------------------------
GOGA1_MOUSE     ----------------------------------------------------------------------
FIL1L_MOUSE     ----------------------------------------------------------------------
EVI5L_HUMAN     ----------------------------------------------------------------------
DESP_HUMAN      ----------------------------------------------------------------------
CD158_HUMAN     ----------------------------------------------------------------------
CCHCR_MOUSE     ----------------------------------------------------------------------
CCD41_RAT       ----------------------------------------------------------------------
YOND_BACSU      ----------------------------------------------------------------------
VIME_ONCMY      ----------------------------------------------------------------------
SMC_BACSU       ----------------------------------------------------------------------
SMC2_XENLA      ----------------------------------------------------------------------
SKI_XENLA       ----------------------------------------------------------------------
SBCC_BACSU      ----------------------------------------------------------------------
RB6I2_HUMAN     ----------------------------------------------------------------------
PLST_CARAU      ----------------------------------------------------------------------
OPTN_CHICK      ----------------------------------------------------------------------
MYSP_MYTGA      ----------------------------------------------------------------------
MYSP_CAEEL      ----------------------------------------------------------------------
MYH6_MOUSE      ----------------------------------------------------------------------
MY18A_MOUSE     ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
KINH_SYNRA      ----------------------------------------------------------------------
EP15R_MOUSE     ----------------------------------------------------------------------
EEA1_MOUSE      ----------------------------------------------------------------------
CUT_CAEEL       ----------------------------------------------------------------------
CGNL1_MOUSE     ----------------------------------------------------------------------
CCD41_MOUSE     ----------------------------------------------------------------------
CCD18_HUMAN     ----------------------------------------------------------------------
CC151_BOVIN     ----------------------------------------------------------------------
CASP_CAEEL      ----------------------------------------------------------------------
ATG11_PICST     ----------------------------------------------------------------------
Y1002_CHLCV     ----------------------------------------------------------------------
VIME_PANTR      ----------------------------------------------------------------------
VIME_MACFA      ----------------------------------------------------------------------
VIME_HUMAN      ----------------------------------------------------------------------
VIME_CERAE      ----------------------------------------------------------------------
SMC2_MOUSE      ----------------------------------------------------------------------
OPTN_MOUSE      ----------------------------------------------------------------------
OPTN_DANRE      ----------------------------------------------------------------------
NDE1_HUMAN      ----------------------------------------------------------------------
MYO5C_HUMAN     ----------------------------------------------------------------------
MYH9_HUMAN      ----------------------------------------------------------------------
MYH9_CANFA      ----------------------------------------------------------------------
MYH13_HUMAN     ----------------------------------------------------------------------
EP15R_HUMAN     ----------------------------------------------------------------------
DZIP1_DANRE     ----------------------------------------------------------------------
DIAP1_HUMAN     ----------------------------------------------------------------------
CD158_MOUSE     ----------------------------------------------------------------------
SYCP3_HUMAN     ----------------------------------------------------------------------
MYS_AEQIR       ----------------------------------------------------------------------
MYH7_HORSE      ----------------------------------------------------------------------
MYH6_MESAU      ----------------------------------------------------------------------
MYH13_CANFA     ----------------------------------------------------------------------
MY18A_HUMAN     ----------------------------------------------------------------------
MOES_LYTVA      ----------------------------------------------------------------------
MLP2_YEAST      ----------------------------------------------------------------------
MFP1_ARATH      ----------------------------------------------------------------------
LRCC1_MOUSE     ----------------------------------------------------------------------
KIF7_DANRE      ----------------------------------------------------------------------
GOGA4_MOUSE     ----------------------------------------------------------------------
FLIP1_HUMAN     ----------------------------------------------------------------------
SGM1_YEAST      ----------------------------------------------------------------------
ROCK2_RAT       ----------------------------------------------------------------------
NDE1_XENTR      ----------------------------------------------------------------------
MYSP_BRUMA      ----------------------------------------------------------------------
MYO1_YEAST      ----------------------------------------------------------------------
ITSN1_XENLA     ----------------------------------------------------------------------
GOGA5_MOUSE     ----------------------------------------------------------------------
GCC2_MOUSE      ----------------------------------------------------------------------
GCC2_HUMAN      ----------------------------------------------------------------------
ETP1_YEAST      ----------------------------------------------------------------------
CTK2_XENLA      ----------------------------------------------------------------------
CC146_RAT       ----------------------------------------------------------------------
SPDLY_MACFA     ----------------------------------------------------------------------
RRBP1_MOUSE     ----------------------------------------------------------------------
RMUC_NEIMA      ----------------------------------------------------------------------
OPTN_XENLA      ----------------------------------------------------------------------
NUF2_EMENI      ----------------------------------------------------------------------
MYSP_SARSC      ----------------------------------------------------------------------
MYO4_CAEEL      ----------------------------------------------------------------------
MOEH_CULQU      ----------------------------------------------------------------------
MAD1_YARLI      ----------------------------------------------------------------------
KIF8_DICDI      ----------------------------------------------------------------------
KIF4_XENLA      ----------------------------------------------------------------------
K1C10_MOUSE     ----------------------------------------------------------------------
HOOK_AEDAE      ----------------------------------------------------------------------
DCTN1_CHICK     ----------------------------------------------------------------------
CENPE_MOUSE     ----------------------------------------------------------------------
CD72_HUMAN      ----------------------------------------------------------------------
CCD68_HUMAN     ----------------------------------------------------------------------
CACO1_DANRE     ----------------------------------------------------------------------
ANR26_HUMAN     ----------------------------------------------------------------------
XNIF_XENLA      ----------------------------------------------------------------------
TRIPB_HUMAN     ----------------------------------------------------------------------
TPM_MIMNO       ----------------------------------------------------------------------
ROCK2_HUMAN     ----------------------------------------------------------------------
PMFBP_MOUSE     ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
NU211_SCHPO     ----------------------------------------------------------------------
NMCP_ARATH      ----------------------------------------------------------------------
NDC80_NEUCR     ----------------------------------------------------------------------
MYSU_RABIT      ----------------------------------------------------------------------
MYSP_ONCVO      ----------------------------------------------------------------------
KIF15_HUMAN     ----------------------------------------------------------------------
KI20B_MOUSE     ----------------------------------------------------------------------
K1C15_PROAT     ----------------------------------------------------------------------
HOOK_CULQU      ----------------------------------------------------------------------
HOOK2_HUMAN     ----------------------------------------------------------------------
FBF1_HUMAN      ----------------------------------------------------------------------
CUX1_MOUSE      ----------------------------------------------------------------------
CTGE5_MOUSE     ----------------------------------------------------------------------
CT2NL_PONAB     ----------------------------------------------------------------------
CT2NL_HUMAN     ----------------------------------------------------------------------
CROL2_HUMAN     ----------------------------------------------------------------------
CNTLN_HUMAN     ----------------------------------------------------------------------
CING_CANFA      ----------------------------------------------------------------------
YD72_SCHPO      ----------------------------------------------------------------------
WIT2_ARATH      ----------------------------------------------------------------------
TANA_XENLA      ----------------------------------------------------------------------
STX4_BOVIN      ----------------------------------------------------------------------
ROCK1_BOVIN     ----------------------------------------------------------------------
RAD50_SULSO     ----------------------------------------------------------------------
PLPA_MYCGA      ----------------------------------------------------------------------
NIN_HUMAN       ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYSP_DIRIM      ----------------------------------------------------------------------
MYSP_BLOTA      ----------------------------------------------------------------------
MTS1A_DANRE     ----------------------------------------------------------------------
MEU1_SCHPO      ----------------------------------------------------------------------
MBO1_SCHPO      ----------------------------------------------------------------------
KIFC1_MOUSE     ----------------------------------------------------------------------
HOOK3_XENLA     ----------------------------------------------------------------------
HOOK1_CHICK     ----------------------------------------------------------------------
GCOM1_HUMAN     ----------------------------------------------------------------------
FBF1_MOUSE      ----------------------------------------------------------------------
CYTSA_TAKRU     ----------------------------------------------------------------------
CCD91_RAT       ----------------------------------------------------------------------
ATG11_NEUCR     ----------------------------------------------------------------------
YOMI_BACSU      ----------------------------------------------------------------------
YG3A_YEAST      ----------------------------------------------------------------------
SPDLY_HUMAN     ----------------------------------------------------------------------
SPC25_CANAL     ----------------------------------------------------------------------
ROCK2_BOVIN     ----------------------------------------------------------------------
RMUC_NEIMB      ----------------------------------------------------------------------
NUF2_ASPFU      ----------------------------------------------------------------------
NEMO_RAT        ----------------------------------------------------------------------
NDE1_RAT        ----------------------------------------------------------------------
MYSS_RABIT      ----------------------------------------------------------------------
MYSP_BOOMI      ----------------------------------------------------------------------
MIX1_CAEEL      ----------------------------------------------------------------------
LRC45_MOUSE     ----------------------------------------------------------------------
KINH_RAT        ----------------------------------------------------------------------
KIF4_CHICK      ----------------------------------------------------------------------
KI20B_HUMAN     ----------------------------------------------------------------------
K1C9_CANFA      ----------------------------------------------------------------------
K1C10_CANFA     ----------------------------------------------------------------------
IFEB_ASCSU      ----------------------------------------------------------------------
HMMR_HUMAN      ----------------------------------------------------------------------
GAS8_BOVIN      ----------------------------------------------------------------------
FIP37_ARATH     ----------------------------------------------------------------------
CCD18_MOUSE     ----------------------------------------------------------------------
APOA1_COTJA     ----------------------------------------------------------------------
Y451_HELPY      ----------------------------------------------------------------------
VIMB_CARAU      ----------------------------------------------------------------------
SYCP1_MESAU     ----------------------------------------------------------------------
STAT3_RAT       ----------------------------------------------------------------------
STAT3_PIG       ----------------------------------------------------------------------
STAT3_MOUSE     ----------------------------------------------------------------------
STAT3_HUMAN     ----------------------------------------------------------------------
RUFY2_PONAB     ----------------------------------------------------------------------
RUFY2_HUMAN     ----------------------------------------------------------------------
PIBF1_HUMAN     ----------------------------------------------------------------------
PHLB2_MOUSE     ----------------------------------------------------------------------
PHLB2_HUMAN     ----------------------------------------------------------------------
ODFP2_RAT       ----------------------------------------------------------------------
ODF2L_MOUSE     ----------------------------------------------------------------------
NDL1A_XENLA     ----------------------------------------------------------------------
MYS3_HYDAT      ----------------------------------------------------------------------
LAMB4_DANRE     ----------------------------------------------------------------------
KTN1_CHICK      ----------------------------------------------------------------------
KIF5C_MOUSE     ----------------------------------------------------------------------
KIF4_MOUSE      ----------------------------------------------------------------------
KIF27_MOUSE     ----------------------------------------------------------------------
K1C20_RAT       ----------------------------------------------------------------------
K1C10_BOVIN     ----------------------------------------------------------------------
F184B_HUMAN     ----------------------------------------------------------------------
EFG_AZOSB       ----------------------------------------------------------------------
DCTN1_DROME     ----------------------------------------------------------------------
CNPD_ARCB4      ----------------------------------------------------------------------
CLIP1_MOUSE     ----------------------------------------------------------------------
CENPJ_PANTR     ----------------------------------------------------------------------
CENPF_HUMAN     ----------------------------------------------------------------------
CENPE_HUMAN     ----------------------------------------------------------------------
CE290_BOVIN     ----------------------------------------------------------------------
CCPG1_CHICK     ----------------------------------------------------------------------
CC147_HUMAN     ----------------------------------------------------------------------
CACO1_RAT       ----------------------------------------------------------------------
C3H41_ARATH     ----------------------------------------------------------------------
BRE1_ASHGO      ----------------------------------------------------------------------
ATG16_XENTR     ----------------------------------------------------------------------
YQOE_CAEEL      ----------------------------------------------------------------------
Y4A0_ENCCU      ----------------------------------------------------------------------
TIG_PROM5       ----------------------------------------------------------------------
TAXB1_RAT       ----------------------------------------------------------------------
SYGP1_HUMAN     ----------------------------------------------------------------------
SYCP1_HUMAN     ----------------------------------------------------------------------
STAT3_CHICK     ----------------------------------------------------------------------
SMC6_MOUSE      ----------------------------------------------------------------------
SLMAP_HUMAN     ----------------------------------------------------------------------
QN1_HUMAN       ----------------------------------------------------------------------
OPTN_RAT        ----------------------------------------------------------------------
ODFP2_MOUSE     ----------------------------------------------------------------------
NEMO_BOVIN      ----------------------------------------------------------------------
NDEL1_XENTR     ----------------------------------------------------------------------
MYH2_PIG        ----------------------------------------------------------------------
MYH10_RAT       ----------------------------------------------------------------------
MYH10_MOUSE     ----------------------------------------------------------------------
KIF1_DICDI      ----------------------------------------------------------------------
GRAP1_RAT       ----------------------------------------------------------------------
FAT1_SCHPO      ----------------------------------------------------------------------
DIXC1_RAT       ----------------------------------------------------------------------
DCTN1_XENLA     ----------------------------------------------------------------------
CTTB2_RABIT     ----------------------------------------------------------------------
CLPB_HELPY      ----------------------------------------------------------------------
CEP63_PONAB     ----------------------------------------------------------------------
CEP63_MACFA     ----------------------------------------------------------------------
CEP63_HUMAN     ----------------------------------------------------------------------
CENPC_HUMAN     ----------------------------------------------------------------------
CCD69_XENTR     ----------------------------------------------------------------------
CACO2_BOVIN     ----------------------------------------------------------------------
BFR1_YEAST      ----------------------------------------------------------------------
AKAP9_HUMAN     ----------------------------------------------------------------------
AGLZ_MYXXD      ----------------------------------------------------------------------
ZIP1_YEAST      ----------------------------------------------------------------------
YB145_PLAF7     ----------------------------------------------------------------------
YA046_HUMAN     ----------------------------------------------------------------------
VIME_CHICK      ----------------------------------------------------------------------
UACA_HUMAN      ----------------------------------------------------------------------
TNNT2_RAT       ----------------------------------------------------------------------
T4AF1_HUMAN     ----------------------------------------------------------------------
SYCP1_MOUSE     ----------------------------------------------------------------------
RFIP4_MOUSE     ----------------------------------------------------------------------
RAD50_THEAC     ----------------------------------------------------------------------
RAD50_ARATH     ----------------------------------------------------------------------
PUMA_PARUN      ----------------------------------------------------------------------
PFDA_IGNH4      ----------------------------------------------------------------------
MYO5A_HUMAN     ----------------------------------------------------------------------
MYH10_HUMAN     ----------------------------------------------------------------------
MYH10_BOVIN     ----------------------------------------------------------------------
MD1L1_MOUSE     ----------------------------------------------------------------------
KIF15_STRPU     ----------------------------------------------------------------------
KI21A_HUMAN     ----------------------------------------------------------------------
GOGA2_HUMAN     ----------------------------------------------------------------------
EVI5_HUMAN      ----------------------------------------------------------------------
CING_XENTR      ----------------------------------------------------------------------
CING_XENLA      ----------------------------------------------------------------------
CI117_RAT       ----------------------------------------------------------------------
CC146_HUMAN     ----------------------------------------------------------------------
CAR14_HUMAN     ----------------------------------------------------------------------
BPAEA_MOUSE     ----------------------------------------------------------------------
ZWINT_RAT       ----------------------------------------------------------------------
ZWINT_MOUSE     ----------------------------------------------------------------------
YM92_CAEEL      ----------------------------------------------------------------------
YL139_YARLI     ----------------------------------------------------------------------
YA046_MOUSE     ----------------------------------------------------------------------
VIM4_XENLA      ----------------------------------------------------------------------
SYS_SYNE7       ----------------------------------------------------------------------
SYS_DESHY       ----------------------------------------------------------------------
SYCP2_MOUSE     ----------------------------------------------------------------------
SPC24_HUMAN     ----------------------------------------------------------------------
SHE9_ASHGO      ----------------------------------------------------------------------
RIMB1_HUMAN     ----------------------------------------------------------------------
RHG17_RAT       ----------------------------------------------------------------------
RHG17_MOUSE     ----------------------------------------------------------------------
P54_ENTFC       ----------------------------------------------------------------------
ODFP2_HUMAN     ----------------------------------------------------------------------
NFM_PIG         ----------------------------------------------------------------------
NFM_HUMAN       ----------------------------------------------------------------------
NDE1_DROME      ----------------------------------------------------------------------
MYH2_HUMAN      ----------------------------------------------------------------------
MYH2_HORSE      ----------------------------------------------------------------------
MTUS1_MOUSE     ----------------------------------------------------------------------
MEDB_GIALA      ----------------------------------------------------------------------
LCA5L_PAPAN     ----------------------------------------------------------------------
KLPA_EMENI      ----------------------------------------------------------------------
K1C10_RAT       ----------------------------------------------------------------------
HOOK_BRAFL      ----------------------------------------------------------------------
GAS8_RAT        ----------------------------------------------------------------------
EZRA_BACLD      ----------------------------------------------------------------------
EFG_YERPY       ----------------------------------------------------------------------
EFG_YERPS       ----------------------------------------------------------------------
EFG_YERPP       ----------------------------------------------------------------------
EFG_YERPN       ----------------------------------------------------------------------
EFG_YERPG       ----------------------------------------------------------------------
EFG_YERPE       ----------------------------------------------------------------------
EFG_YERPB       ----------------------------------------------------------------------
EFG_YERPA       ----------------------------------------------------------------------
EFG_YERP3       ----------------------------------------------------------------------
DEFI6_XENLA     ----------------------------------------------------------------------
CWLO_BACSU      ----------------------------------------------------------------------
CP135_DANRE     ----------------------------------------------------------------------
CK5P2_HUMAN     ----------------------------------------------------------------------
CCD93_XENTR     ----------------------------------------------------------------------
ATPF_DESDG      ----------------------------------------------------------------------
YDEM_CAEEL      ----------------------------------------------------------------------
YBAC_SCHPO      ----------------------------------------------------------------------
Y4862_ARATH     ----------------------------------------------------------------------
Y147_TNAVC      ----------------------------------------------------------------------
VIM1_XENLA      ----------------------------------------------------------------------
UACA_BOVIN      ----------------------------------------------------------------------
TMF1_MOUSE      ----------------------------------------------------------------------
TAXB1_BOVIN     ----------------------------------------------------------------------
ROCK1_RABIT     ----------------------------------------------------------------------
RBCC1_MOUSE     ----------------------------------------------------------------------
NFM_MOUSE       ----------------------------------------------------------------------
NFM_BOVIN       ----------------------------------------------------------------------
NDE1B_XENLA     ----------------------------------------------------------------------
NDC80_ASHGO     ----------------------------------------------------------------------
MYSP_ANISI      ----------------------------------------------------------------------
MYSA_DROME      ----------------------------------------------------------------------
MYH2_CANFA      ----------------------------------------------------------------------
MYH11_MOUSE     ----------------------------------------------------------------------
MIP1_ARATH      ----------------------------------------------------------------------
MAD1_DEBHA      ----------------------------------------------------------------------
K2C7_RAT        ----------------------------------------------------------------------
K2C7_MOUSE      ----------------------------------------------------------------------
K1C20_MOUSE     ----------------------------------------------------------------------
HOOK_DROMO      ----------------------------------------------------------------------
HAUS3_MOUSE     ----------------------------------------------------------------------
GG8L1_HUMAN     ----------------------------------------------------------------------
FBF1_CHICK      ----------------------------------------------------------------------
EDE1_YEAST      ----------------------------------------------------------------------
CTRO_HUMAN      ----------------------------------------------------------------------
CNPD_PELPD      ----------------------------------------------------------------------
CNPD_NITSB      ----------------------------------------------------------------------
CNPD_CHLTE      ----------------------------------------------------------------------
CING_MOUSE      ----------------------------------------------------------------------
CI117_MOUSE     ----------------------------------------------------------------------
CI117_HUMAN     ----------------------------------------------------------------------
CASP_MOUSE      ----------------------------------------------------------------------
CAO1B_XENLA     ----------------------------------------------------------------------
BRE1_DEBHA      ----------------------------------------------------------------------
BICD2_MOUSE     ----------------------------------------------------------------------
BICD2_HUMAN     ----------------------------------------------------------------------
AV71_ACAVI      ----------------------------------------------------------------------
APOA1_CHICK     ----------------------------------------------------------------------
ANR24_MOUSE     ----------------------------------------------------------------------
A16L1_MOUSE     ----------------------------------------------------------------------
YIBP_ECOLI      ----------------------------------------------------------------------
YF82_SCHPO      ----------------------------------------------------------------------
TNNT2_BOVIN     ----------------------------------------------------------------------
TG278_CAEEL     ----------------------------------------------------------------------
STX4_RAT        ----------------------------------------------------------------------
STX4_MOUSE      ----------------------------------------------------------------------
SPTA2_HUMAN     ----------------------------------------------------------------------
SMC4_XENLA      ----------------------------------------------------------------------
ROCK1_RAT       ----------------------------------------------------------------------
RIMB1_RAT       ----------------------------------------------------------------------
OPTN_HUMAN      ----------------------------------------------------------------------
NFM_RAT         ----------------------------------------------------------------------
MYOJ_DICDI      ----------------------------------------------------------------------
MYH4_PIG        ----------------------------------------------------------------------
MYH2_BOVIN      ----------------------------------------------------------------------
MYH1_HUMAN      ----------------------------------------------------------------------
MYH11_RAT       ----------------------------------------------------------------------
MYH11_HUMAN     ----------------------------------------------------------------------
MTUS1_PONAB     ----------------------------------------------------------------------
MCP3_SCHPO      ----------------------------------------------------------------------
LEKR1_HUMAN     ----------------------------------------------------------------------
LAML1_XENLA     ----------------------------------------------------------------------
KINH_HUMAN      ----------------------------------------------------------------------
KI21B_MOUSE     ----------------------------------------------------------------------
KI21B_HUMAN     ----------------------------------------------------------------------
KI15A_XENLA     ----------------------------------------------------------------------
K1C10_HUMAN     ----------------------------------------------------------------------
ESIP1_RAT       ----------------------------------------------------------------------
CUX1_HUMAN      ----------------------------------------------------------------------
CTTB2_FELCA     ----------------------------------------------------------------------
CNPD_STAS1      ----------------------------------------------------------------------
CLPB_CHRVO      ----------------------------------------------------------------------
CLIP2_MOUSE     ----------------------------------------------------------------------
CK5P2_PANTR     ----------------------------------------------------------------------
CIP2A_HUMAN     ----------------------------------------------------------------------
CCD57_MOUSE     ----------------------------------------------------------------------
CB039_HUMAN     ----------------------------------------------------------------------
CASP_PONAB      ----------------------------------------------------------------------
CASP_HUMAN      ----------------------------------------------------------------------
CACO1_MOUSE     ----------------------------------------------------------------------
ATK1_ARATH      ----------------------------------------------------------------------
ATG11_ASPFU     ----------------------------------------------------------------------
AP1_ARATH       ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           EXXXXXXXXXXXXXXXAELTGKDSNVTASPTAPACPSDKPAPVQKPPSSGTSSEFEVVTPEEQNSPESSS
TNIP1_HUMAN     EXXXXXXXXXXXXXXXAELTGKDSNVTASPTAPACPSDKPAPVQKPPSSGTSSEFEVVTPEEQNSPESSS
TNIP1_MOUSE     ELSPPTSAPSLVSFDDAELTGQDTKVQVHPXXXXXXXEKPEPASKSPSNGASSDFEVVPTEEQNSPETGS
TNIP3_HUMAN     ----------------------------------------------------------------------
CEP55_RAT       ----------------------------------------------------------------------
CEP55_MOUSE     ----------------------------------------------------------------------
TPR_HUMAN       ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
CEP55_HUMAN     ----------------------------------------------------------------------
MPP9_MOUSE      ----------------------------------------------------------------------
HMMR_RAT        ----------------------------------------------------------------------
IMH1_YEAST      ----------------------------------------------------------------------
CCD46_HUMAN     ----------------------------------------------------------------------
CCD46_MOUSE     ----------------------------------------------------------------------
CCD41_HUMAN     ----------------------------------------------------------------------
CC150_HUMAN     ----------------------------------------------------------------------
TNIP2_MOUSE     ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
CLIP1_HUMAN     ----------------------------------------------------------------------
SPTB2_MOUSE     ----------------------------------------------------------------------
SPTB2_HUMAN     ----------------------------------------------------------------------
SMC3_RAT        ----------------------------------------------------------------------
SMC3_PONAB      ----------------------------------------------------------------------
SMC3_MOUSE      ----------------------------------------------------------------------
SMC3_HUMAN      ----------------------------------------------------------------------
SMC3_BOVIN      ----------------------------------------------------------------------
SYCP3_MOUSE     ----------------------------------------------------------------------
RUD3_YEAST      ----------------------------------------------------------------------
MYSP_DERFA      ----------------------------------------------------------------------
IFE_BRALA       ----------------------------------------------------------------------
FKB15_HUMAN     ---------------------------------------PAPLSQPPGSGDMASF-LMTEARQHNTEIR-
CTRO_MOUSE      ----------------------------------------------------------------------
CE290_DANRE     ----------------------------------------------------------------------
GOGA3_MOUSE     ----------------------------------------------------------------------
EZRI_RABIT      ----------------------------------------------------------------------
DMD_PIG         ----------------------------------------------------------------------
DMD_HUMAN       ----------------------------------------------------------------------
CP250_HUMAN     ----------------------------------------------------------------------
DIAP1_MOUSE     ----------------------------------------------------------------------
TNIP2_HUMAN     ----------------------------------------------------------------------
KIF15_RAT       ----------------------------------------------------------------------
MYH9_CHICK      ----------------------------------------------------------------------
USO1_YEAST      ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
M12_STRPY       -------------------------------------------------------------EQAYNELSG
CROCC_MOUSE     ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
QN1_RAT         ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
DMD_CANFA       ----------------------------------------------------------------------
CING_SORAR      ----------------------------------------------------------------------
CE164_HUMAN     ----------------------------------------------------------------------
SGM1_SCHPO      ----------------------------------------------------------------------
NF70_LOLPE      ----------------------------------------------------------------------
NF60_LOLPE      ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYO2_SCHPO      ----------------------------------------------------------------------
MYH8_MOUSE      ----------------------------------------------------------------------
GOGA5_RAT       ----------------------------------------------------------------------
GOGA5_HUMAN     ----------------------------------------------------------------------
GOGA4_HUMAN     ----------------------------------------------------------------------
FIL1L_HUMAN     ----------------------------------------------------------------------
TPM2_SCHMA      ----------------------------------------------------------------------
SYCP3_RAT       ----------------------------------------------------------------------
SMC4_DICDI      ----------------------------------------------------------------------
SAS6_DANRE      ----------------------------------------------------------------------
MLP1_YEAST      ----------------------------------------------------------------------
HMMR_MOUSE      ----------------------------------------------------------------------
CNPD_PELLD      ----------------------------------------------------------------------
PU92_SCICO      ----------------------------------------------------------------------
MYH8_HUMAN      ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
GCOM1_XENTR     ----------------------------------------------------------------------
CEP63_CHICK     ----------------------------------------------------------------------
CC150_MOUSE     ----------------------------------------------------------------------
BPA1_HUMAN      ----------------------------------------------------------------------
ALM1_SCHPO      ----------------------------------------------------------------------
SYCP3_MESAU     ----------------------------------------------------------------------
MYH8_CANFA      ----------------------------------------------------------------------
MYH3_MOUSE      ----------------------------------------------------------------------
KIF7_HUMAN      ----------------------------------------------------------------------
KIF15_MOUSE     ----------------------------------------------------------------------
DMD_MOUSE       ----------------------------------------------------------------------
CUX2_HUMAN      ----------------------------------------------------------------------
CNPD_PROVI      ----------------------------------------------------------------------
APSB_EMENI      ----------------------------------------------------------------------
SAS6_CHICK      ----------------------------------------------------------------------
NUF1_YEAST      ----------------------------------------------------------------------
MYO1_CAEEL      ----------------------------------------------------------------------
MYH7_RAT        ----------------------------------------------------------------------
MYH7_PAPHA      ----------------------------------------------------------------------
MYH7_MOUSE      ----------------------------------------------------------------------
MYH7_MESAU      ----------------------------------------------------------------------
MYH7_HUMAN      ----------------------------------------------------------------------
MYH7_CANFA      ----------------------------------------------------------------------
MYH3_RAT        ----------------------------------------------------------------------
MYH3_HUMAN      ----------------------------------------------------------------------
MRCKB_HUMAN     ----------------------------------------------------------------------
MRCKA_HUMAN     ----------------------------------------------------------------------
MPP9_HUMAN      ----------------------------------------------------------------------
IMH1_ASHGO      ----------------------------------------------------------------------
IFA1_CAEEL      ----------------------------------------------------------------------
GRDN_MOUSE      ----------------------------------------------------------------------
GOGA3_HUMAN     ----------------------------------------------------------------------
GOGA1_HUMAN     ----------------------------------------------------------------------
FKB15_MOUSE     ----------------------------------------------------------------------
CP250_MOUSE     ----------------------------------------------------------------------
CGNL1_HUMAN     ----------------------------------------------------------------------
BRE1_ASPFU      ARSLTVAKLEKQYLLGAQRPGGDS--------ASGNREEQSPVNGLPSS---AERNTELEEAHKQLVAVS
UACA_CANFA      ----------------------------------------------------------------------
SWP70_CHICK     ----------------------------------------------------------------------
SMC2_HUMAN      ----------------------------------------------------------------------
NEMO_DROME      ----------------------------------------------------------------------
MRCKA_RAT       ----------------------------------------------------------------------
BRE1_CRYNE      ----------------------------------------------------------------------
TAXB1_PONAB     ----------------------------------------------------------------------
SMC1_YEAST      ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
MYH9_RAT        ----------------------------------------------------------------------
MYH9_MOUSE      ----------------------------------------------------------------------
MRCKB_MOUSE     ----------------------------------------------------------------------
GFAP_DANRE      ----------------------------------------------------------------------
GFAP_CARAU      ----------------------------------------------------------------------
EFG_ACIAC       ----------------------------------------------------------------------
EEA1_HUMAN      ----------------------------------------------------------------------
DAPLE_XENLA     ----------------------------------------------------------------------
CE290_HUMAN     ----------------------------------------------------------------------
CACO1_BOVIN     ----------------------------------------------------------------------
ANT1_ONCVO      ----------------------------------------------------------------------
YNP9_CAEEL      ----------------------------------------------------------------------
VIME_RAT        ----------------------------------------------------------------------
VIME_MOUSE      ----------------------------------------------------------------------
VIME_MESAU      ----------------------------------------------------------------------
VIME_CRIGR      ----------------------------------------------------------------------
VIME_BOVIN      ----------------------------------------------------------------------
SPTCB_DROME     ----------------------------------------------------------------------
NIN_MOUSE       ----------------------------------------------------------------------
MYSN_DROME      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
MYO2_CAEEL      ----------------------------------------------------------------------
MYH6_RAT        ----------------------------------------------------------------------
LIPA1_HUMAN     ----------------------------------------------------------------------
K1C9_HUMAN      ----------------------------------------------------------------------
HOOK3_MOUSE     ----------------------------------------------------------------------
HOOK3_HUMAN     ----------------------------------------------------------------------
HMW2_MYCGE      ----------------------------------------------------------------------
HIP1_HUMAN      ----------------------------------------------------------------------
GRDN_HUMAN      ----------------------------------------------------------------------
GPTC8_MOUSE     ----------------------------------------------------------------------
GPTC8_HUMAN     ----------------------------------------------------------------------
CP135_HUMAN     ----------------------------------------------------------------------
CNPD_CHLPD      ----------------------------------------------------------------------
CASC4_CHICK     ----------------------------------------------------------------------
WAP_ARATH       ----------------------------------------------------------------------
TAXB1_HUMAN     ----------------------------------------------------------------------
SYCP3_MACFA     ----------------------------------------------------------------------
ROCK2_MOUSE     ----------------------------------------------------------------------
NDE1_CHICK      ----------------------------------------------------------------------
MYH8_RAT        ----------------------------------------------------------------------
MYH7_PIG        ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
MYH6_HUMAN      ----------------------------------------------------------------------
MRCKA_MOUSE     ----------------------------------------------------------------------
LIPB1_MOUSE     ----------------------------------------------------------------------
KINH_DROME      ----------------------------------------------------------------------
K1C9_RAT        ----------------------------------------------------------------------
GRIP_ARATH      ----------------------------------------------------------------------
GOGA1_MOUSE     ----------------------------------------------------------------------
FIL1L_MOUSE     ----------------------------------------------------------------------
EVI5L_HUMAN     ----------------------------------------------------------------------
DESP_HUMAN      ----------------------------------------------------------------------
CD158_HUMAN     ----------------------------------------------------------------------
CCHCR_MOUSE     ----------------------------------------------------------------------
CCD41_RAT       ----------------------------------------------------------------------
YOND_BACSU      ----------------------------------------------------------------------
VIME_ONCMY      ----------------------------------------------------------------------
SMC_BACSU       ----------------------------------------------------------------------
SMC2_XENLA      ----------------------------------------------------------------------
SKI_XENLA       ----------------------------------------------------------------------
SBCC_BACSU      ----------------------------------------------------------------------
RB6I2_HUMAN     ----------------------------------------------------------------------
PLST_CARAU      ----------------------------------------------------------------------
OPTN_CHICK      ----------------------------------------------------------------------
MYSP_MYTGA      ----------------------------------------------------------------------
MYSP_CAEEL      ----------------------------------------------------------------------
MYH6_MOUSE      ----------------------------------------------------------------------
MY18A_MOUSE     ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
KINH_SYNRA      ---------------------------------------PAPGFKSPVSGSRPATPVPTLEKDEREEFIK
EP15R_MOUSE     ----------------------------------------------------------------------
EEA1_MOUSE      ----------------------------------------------------------------------
CUT_CAEEL       ----------------------------------------------------------------------
CGNL1_MOUSE     ----------------------------------------------------------------------
CCD41_MOUSE     ----------------------------------------------------------------------
CCD18_HUMAN     ----------------------------------------------------------------------
CC151_BOVIN     ----------------------------------------------------------------------
CASP_CAEEL      ----------------------------------------------------------------------
ATG11_PICST     ----------------------------------------------------------------------
Y1002_CHLCV     ----------------------------------------------------------------------
VIME_PANTR      ----------------------------------------------------------------------
VIME_MACFA      ----------------------------------------------------------------------
VIME_HUMAN      ----------------------------------------------------------------------
VIME_CERAE      ----------------------------------------------------------------------
SMC2_MOUSE      ----------------------------------------------------------------------
OPTN_MOUSE      ----------------------------------------------------------------------
OPTN_DANRE      ----------------------------------------------------------------------
NDE1_HUMAN      ----------------------------------------------------------------------
MYO5C_HUMAN     ----------------------------------------------------------------------
MYH9_HUMAN      ----------------------------------------------------------------------
MYH9_CANFA      ----------------------------------------------------------------------
MYH13_HUMAN     ----------------------------------------------------------------------
EP15R_HUMAN     ----------------------------------------------------------------------
DZIP1_DANRE     ----------------------------------------------------------------------
DIAP1_HUMAN     ----------------------------------------------------------------------
CD158_MOUSE     ----------------------------------------------------------------------
SYCP3_HUMAN     ----------------------------------------------------------------------
MYS_AEQIR       ----------------------------------------------------------------------
MYH7_HORSE      ----------------------------------------------------------------------
MYH6_MESAU      ----------------------------------------------------------------------
MYH13_CANFA     ----------------------------------------------------------------------
MY18A_HUMAN     ----------------------------------------------------------------------
MOES_LYTVA      ----------------------------------------------------------------------
MLP2_YEAST      ----------------------------------------------------------------------
MFP1_ARATH      ----------------------------------------------------------------------
LRCC1_MOUSE     ----------------------------------------------------------------------
KIF7_DANRE      ----------------------------------------------------------------------
GOGA4_MOUSE     ----------------------------------------------------------------------
FLIP1_HUMAN     ----------------------------------------------------------------------
SGM1_YEAST      ----------------------------------------------------------------------
ROCK2_RAT       ----------------------------------------------------------------------
NDE1_XENTR      ----------------------------------------------------------------------
MYSP_BRUMA      ----------------------------------------------------------------------
MYO1_YEAST      ----------------------------------------------------------------------
ITSN1_XENLA     ----------------------------------------------------------------------
GOGA5_MOUSE     ----------------------------------------------------------------------
GCC2_MOUSE      ----------------------------------------------------------------------
GCC2_HUMAN      ----------------------------------------------------------------------
ETP1_YEAST      ----------------------------------------------------------------------
CTK2_XENLA      ----------------------------------------------------------------------
CC146_RAT       ----------------------------------------------------------------------
SPDLY_MACFA     ----------------------------------------------------------------------
RRBP1_MOUSE     ----------------------------------------------------------------------
RMUC_NEIMA      ----------------------------------------------------------------------
OPTN_XENLA      ----------------------------------------------------------------------
NUF2_EMENI      ----------------------------------------------------------------------
MYSP_SARSC      ----------------------------------------------------------------------
MYO4_CAEEL      ----------------------------------------------------------------------
MOEH_CULQU      ----------------------------------------------------------------------
MAD1_YARLI      ----------------------------------------------------------------------
KIF8_DICDI      ----------------------------------------------------------------------
KIF4_XENLA      ----------------------------------------------------------------------
K1C10_MOUSE     ----------------------------------------------------------------------
HOOK_AEDAE      ----------------------------------------------------------------------
DCTN1_CHICK     ----------------------------------------------------------------------
CENPE_MOUSE     ----------------------------------------------------------------------
CD72_HUMAN      ----------------------------------------------------------------------
CCD68_HUMAN     ----------------------------------------------------------------------
CACO1_DANRE     ----------------------------------------------------------------------
ANR26_HUMAN     ----------------------------------------------------------------------
XNIF_XENLA      ----------------------------------------------------------------------
TRIPB_HUMAN     ----------------------------------------------------------------------
TPM_MIMNO       ----------------------------------------------------------------------
ROCK2_HUMAN     ----------------------------------------------------------------------
PMFBP_MOUSE     ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
NU211_SCHPO     ----------------------------------------------------------------------
NMCP_ARATH      ----------------------------------------------------------------------
NDC80_NEUCR     ----------------------------------------------------------------------
MYSU_RABIT      ----------------------------------------------------------------------
MYSP_ONCVO      ----------------------------------------------------------------------
KIF15_HUMAN     ----------------------------------------------------------------------
KI20B_MOUSE     ----------------------------------------------------------------------
K1C15_PROAT     ----------------------------------------------------------------------
HOOK_CULQU      ----------------------------------------------------------------------
HOOK2_HUMAN     ----------------------------------------------------------------------
FBF1_HUMAN      ----------------------------------------------------------------------
CUX1_MOUSE      ----------------------------------------------------------------------
CTGE5_MOUSE     ----------------------------------------------------------------------
CT2NL_PONAB     ----------------------------------------------------------------------
CT2NL_HUMAN     ----------------------------------------------------------------------
CROL2_HUMAN     ----------------------------------------------------------------------
CNTLN_HUMAN     ----------------------------------------------------------------------
CING_CANFA      ----------------------------------------------------------------------
YD72_SCHPO      ----------------------------------------------------------------------
WIT2_ARATH      ----------------------------------------------------------------------
TANA_XENLA      ----------------------------------------------------------------------
STX4_BOVIN      ----------------------------------------------------------------------
ROCK1_BOVIN     ----------------------------------------------------------------------
RAD50_SULSO     ----------------------------------------------------------------------
PLPA_MYCGA      ----------------------------------------------------------------------
NIN_HUMAN       ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYSP_DIRIM      ----------------------------------------------------------------------
MYSP_BLOTA      ----------------------------------------------------------------------
MTS1A_DANRE     ----------------------------------------------------------------------
MEU1_SCHPO      ----------------------------------------------------------------------
MBO1_SCHPO      ----------------------------------------------------------------------
KIFC1_MOUSE     ----------------------------------------------------------------------
HOOK3_XENLA     ----------------------------------------------------------------------
HOOK1_CHICK     ----------------------------------------------------------------------
GCOM1_HUMAN     ----------------------------------------------------------------------
FBF1_MOUSE      ----------------------------------------------------------------------
CYTSA_TAKRU     ----------------------------------------------------------------------
CCD91_RAT       ----------------------------------------------------------------------
ATG11_NEUCR     ----------------------------------------------------------------------
YOMI_BACSU      ----------------------------------------------------------------------
YG3A_YEAST      ----------------------------------------------------------------------
SPDLY_HUMAN     ----------------------------------------------------------------------
SPC25_CANAL     ----------------------------------------------------------------------
ROCK2_BOVIN     ----------------------------------------------------------------------
RMUC_NEIMB      ----------------------------------------------------------------------
NUF2_ASPFU      ----------------------------------------------------------------------
NEMO_RAT        ----------------------------------------------------------------------
NDE1_RAT        ----------------------------------------------------------------------
MYSS_RABIT      ----------------------------------------------------------------------
MYSP_BOOMI      ----------------------------------------------------------------------
MIX1_CAEEL      ----------------------------------------------------------------------
LRC45_MOUSE     ----------------------------------------------------------------------
KINH_RAT        ----------------------------------------------------------------------
KIF4_CHICK      ----------------------------------------------------------------------
KI20B_HUMAN     ----------------------------------------------------------------------
K1C9_CANFA      ----------------------------------------------------------------------
K1C10_CANFA     ----------------------------------------------------------------------
IFEB_ASCSU      ----------------------------------------------------------------------
HMMR_HUMAN      ----------------------------------------------------------------------
GAS8_BOVIN      ----------------------------------------------------------------------
FIP37_ARATH     ----------------------------------------------------------------------
CCD18_MOUSE     ----------------------------------------------------------------------
APOA1_COTJA     ----------------------------------------------------------------------
Y451_HELPY      ----------------------------------------------------------------------
VIMB_CARAU      ----------------------------------------------------------------------
SYCP1_MESAU     ----------------------------------------------------------------------
STAT3_RAT       ----------------------------------------------------------------------
STAT3_PIG       ----------------------------------------------------------------------
STAT3_MOUSE     ----------------------------------------------------------------------
STAT3_HUMAN     ----------------------------------------------------------------------
RUFY2_PONAB     ----------------------------------------------------------------------
RUFY2_HUMAN     ----------------------------------------------------------------------
PIBF1_HUMAN     ----------------------------------------------------------------------
PHLB2_MOUSE     ----------------------------------------------------------------------
PHLB2_HUMAN     ----------------------------------------------------------------------
ODFP2_RAT       ----------------------------------------------------------------------
ODF2L_MOUSE     ----------------------------------------------------------------------
NDL1A_XENLA     ----------------------------------------------------------------------
MYS3_HYDAT      ----------------------------------------------------------------------
LAMB4_DANRE     ----------------------------------------------------------------------
KTN1_CHICK      ----------------------------------------------------------------------
KIF5C_MOUSE     ----------------------------------------------------------------------
KIF4_MOUSE      ----------------------------------------------------------------------
KIF27_MOUSE     ----------------------------------------------------------------------
K1C20_RAT       ----------------------------------------------------------------------
K1C10_BOVIN     ----------------------------------------------------------------------
F184B_HUMAN     ----------------------------------------------------------------------
EFG_AZOSB       ----------------------------------------------------------------------
DCTN1_DROME     ----------------------------------------------------------------------
CNPD_ARCB4      ----------------------------------------------------------------------
CLIP1_MOUSE     ----------------------------------------------------------------------
CENPJ_PANTR     ----------------------------------------------------------------------
CENPF_HUMAN     ----------------------------------------------------------------------
CENPE_HUMAN     ----------------------------------------------------------------------
CE290_BOVIN     ----------------------------------------------------------------------
CCPG1_CHICK     ----------------------------------------------------------------------
CC147_HUMAN     ----------------------------------------------------------------------
CACO1_RAT       ----------------------------------------------------------------------
C3H41_ARATH     ----------------------------------------------------------------------
BRE1_ASHGO      ----------------------------------------------------------------------
ATG16_XENTR     ----------------------------------------------------------------------
YQOE_CAEEL      ----------------------------------------------------------------------
Y4A0_ENCCU      ----------------------------------------------------------------------
TIG_PROM5       ----------------------------------------------------------------------
TAXB1_RAT       ----------------------------------------------------------------------
SYGP1_HUMAN     ----------------------------------------------------------------------
SYCP1_HUMAN     ----------------------------------------------------------------------
STAT3_CHICK     ----------------------------------------------------------------------
SMC6_MOUSE      ----------------------------------------------------------------------
SLMAP_HUMAN     ----------------------------------------------------------------------
QN1_HUMAN       ----------------------------------------------------------------------
OPTN_RAT        ----------------------------------------------------------------------
ODFP2_MOUSE     ----------------------------------------------------------------------
NEMO_BOVIN      ----------------------------------------------------------------------
NDEL1_XENTR     ----------------------------------------------------------------------
MYH2_PIG        ----------------------------------------------------------------------
MYH10_RAT       ----------------------------------------------------------------------
MYH10_MOUSE     ----------------------------------------------------------------------
KIF1_DICDI      ----------------------------------------------------------------------
GRAP1_RAT       ----------------------------------------------------------------------
FAT1_SCHPO      ----------------------------------------------------------------------
DIXC1_RAT       ----------------------------------------------------------------------
DCTN1_XENLA     ----------------------------------------------------------------------
CTTB2_RABIT     ----------------------------------------------------------------------
CLPB_HELPY      ----------------------------------------------------------------------
CEP63_PONAB     ----------------------------------------------------------------------
CEP63_MACFA     ----------------------------------------------------------------------
CEP63_HUMAN     ----------------------------------------------------------------------
CENPC_HUMAN     ----------------------------------------------------------------------
CCD69_XENTR     ----------------------------------------------------------------------
CACO2_BOVIN     ----------------------------------------------------------------------
BFR1_YEAST      ----------------------------------------------------------------------
AKAP9_HUMAN     ----------------------------------------------------------------------
AGLZ_MYXXD      ----------------------------------------------------------------------
ZIP1_YEAST      ----------------------------------------------------------------------
YB145_PLAF7     ----------------------------------------------------------------------
YA046_HUMAN     ----------------------------------------------------------------------
VIME_CHICK      ----------------------------------------------------------------------
UACA_HUMAN      ----------------------------------------------------------------------
TNNT2_RAT       ----------------------------------------------------------------------
T4AF1_HUMAN     ----------------------------------------------------------------------
SYCP1_MOUSE     ----------------------------------------------------------------------
RFIP4_MOUSE     ----------------------------------------------------------------------
RAD50_THEAC     ----------------------------------------------------------------------
RAD50_ARATH     ----------------------------------------------------------------------
PUMA_PARUN      ----------------------------------------------------------------------
PFDA_IGNH4      ----------------------------------------------------------------------
MYO5A_HUMAN     ----------------------------------------------------------------------
MYH10_HUMAN     ----------------------------------------------------------------------
MYH10_BOVIN     ----------------------------------------------------------------------
MD1L1_MOUSE     ----------------------------------------------------------------------
KIF15_STRPU     ----------------------------------------------------------------------
KI21A_HUMAN     ----------------------------------------------------------------------
GOGA2_HUMAN     ----------------------------------------------------------------------
EVI5_HUMAN      ----------------------------------------------------------------------
CING_XENTR      ----------------------------------------------------------------------
CING_XENLA      ----------------------------------------------------------------------
CI117_RAT       ----------------------------------------------------------------------
CC146_HUMAN     ----------------------------------------------------------------------
CAR14_HUMAN     ----------------------------------------------------------------------
BPAEA_MOUSE     ----------------------------------------------------------------------
ZWINT_RAT       ----------------------------------------------------------------------
ZWINT_MOUSE     ----------------------------------------------------------------------
YM92_CAEEL      ----------------------------------------------------------------------
YL139_YARLI     ----------------------------------------------------------------------
YA046_MOUSE     ----------------------------------------------------------------------
VIM4_XENLA      ----------------------------------------------------------------------
SYS_SYNE7       ----------------------------------------------------------------------
SYS_DESHY       ----------------------------------------------------------------------
SYCP2_MOUSE     ----------------------------------------------------------------------
SPC24_HUMAN     ----------------------------------------------------------------------
SHE9_ASHGO      ----------------------------------------------------------------------
RIMB1_HUMAN     ----------------------------------------------------------------------
RHG17_RAT       ----------------------------------------------------------------------
RHG17_MOUSE     ----------------------------------------------------------------------
P54_ENTFC       ----------------------------------------------------------------------
ODFP2_HUMAN     ----------------------------------------------------------------------
NFM_PIG         ----------------------------------------------------------------------
NFM_HUMAN       ----------------------------------------------------------------------
NDE1_DROME      ----------------------------------------------------------------------
MYH2_HUMAN      ----------------------------------------------------------------------
MYH2_HORSE      ----------------------------------------------------------------------
MTUS1_MOUSE     ----------------------------------------------------------------------
MEDB_GIALA      ----------------------------------------------------------------------
LCA5L_PAPAN     ----------------------------------------------------------------------
KLPA_EMENI      ----------------------------------------------------------------------
K1C10_RAT       ----------------------------------------------------------------------
HOOK_BRAFL      ----------------------------------------------------------------------
GAS8_RAT        ----------------------------------------------------------------------
EZRA_BACLD      ----------------------------------------------------------------------
EFG_YERPY       ----------------------------------------------------------------------
EFG_YERPS       ----------------------------------------------------------------------
EFG_YERPP       ----------------------------------------------------------------------
EFG_YERPN       ----------------------------------------------------------------------
EFG_YERPG       ----------------------------------------------------------------------
EFG_YERPE       ----------------------------------------------------------------------
EFG_YERPB       ----------------------------------------------------------------------
EFG_YERPA       ----------------------------------------------------------------------
EFG_YERP3       ----------------------------------------------------------------------
DEFI6_XENLA     ----------------------------------------------------------------------
CWLO_BACSU      ----------------------------------------------------------------------
CP135_DANRE     ----------------------------------------------------------------------
CK5P2_HUMAN     ---------------------EEDNLTYQHLLPESPEPSASHALSDYETSEKSFFSRDQKQDNETEKTSV
CCD93_XENTR     ----------------------------------------------------------------------
ATPF_DESDG      ----------------------------------------------------------------------
YDEM_CAEEL      ----------------------------------------------------------------------
YBAC_SCHPO      ----------------------------------------------------------------------
Y4862_ARATH     ----------------------------------------------------------------------
Y147_TNAVC      ----------------------------------------------------------------------
VIM1_XENLA      ----------------------------------------------------------------------
UACA_BOVIN      ----------------------------------------------------------------------
TMF1_MOUSE      ----------------------------------------------------------------------
TAXB1_BOVIN     ----------------------------------------------------------------------
ROCK1_RABIT     ----------------------------------------------------------------------
RBCC1_MOUSE     ----------------------------------------------------------------------
NFM_MOUSE       ----------------------------------------------------------------------
NFM_BOVIN       ----------------------------------------------------------------------
NDE1B_XENLA     ----------------------------------------------------------------------
NDC80_ASHGO     ----------------------------------------------------------------------
MYSP_ANISI      ----------------------------------------------------------------------
MYSA_DROME      ----------------------------------------------------------------------
MYH2_CANFA      ----------------------------------------------------------------------
MYH11_MOUSE     ----------------------------------------------------------------------
MIP1_ARATH      ----------------------------------------------------------------------
MAD1_DEBHA      ----------------------------------------------------------------------
K2C7_RAT        ----------------------------------------------------------------------
K2C7_MOUSE      ----------------------------------------------------------------------
K1C20_MOUSE     ----------------------------------------------------------------------
HOOK_DROMO      ----------------------------------------------------------------------
HAUS3_MOUSE     ----------------------------------------------------------------------
GG8L1_HUMAN     ----------------------------------------------------------------------
FBF1_CHICK      ----------------------------------------------------------------------
EDE1_YEAST      ----------------------------------------------------------------------
CTRO_HUMAN      ----------------------------------------------------------------------
CNPD_PELPD      ----------------------------------------------------------------------
CNPD_NITSB      ----------------------------------------------------------------------
CNPD_CHLTE      ----------------------------------------------------------------------
CING_MOUSE      ----------------------------------------------------------------------
CI117_MOUSE     ----------------------------------------------------------------------
CI117_HUMAN     ----------------------------------------------------------------------
CASP_MOUSE      ----------------------------------------------------------------------
CAO1B_XENLA     ----------------------------------------------------------------------
BRE1_DEBHA      ----------------------------------------------------------------------
BICD2_MOUSE     ----------------------------------------------------------------------
BICD2_HUMAN     ----------------------------------------------------------------------
AV71_ACAVI      ----------------------------------------------------------------------
APOA1_CHICK     ----------------------------------------------------------------------
ANR24_MOUSE     ----------------------------------------------------------------------
A16L1_MOUSE     ----------------------------------------------------------------------
YIBP_ECOLI      ----------------------------------------------------------------------
YF82_SCHPO      ----------------------------------------------------------------------
TNNT2_BOVIN     ----------------------------------------------------------------------
TG278_CAEEL     ----------------------------------------------------------------------
STX4_RAT        ----------------------------------------------------------------------
STX4_MOUSE      ----------------------------------------------------------------------
SPTA2_HUMAN     ----------------------------------------------------------------------
SMC4_XENLA      ----------------------------------------------------------------------
ROCK1_RAT       ----------------------------------------------------------------------
RIMB1_RAT       ----------------------------------------------------------------------
OPTN_HUMAN      ----------------------------------------------------------------------
NFM_RAT         ----------------------------------------------------------------------
MYOJ_DICDI      ----------------------------------------------------------------------
MYH4_PIG        ----------------------------------------------------------------------
MYH2_BOVIN      ----------------------------------------------------------------------
MYH1_HUMAN      ----------------------------------------------------------------------
MYH11_RAT       ----------------------------------------------------------------------
MYH11_HUMAN     ----------------------------------------------------------------------
MTUS1_PONAB     ----------------------------------------------------------------------
MCP3_SCHPO      ----------------------------------------------------------------------
LEKR1_HUMAN     ----------------------------------------------------------------------
LAML1_XENLA     ----------------------------------------------------------------------
KINH_HUMAN      ----------------------------------------------------------------------
KI21B_MOUSE     ----------------------------------------------------------------------
KI21B_HUMAN     ----------------------------------------------------------------------
KI15A_XENLA     ----------------------------------------------------------------------
K1C10_HUMAN     ----------------------------------------------------------------------
ESIP1_RAT       ----------------------------------------------------------------------
CUX1_HUMAN      ----------------------------------------------------------------------
CTTB2_FELCA     ----------------------------------------------------------------------
CNPD_STAS1      ----------------------------------------------------------------------
CLPB_CHRVO      ----------------------------------------------------------------------
CLIP2_MOUSE     ----------------------------------------------------------------------
CK5P2_PANTR     ---------------------EEDNLTYQHLLPESPEPSASHALSDYETSEKSFFSQDQKQDNETEKTSV
CIP2A_HUMAN     ----------------------------------------------------------------------
CCD57_MOUSE     ----------------------------------------------------------------------
CB039_HUMAN     ----------------------------------------------------------------------
CASP_PONAB      ----------------------------------------------------------------------
CASP_HUMAN      ----------------------------------------------------------------------
CACO1_MOUSE     ----------------------------------------------------------------------
ATK1_ARATH      ----------------------------------------------------------------------
ATG11_ASPFU     ----------------------------------------------------------------------
AP1_ARATH       ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           HANAMALGPLPREDGNLMLHLQRLETTLSVCAEEPDHGQLFTHLGRMALEFNRLASKVHKNEQRTSILQT
TNIP1_HUMAN     HANAMALGPLPREDGNLMLHLQRLETTLSVCAEEPDHGQLFTHLGRMALEFNRLASKVHKNEQRTSILQT
TNIP1_MOUSE     HTNMMDLGPPPPEDSNLKLHLQRLETTLSVCAEEPDHSQLFTHLGRMALEFNRLASKVHKNEQRTSILQT
TNIP3_HUMAN     ----------------------------------------------------------------------
CEP55_RAT       ----------------------------------------------------------------------
CEP55_MOUSE     ----------------------------------------------------------------------
TPR_HUMAN       --------------------------------------QLTEEIGRLKAEIARSNASLTNNQNLIQSLKE
HMW2_MYCPN      ----------------------------------------------------------------------
CEP55_HUMAN     ----------------------------------------------------------------------
MPP9_MOUSE      ----------------------------------------------------------------------
HMMR_RAT        ----------------------------------------------------------------------
IMH1_YEAST      ----------------------------------------------------------------------
CCD46_HUMAN     ----------------------------------------------------------------------
CCD46_MOUSE     ----------------------------------------------------------------------
CCD41_HUMAN     ----------------------------------------------------------------------
CC150_HUMAN     ------------QEQNLLLDAAHASITNELQTVQNEKTQLQAHLDHLILEHNQCIQKAQDAEKRTAVQKE
TNIP2_MOUSE     ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
CLIP1_HUMAN     --------------------------------ETAEFAELKTQIEKMRLDYQHEIENLQNQQDSERAAHA
SPTB2_MOUSE     ----------------------------------------------------------------------
SPTB2_HUMAN     ----------------------------------------------------------------------
SMC3_RAT        ----------------------------------------------------------------------
SMC3_PONAB      ----------------------------------------------------------------------
SMC3_MOUSE      ----------------------------------------------------------------------
SMC3_HUMAN      ----------------------------------------------------------------------
SMC3_BOVIN      ----------------------------------------------------------------------
SYCP3_MOUSE     ----------------------------------------------------------------------
RUD3_YEAST      ----------------------------------------------------------------------
MYSP_DERFA      ---------------------------------------------QIAQQLEDTRHRLEEEERKRASLEN
IFE_BRALA       ----------------------------------------------------------------------
FKB15_HUMAN     ----MAVSKVADKMDHLMTKVEELQKSMSVTMET---SMIMSNIQRIIQENERLKQEILEKSNRIEEQND
CTRO_MOUSE      ----------------------------------------------------------------------
CE290_DANRE     ----------------------------------------------------------------------
GOGA3_MOUSE     ----------------------------------------------------------------------
EZRI_RABIT      ----------------------------------------------------------------------
DMD_PIG         ----------------------------------------------------------------------
DMD_HUMAN       ----------------------------------------------------------------------
CP250_HUMAN     ----------------------------------------------------------------------
DIAP1_MOUSE     ----------------------------------------------------------------------
TNIP2_HUMAN     ----------------------------------------------------------------------
KIF15_RAT       ----------------------------------------------------------------------
MYH9_CHICK      ----------------------------------------------------------------------
USO1_YEAST      ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
M12_STRPY       EAHKDALGKLGIDNADLKAKITELEKSLSQIKKELEEAEKDIQFGREVH-----AADLLRHKQEIAEKEN
CROCC_MOUSE     ----------------------------------------------------------------------
CLIP1_CHICK     -------------------------------------------------------NKLNQKEEQFALMSS
QN1_RAT         ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
DMD_CANFA       ----------------------------------------------------------------------
CING_SORAR      ----------------------------------------------------------------------
CE164_HUMAN     ----------------------------------------------------------------------
SGM1_SCHPO      ----------------------------------------------------------------------
NF70_LOLPE      ----------------------------------------------------------------------
NF60_LOLPE      ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYO2_SCHPO      ----------------------------------------------------------------------
MYH8_MOUSE      ----------------------------------------------------------------------
GOGA5_RAT       ----------------------------------------------------------------------
GOGA5_HUMAN     ----------------------------------------------------------------------
GOGA4_HUMAN     ----------------------------------------------------------------------
FIL1L_HUMAN     ----------------------------------------------------------------------
TPM2_SCHMA      ----------------------------------------------------------------------
SYCP3_RAT       ----------------------------------------------------------------------
SMC4_DICDI      ----------------------------------------------------------------------
SAS6_DANRE      ----------------------------------------------------------------------
MLP1_YEAST      ----------------------------------------------------------------------
HMMR_MOUSE      ----------------------------------------------------------------------
CNPD_PELLD      ----------------------------------------------------------------------
PU92_SCICO      ----------------------------------------------------------------------
MYH8_HUMAN      ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------RLLNKLKEDYDRLKIASL
GCOM1_XENTR     ----------------------------------------------------------------------
CEP63_CHICK     ----------------------------------------------------------------------
CC150_MOUSE     ------------QEQNLLLDAAHASITGELQAVQNEKAQLQIHLDHLILEHNQCLQKSQEAEKRTVVQKE
BPA1_HUMAN      ----------------------------------------------------------------------
ALM1_SCHPO      ----------------------------------------------------------------------
SYCP3_MESAU     ----------------------------------------------------------------------
MYH8_CANFA      ----------------------------------------------------------------------
MYH3_MOUSE      ----------------------------------------------------------------------
KIF7_HUMAN      ----------------------------------------------------------------------
KIF15_MOUSE     ----------------------------------------------------------------------
DMD_MOUSE       ----------------------------------------------------------------------
CUX2_HUMAN      ----------------------------------------------------------------------
CNPD_PROVI      ----------------------------------------------------------------------
APSB_EMENI      ----------------------------------------------------------------------
SAS6_CHICK      ----------------------------------------------------------------------
NUF1_YEAST      ----------------------------------------------------------------------
MYO1_CAEEL      ----------------------------------------------------------------------
MYH7_RAT        ----------------------------------------------------------------------
MYH7_PAPHA      ----------------------------------------------------------------------
MYH7_MOUSE      ----------------------------------------------------------------------
MYH7_MESAU      ----------------------------------------------------------------------
MYH7_HUMAN      ----------------------------------------------------------------------
MYH7_CANFA      ----------------------------------------------------------------------
MYH3_RAT        ----------------------------------------------------------------------
MYH3_HUMAN      ----------------------------------------------------------------------
MRCKB_HUMAN     ----------------------------------------------------------------------
MRCKA_HUMAN     ----------------------------------------------------------------------
MPP9_HUMAN      ----------------------------------------------------------------------
IMH1_ASHGO      ----------------------------------------------------------------------
IFA1_CAEEL      ----------------------------------------------------------------------
GRDN_MOUSE      ----------------------------------------------------------------------
GOGA3_HUMAN     ----------------------------------------------------------------------
GOGA1_HUMAN     ----------------------------------------------------------------------
FKB15_MOUSE     ----------------------------------------------------------------------
CP250_MOUSE     ----------------------------------------------------------------------
CGNL1_HUMAN     ----------------------------------------------------------------------
BRE1_ASPFU      EKQKEQLQKLESENANLLSQI----TELNIKRTKPDDDYAHTDL------FKQLRSQYDDVVKRINHLEA
UACA_CANFA      ----------------------------------------------------------------------
SWP70_CHICK     ----------------------------------------------------------------------
SMC2_HUMAN      ----------------------------------------------------------------------
NEMO_DROME      ----------------------------------------------------------------------
MRCKA_RAT       ----------------------------------------------------------------------
BRE1_CRYNE      ----------------------------------------------------------------------
TAXB1_PONAB     --------------------------------------------------FSDATSKAHQLEE--DIVSV
SMC1_YEAST      ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
MYH9_RAT        ----------------------------------------------------------------------
MYH9_MOUSE      ----------------------------------------------------------------------
MRCKB_MOUSE     ----------------------------------------------------------------------
GFAP_DANRE      ----------------------------------------------------------------------
GFAP_CARAU      ----------------------------------------------------------------------
EFG_ACIAC       ----------------------------------------------------------------------
EEA1_HUMAN      ----------------------------------------------------------------------
DAPLE_XENLA     ----------------------------------------------------------------------
CE290_HUMAN     ----------------------------------------------------------------------
CACO1_BOVIN     ----------------------------------------------------------------------
ANT1_ONCVO      ----------------------------------------------------------------------
YNP9_CAEEL      -----------------------------------------------------LARKMAESENRGRILEE
VIME_RAT        ----------------------------------------------------------------------
VIME_MOUSE      ----------------------------------------------------------------------
VIME_MESAU      ----------------------------------------------------------------------
VIME_CRIGR      ----------------------------------------------------------------------
VIME_BOVIN      ----------------------------------------------------------------------
SPTCB_DROME     ----------------------------------------------------------------------
NIN_MOUSE       ----------------------------------------------------------------------
MYSN_DROME      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
MYO2_CAEEL      ----------------------------------------------------------------------
MYH6_RAT        ----------------------------------------------------------------------
LIPA1_HUMAN     ----------------------------------------------------------------------
K1C9_HUMAN      ----------------------------------------------------------------------
HOOK3_MOUSE     ----------------------------------------------------------------------
HOOK3_HUMAN     ----------------------------------------------------------------------
HMW2_MYCGE      ----------------------------------------------------------------------
HIP1_HUMAN      ----------------------------------------------------------------------
GRDN_HUMAN      ---------------NMALHLKRL------IDERDEHSETIIELSRDGLHFLPHASSSAQSPKRTESRQH
GPTC8_MOUSE     ----------------------------------------------------------------------
GPTC8_HUMAN     ----------------------------------------------------------------------
CP135_HUMAN     ----------------------------------------------------------------------
CNPD_CHLPD      ----------------------------------------------------------------------
CASC4_CHICK     ----------------------------------------------------------------------
WAP_ARATH       ----------------------------------------------------------------------
TAXB1_HUMAN     --------------------------------------------------FSDATSKAHQLEE--DIVSV
SYCP3_MACFA     ----------------------------------------------------------------------
ROCK2_MOUSE     ----------------------------------------------------------------------
NDE1_CHICK      ----------------------------------------------------------------------
MYH8_RAT        ----------------------------------------------------------------------
MYH7_PIG        ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
MYH6_HUMAN      ----------------------------------------------------------------------
MRCKA_MOUSE     ----------------------------------------------------------------------
LIPB1_MOUSE     ----------------------------------------------------------------------
KINH_DROME      ----------------------------------------------------------------------
K1C9_RAT        ----------------------------------------------------------------------
GRIP_ARATH      ----------------------------------------------------------------------
GOGA1_MOUSE     ----------------------------------------------------------------------
FIL1L_MOUSE     ----------------------------------------------------------------------
EVI5L_HUMAN     ------------------------------------------------LEKEYAAMKSKEMEEQIEI---
DESP_HUMAN      ----------------------------------------------------------------------
CD158_HUMAN     ----------------------------------------------------------------------
CCHCR_MOUSE     ----------------------------------------------------------------------
CCD41_RAT       ----------------------------------------------------------------------
YOND_BACSU      ----------------------------------------------------------------------
VIME_ONCMY      ----------------------------------------------------------------------
SMC_BACSU       ----------------------------------------------------------------------
SMC2_XENLA      ----------------------------------------------------------------------
SKI_XENLA       ----------------------------------------------------------------------
SBCC_BACSU      ----------------------------------------------------------------------
RB6I2_HUMAN     ----------------------------------------------------------------------
PLST_CARAU      ----------------------------------------------------------------------
OPTN_CHICK      ----------------------------------------------------------------------
MYSP_MYTGA      ----------------------------------------------------------------------
MYSP_CAEEL      ----------------------------------------------------------------------
MYH6_MOUSE      ----------------------------------------------------------------------
MY18A_MOUSE     ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
KINH_SYNRA      RENELMISEKETELTNREKLLESLREEMGYYKEQEENQQMTSELSELRLQLQKVSYESKENAITVDSLKE
EP15R_MOUSE     ----------------------------------------------------------------------
EEA1_MOUSE      ----------------------------------------------------------------------
CUT_CAEEL       ----------------------------------------------------------------------
CGNL1_MOUSE     -----------------------------------------------------LASRSNSSEQSQAEADL
CCD41_MOUSE     ----------------------------------------------------------------------
CCD18_HUMAN     ----------------------------------------------------------------------
CC151_BOVIN     ----------------------------------------------------------------------
CASP_CAEEL      ----------------------------------------------------------------------
ATG11_PICST     ----------------------------------------------------------------------
Y1002_CHLCV     ----------------------------------------------------------------------
VIME_PANTR      ----------------------------------------------------------------------
VIME_MACFA      ----------------------------------------------------------------------
VIME_HUMAN      ----------------------------------------------------------------------
VIME_CERAE      ----------------------------------------------------------------------
SMC2_MOUSE      ----------------------------------------------------------------------
OPTN_MOUSE      ----------------------------------------------------------------------
OPTN_DANRE      ----------------------------------------------------------------------
NDE1_HUMAN      ----------------------------------------------------------------------
MYO5C_HUMAN     ----------------------------------------------------------------------
MYH9_HUMAN      ----------------------------------------------------------------------
MYH9_CANFA      ----------------------------------------------------------------------
MYH13_HUMAN     ----------------------------------------------------------------------
EP15R_HUMAN     ----------------------------------------------------------------------
DZIP1_DANRE     ----------------------------------------------------------------------
DIAP1_HUMAN     ----------------------------------------------------------------------
CD158_MOUSE     ----------------------------------------------------------------------
SYCP3_HUMAN     ----------------------------------------------------------------------
MYS_AEQIR       ----------------------------------------------------------------------
MYH7_HORSE      ----------------------------------------------------------------------
MYH6_MESAU      ----------------------------------------------------------------------
MYH13_CANFA     ----------------------------------------------------------------------
MY18A_HUMAN     ---------------------QRLTAELQDTKLHLEGQQVRNHLEKKQRRFDSELSQAHEEAQREKLQR-
MOES_LYTVA      ----------------------------------------------------------------------
MLP2_YEAST      ----------------------------------------------------------------------
MFP1_ARATH      ----------------------------------------------------------------------
LRCC1_MOUSE     ----------------------------------------------------------------------
KIF7_DANRE      ----------------------------------------------------------------------
GOGA4_MOUSE     ----------------------------------------------------------------------
FLIP1_HUMAN     ----------------------------------------------------------------------
SGM1_YEAST      ----------------------------------------------------------------------
ROCK2_RAT       ----------------------------------------------------------------------
NDE1_XENTR      ----------------------------------------------------------------------
MYSP_BRUMA      ----------------------------------------------------------------------
MYO1_YEAST      ----------------------------------------------------------------------
ITSN1_XENLA     ----------------------------------------------------------------------
GOGA5_MOUSE     ----------------------------------------------------------------------
GCC2_MOUSE      ----------------------------------------------------------------------
GCC2_HUMAN      ----------------------------------------------------------------------
ETP1_YEAST      ----------------------------------------------------------------------
CTK2_XENLA      ----------------------------------------------------------------------
CC146_RAT       ----------------------------------------------------------------------
SPDLY_MACFA     ----------------------------------------------------------------------
RRBP1_MOUSE     ----------------------------------------------------------------------
RMUC_NEIMA      ----------------------------------------------------------------------
OPTN_XENLA      ----------------------------------------------------------------------
NUF2_EMENI      ----------------------------------------------------------------------
MYSP_SARSC      ----------------------------------------------------------------------
MYO4_CAEEL      ----------------------------------------------------------------------
MOEH_CULQU      ----------------------------------------------------------------------
MAD1_YARLI      ----------------------------------------------------------------------
KIF8_DICDI      ----------------------------------------------------------------------
KIF4_XENLA      ----------------------------------------------------------------------
K1C10_MOUSE     ----------------------------------------------------------------------
HOOK_AEDAE      ----------------------------------------------------------------------
DCTN1_CHICK     ----------------------------------------------------------------------
CENPE_MOUSE     ----------------------------------------------------------------------
CD72_HUMAN      ----------------------------------------------------------------------
CCD68_HUMAN     ----------------------------------------------------------------------
CACO1_DANRE     ----------------------------------------------------------------------
ANR26_HUMAN     ------------------------EKTLGLERVQKDLSQTQCQMKEMEQKYQNEQVKVNKYIGKQESVEE
XNIF_XENLA      ----------------------------------------------------------------------
TRIPB_HUMAN     ----------------------------------------------------------------------
TPM_MIMNO       ----------------------------------------------------------------------
ROCK2_HUMAN     ----------------------------------------------------------------------
PMFBP_MOUSE     ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
NU211_SCHPO     ----------------------------------------------------------------------
NMCP_ARATH      ----------------------------------------------------------------------
NDC80_NEUCR     ----------------------------------------------------------------------
MYSU_RABIT      ----------------------------------------------------------------------
MYSP_ONCVO      ----------------------------------------------------------------------
KIF15_HUMAN     ----------------------------------------------------------------------
KI20B_MOUSE     ----------------------------------------------------------------------
K1C15_PROAT     ----------------------------------------------------------------------
HOOK_CULQU      ----------------------------------------------------------------------
HOOK2_HUMAN     ----------------------------------------------------------------------
FBF1_HUMAN      ----------------------------------------------------------------------
CUX1_MOUSE      ----------------------------------------------------------------------
CTGE5_MOUSE     ----------------------------------------------------------------------
CT2NL_PONAB     ----------------------------------------------------------------------
CT2NL_HUMAN     ----------------------------------------------------------------------
CROL2_HUMAN     ----------------------------------------------------------------------
CNTLN_HUMAN     ----------------------------------------------------------------------
CING_CANFA      ----------------------------------------------------------------------
YD72_SCHPO      ----------------------------------------------------------------------
WIT2_ARATH      ----------------------------------------------------------------------
TANA_XENLA      ----------------------------------------------------------------------
STX4_BOVIN      ----------------------------------------------------------------------
ROCK1_BOVIN     ----------------------------------------------------------------------
RAD50_SULSO     ----------------------------------------------------------------------
PLPA_MYCGA      ----------------------------------------------------------------------
NIN_HUMAN       ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYSP_DIRIM      ----------------------------------------------------------------------
MYSP_BLOTA      ----------------------------------------------------------------------
MTS1A_DANRE     ----------------------------------------------------------------------
MEU1_SCHPO      ----------------------------------------------------------------------
MBO1_SCHPO      ----------------------------------------------------------------------
KIFC1_MOUSE     ----------------------------------------------------------------------
HOOK3_XENLA     ----------------------------------------------------------------------
HOOK1_CHICK     ----------------------------------------------------------------------
GCOM1_HUMAN     ----------------------------------------------------------------------
FBF1_MOUSE      ----------------------------------------------------------------------
CYTSA_TAKRU     ----------------------------------------------------------------------
CCD91_RAT       ----------------------------------------------------------------------
ATG11_NEUCR     ----------------------------------------------------------------------
YOMI_BACSU      ----------------------------------------------------------------------
YG3A_YEAST      ----------------------------------------------------------------------
SPDLY_HUMAN     ----------------------------------------------------------------------
SPC25_CANAL     ----------------------------------------------------------------------
ROCK2_BOVIN     ----------------------------------------------------------------------
RMUC_NEIMB      ----------------------------------------------------------------------
NUF2_ASPFU      ----------------------------------------------------------------------
NEMO_RAT        ----------------------------------------------------------------------
NDE1_RAT        ----------------------------------------------------------------------
MYSS_RABIT      ----------------------------------------------------------------------
MYSP_BOOMI      ----------------------------------------------------------------------
MIX1_CAEEL      ----------------------------------------------------------------------
LRC45_MOUSE     ----------------------------------------------------------------------
KINH_RAT        -----------RDQDNMQAELNRLQAENDASKEEVK--EVLQALEELAVNYDQKSQEV---EDKTKEYEL
KIF4_CHICK      ----------------------------------------------------------------------
KI20B_HUMAN     ----------------------------------------------------------------------
K1C9_CANFA      ----------------------------------------------------------------------
K1C10_CANFA     ----------------------------------------------------------------------
IFEB_ASCSU      ----------------------------------------------------------------------
HMMR_HUMAN      ----------------------------------------------------------------------
GAS8_BOVIN      ----------------------------------------------------------------------
FIP37_ARATH     ----------------------------------------------------------------------
CCD18_MOUSE     ----------------------------------------------------------------------
APOA1_COTJA     ----------------------------------------------------------------------
Y451_HELPY      ----------------------------------------------------------------------
VIMB_CARAU      ----------------------------------------------------------------------
SYCP1_MESAU     ----------------------------------------------------------------------
STAT3_RAT       ----------------------------------------------------------------------
STAT3_PIG       ----------------------------------------------------------------------
STAT3_MOUSE     ----------------------------------------------------------------------
STAT3_HUMAN     ----------------------------------------------------------------------
RUFY2_PONAB     ----------------------------------------------------------------------
RUFY2_HUMAN     ----------------------------------------------------------------------
PIBF1_HUMAN     ----------------------------------------------------------------------
PHLB2_MOUSE     ----------------------------------------------------------------------
PHLB2_HUMAN     ----------------------------------------------------------------------
ODFP2_RAT       ----------------------------------------------------------------------
ODF2L_MOUSE     ----------------------------------------------------------------------
NDL1A_XENLA     ----------------------------------------------------------------------
MYS3_HYDAT      ----------------------------------------------------------------------
LAMB4_DANRE     ----------------------------------------------------------------------
KTN1_CHICK      --------------------LQKLFPNVSLPANV-SHSEWICGFEKMAKEYLRGASKLKEAEELHILLQL
KIF5C_MOUSE     ----------------------------------------------------------------------
KIF4_MOUSE      ----------------------------------------------------------------------
KIF27_MOUSE     ----------------------------------------------------------------------
K1C20_RAT       ----------------------------------------------------------------------
K1C10_BOVIN     ----------------------------------------------------------------------
F184B_HUMAN     ----------------------------------------------------------------------
EFG_AZOSB       ----------------------------------------------------------------------
DCTN1_DROME     ----------------------------------------------------------------------
CNPD_ARCB4      ----------------------------------------------------------------------
CLIP1_MOUSE     ----------------------------------------------------------------------
CENPJ_PANTR     ----------------------------------------------------------------------
CENPF_HUMAN     ----------------------------------------------------------------------
CENPE_HUMAN     ----------------------------------------------------------------------
CE290_BOVIN     ----------------------------------------------------------------------
CCPG1_CHICK     ----------------------------------------------------------------------
CC147_HUMAN     ----------------------------------------------------------------------
CACO1_RAT       ----------------------------------------------------------------------
C3H41_ARATH     ----------------------------------------------------------------------
BRE1_ASHGO      ----------------------------------------------------------------------
ATG16_XENTR     ----------------------------------------------------------------------
YQOE_CAEEL      ----------------------------------------------------------------------
Y4A0_ENCCU      ----------------------------------------------------------------------
TIG_PROM5       ----------------------------------------------------------------------
TAXB1_RAT       ----------------------------------------------------------------------
SYGP1_HUMAN     ----------------------------------------------------------------------
SYCP1_HUMAN     ----------------------------------------------------------------------
STAT3_CHICK     ----------------------------------------------------------------------
SMC6_MOUSE      ----------------------------------------------------------------------
SLMAP_HUMAN     ----------------------------------------------------------------------
QN1_HUMAN       ----------------------------------------------------------------------
OPTN_RAT        ----------------------------------------------------------------------
ODFP2_MOUSE     ----------------------------------------------------------------------
NEMO_BOVIN      ----------------------------------------------------------------------
NDEL1_XENTR     ----------------------------------------------------------------------
MYH2_PIG        ----------------------------------------------------------------------
MYH10_RAT       ----------------------------------------------------------------------
MYH10_MOUSE     ----------------------------------------------------------------------
KIF1_DICDI      ----------------------------------------------------------------------
GRAP1_RAT       ----------------------------------------------------------------------
FAT1_SCHPO      ----------------------------------------------------------------------
DIXC1_RAT       ----------------------------------------------------------------------
DCTN1_XENLA     ----------------------------------------------------------------------
CTTB2_RABIT     ----------------------------------------------------------------------
CLPB_HELPY      ----------------------------------------------------------------------
CEP63_PONAB     ----------------------------------------------------------------------
CEP63_MACFA     ----------------------------------------------------------------------
CEP63_HUMAN     ----------------------------------------------------------------------
CENPC_HUMAN     ----------------------------------------------------------------------
CCD69_XENTR     ----------------------------------------------------------------------
CACO2_BOVIN     ----------------------------------------------------------------------
BFR1_YEAST      ----------------------------------------------------------------------
AKAP9_HUMAN     ----------------------------------------------------------------------
AGLZ_MYXXD      ----------------------------------------------------------------------
ZIP1_YEAST      ----------------------------------------------------------------------
YB145_PLAF7     ----------------------------------------------------------------------
YA046_HUMAN     ----------------------------------------------------------------------
VIME_CHICK      ----------------------------------------------------------------------
UACA_HUMAN      ----------------------------------------------------------------------
TNNT2_RAT       ----------------------------------------------------------------------
T4AF1_HUMAN     ----------------------------------------------------------------------
SYCP1_MOUSE     ----------------------------------------------------------------------
RFIP4_MOUSE     ----------------------------------------------------------------------
RAD50_THEAC     ----------------------------------------------------------------------
RAD50_ARATH     ----------------------------------------------------------------------
PUMA_PARUN      ----------------------------------------------------------------------
PFDA_IGNH4      ----------------------------------------------------------------------
MYO5A_HUMAN     ----------------------------------------------------------------------
MYH10_HUMAN     ----------------------------------------------------------------------
MYH10_BOVIN     ----------------------------------------------------------------------
MD1L1_MOUSE     ----------------------------------------------------------------------
KIF15_STRPU     ----------------------------------------------------------------------
KI21A_HUMAN     ----------------------------------------------------------------------
GOGA2_HUMAN     ----------------------------------------------------------------------
EVI5_HUMAN      ----------------------------------------------------------------------
CING_XENTR      ----------------------------------------------------------------------
CING_XENLA      ----------------------------------------------------------------------
CI117_RAT       ----------------------------------------------------------------------
CC146_HUMAN     ----------------------------------------------------------------------
CAR14_HUMAN     ----------------------------------------------------------------------
BPAEA_MOUSE     ----------------------------------------------------------------------
ZWINT_RAT       ----------------------------------------------------------------------
ZWINT_MOUSE     ----------------------------------------------------------------------
YM92_CAEEL      ----------------------------------------------------------------------
YL139_YARLI     ----------------------------------------------------------------------
YA046_MOUSE     ----------------------------------------------------------------------
VIM4_XENLA      ----------------------------------------------------------------------
SYS_SYNE7       ----------------------------------------------------------------------
SYS_DESHY       ----------------------------------------------------------------------
SYCP2_MOUSE     ----------------------------------------------------------------------
SPC24_HUMAN     ----------------------------------------------------------------------
SHE9_ASHGO      ----------------------------------------------------------------------
RIMB1_HUMAN     ----------------------------------------------------------------------
RHG17_RAT       ----------------------------------------------------------------------
RHG17_MOUSE     ----------------------------------------------------------------------
P54_ENTFC       ----------------------------------------------------------------------
ODFP2_HUMAN     ----------------------------------------------------------------------
NFM_PIG         ----------------------------------------------------------------------
NFM_HUMAN       ----------------------------------------------------------------------
NDE1_DROME      ----------------------------------------------------------------------
MYH2_HUMAN      ----------------------------------------------------------------------
MYH2_HORSE      ----------------------------------------------------------------------
MTUS1_MOUSE     ----------------------------------------------------------------------
MEDB_GIALA      ----------------------------------------------------------------------
LCA5L_PAPAN     ----------------------------------------------------------------------
KLPA_EMENI      ----------------------------------------------------------------------
K1C10_RAT       ----------------------------------------------------------------------
HOOK_BRAFL      ----------------------------------------------------------------------
GAS8_RAT        ----------------------------------------------------------------------
EZRA_BACLD      ----------------------------------------------------------------------
EFG_YERPY       ----------------------------------------------------------------------
EFG_YERPS       ----------------------------------------------------------------------
EFG_YERPP       ----------------------------------------------------------------------
EFG_YERPN       ----------------------------------------------------------------------
EFG_YERPG       ----------------------------------------------------------------------
EFG_YERPE       ----------------------------------------------------------------------
EFG_YERPB       ----------------------------------------------------------------------
EFG_YERPA       ----------------------------------------------------------------------
EFG_YERP3       ----------------------------------------------------------------------
DEFI6_XENLA     ----------------------------------------------------------------------
CWLO_BACSU      ----------------------------------------------------------------------
CP135_DANRE     ----------------------------------------------------------------------
CK5P2_HUMAN     MVNSFS-------QDLLMEHIQEIRTLRKRLEESKTNEKLRKQLERQGSEFVQGSTSIFASSELHSSLTS
CCD93_XENTR     ----------------------------------------------------------------------
ATPF_DESDG      ----------------------------------------------------------------------
YDEM_CAEEL      ----------------------------------------------------------------------
YBAC_SCHPO      ----------------------------------------------------------------------
Y4862_ARATH     ----------------------------------------------------------------------
Y147_TNAVC      ----------------------------------------------------------------------
VIM1_XENLA      ----------------------------------------------------------------------
UACA_BOVIN      --NEMLVEEFKRDEGKLMEENKRLQKELSMCELEREEGQLKDLSAKLALELNEKAKKLIDVEREYERSLN
TMF1_MOUSE      ----------------------------------------------------------------------
TAXB1_BOVIN     --------------------------------------------------YNDVTSKALQLEE--DIVSV
ROCK1_RABIT     ----------------------------------------------------------------------
RBCC1_MOUSE     ----------------------------------------------------------------------
NFM_MOUSE       ----------------------------------------------------------------------
NFM_BOVIN       ----------------------------------------------------------------------
NDE1B_XENLA     ----------------------------------------------------------------------
NDC80_ASHGO     ----------------------------------------------------------------------
MYSP_ANISI      ----------------------------------------------------------------------
MYSA_DROME      ----------------------------------------------------------------------
MYH2_CANFA      ----------------------------------------------------------------------
MYH11_MOUSE     ----------------------------------------------------------------------
MIP1_ARATH      ----------------------------------------------------------------------
MAD1_DEBHA      ----------------------------------------------------------------------
K2C7_RAT        ----------------------------------------------------------------------
K2C7_MOUSE      ----------------------------------------------------------------------
K1C20_MOUSE     ----------------------------------------------------------------------
HOOK_DROMO      ----------------------------------------------------------------------
HAUS3_MOUSE     ----------------------------------------------------------------------
GG8L1_HUMAN     ----------------------------------------------------------------------
FBF1_CHICK      ----------------------------------------------------------------------
EDE1_YEAST      ----------------------------------------------------------------------
CTRO_HUMAN      ----------------------------------------------------------------------
CNPD_PELPD      ----------------------------------------------------------------------
CNPD_NITSB      ----------------------------------------------------------------------
CNPD_CHLTE      ----------------------------------------------------------------------
CING_MOUSE      ----------------------------------------------------------------------
CI117_MOUSE     ----------------------------------------------------------------------
CI117_HUMAN     ----------------------------------------------------------------------
CASP_MOUSE      ----------------------------------------------------------------------
CAO1B_XENLA     ----------------------------------------------------------------------
BRE1_DEBHA      ----------------------------------------------------------------------
BICD2_MOUSE     ----------------------------------------------------------------------
BICD2_HUMAN     ----------------------------------------------------------------------
AV71_ACAVI      ----------------------------------------------------------------------
APOA1_CHICK     ----------------------------------------------------------------------
ANR24_MOUSE     ----------------------------------------------------------------------
A16L1_MOUSE     ----------------------------------------------------------------------
YIBP_ECOLI      ----------------------------------------------------------------------
YF82_SCHPO      ----------------------------------------------------------------------
TNNT2_BOVIN     ----------------------------------------------------------------------
TG278_CAEEL     ----------------------------------------------------------------------
STX4_RAT        ----------------------------------------------------------------------
STX4_MOUSE      ----------------------------------------------------------------------
SPTA2_HUMAN     ----------------------------------------------------------------------
SMC4_XENLA      ----------------------------------------------------------------------
ROCK1_RAT       ----------------------------------------------------------------------
RIMB1_RAT       ----------------------------------------------------------------------
OPTN_HUMAN      ----------------------------------------------------------------------
NFM_RAT         ----------------------------------------------------------------------
MYOJ_DICDI      ----------------------------------------------------------------------
MYH4_PIG        ----------------------------------------------------------------------
MYH2_BOVIN      ----------------------------------------------------------------------
MYH1_HUMAN      ----------------------------------------------------------------------
MYH11_RAT       ----------------------------------------------------------------------
MYH11_HUMAN     ----------------------------------------------------------------------
MTUS1_PONAB     ----------------------------------------------------------------------
MCP3_SCHPO      ----------------------------------------------------------------------
LEKR1_HUMAN     ----------------------------------------------------------------------
LAML1_XENLA     ----------------------------------------------------------------------
KINH_HUMAN      ----------------------------------------------------------------------
KI21B_MOUSE     ----------------------------------------------------------------------
KI21B_HUMAN     ----------------------------------------------------------------------
KI15A_XENLA     ----------------------------------------------------------------------
K1C10_HUMAN     ----------------------------------------------------------------------
ESIP1_RAT       ----------------------------------------------------------------------
CUX1_HUMAN      ----------------------------------------------------------------------
CTTB2_FELCA     ----------------------------------------------------------------------
CNPD_STAS1      ----------------------------------------------------------------------
CLPB_CHRVO      ----------------------------------------------------------------------
CLIP2_MOUSE     ----------------------------------------------------------------------
CK5P2_PANTR     MVNNFS-------QDLLMEHIQEIRTLRKRLEESKTNEKLRKQLERQGSEFDQGSTNIFASSELHSSLTS
CIP2A_HUMAN     ----------------------------------------------------------------------
CCD57_MOUSE     ----------------------------------------------------------------------
CB039_HUMAN     ----------------------------------------------------------------------
CASP_PONAB      ----------------------------------------------------------------------
CASP_HUMAN      ----------------------------------------------------------------------
CACO1_MOUSE     ----------------------------------------------------------------------
ATK1_ARATH      ----------------------------------------------------------------------
ATG11_ASPFU     ----------------------------------------------------------------------
AP1_ARATH       ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LCEQLRKENEALKAKLDKGLEQRDQAAXXXXXXXXXXXXXXMSNGNKEGASGRPGSPKMEGTGKKAVAGQ
TNIP1_HUMAN     LCEQLRKENEALKAKLDKGLEQRDQAAXXXXXXXXXXXXXXMSNGNKEGASGRPGSPKMEGTGKKAVAGQ
TNIP1_MOUSE     LCEQLRQENEALKAKLDKGLEQRDLAAERLREENTELKKLLMNSSCKEGLCGQPSSPKPEXXXXXXXXXX
TNIP3_HUMAN     ----------------------------------------------------------------------
CEP55_RAT       ----------------------------------------------------------------------
CEP55_MOUSE     ----------------------------------------------------------------------
TPR_HUMAN       DLNKVRTEKETIQKDLDAKIIDIQEKVKTITQVKKIGRRYKTQYEELKAQQD-----KVMETSAQSSGDH
HMW2_MYCPN      ----------------------------------------------------------------------
CEP55_HUMAN     ----------------------------------------------------------------------
MPP9_MOUSE      -----------------------------------------------------------ENTVTVASVSQ
HMMR_RAT        ----------------------------------------------------------------------
IMH1_YEAST      ----------------------------------------------------------------------
CCD46_HUMAN     ----------------------------------------------------------------------
CCD46_MOUSE     ----------------------------------------------------------------------
CCD41_HUMAN     ----------------------------------------------------------------------
CC150_HUMAN     LLERLRGELEASMQEKKSLLEEKERAKNKVDINTLTHNLQTLEEENKHLADQMASLELQQVTSDHGLAQQ
TNIP2_MOUSE     ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
CLIP1_HUMAN     ------KEMEALRAKLMKVIKEKENSLEAIR--------------SKLDKAEDQHLVEMEDTLNKL----
SPTB2_MOUSE     ----------------------------------------------------------------------
SPTB2_HUMAN     ----------------------------------------------------------------------
SMC3_RAT        ----------------------------------------------------------------------
SMC3_PONAB      ----------------------------------------------------------------------
SMC3_MOUSE      ----------------------------------------------------------------------
SMC3_HUMAN      ----------------------------------------------------------------------
SMC3_BOVIN      ----------------------------------------------------------------------
SYCP3_MOUSE     ----------------------------------------------------------------------
RUD3_YEAST      ----------------------------------------------------------------------
MYSP_DERFA      HAHTLEVELESLKVQLDEESEARLELERQ------------LTKANGDAASWK--SKYEAELQAHADEVE
IFE_BRALA       ----------------------------------------------------------------------
FKB15_HUMAN     KISELIERNQRYVEQSNLMMEKR--------------------NNSLQTATENTQARVLHAEQEKAKVTE
CTRO_MOUSE      -----------------------------------------------------------EGIKKKLVEAE
CE290_DANRE     ----------------------------------------------------------------------
GOGA3_MOUSE     ----------------------------------------------------------------------
EZRI_RABIT      ----------------------------------------------------------------------
DMD_PIG         ----------------------------------------------------------------------
DMD_HUMAN       ----------------------------------------------------------------------
CP250_HUMAN     --EDLRTARSALKLKNEEVESERERAQAL------------QEQGELKVAQGKALQENLALLTQTLAERE
DIAP1_MOUSE     ----------------------------------------------------------------------
TNIP2_HUMAN     ----------------------------------------------------------------------
KIF15_RAT       --------------------------------------------------SGLLQSAQEELTKKEALIQE
MYH9_CHICK      ----------------------------------------------------------------------
USO1_YEAST      ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
M12_STRPY       VISKLNGELQPLKQKVDRNLQQEKQKVLSLEQQLAVTK----ENAKKDFELAALGHQLADKEYNAKIAEL
CROCC_MOUSE     ----------------------------------------------------------------------
CLIP1_CHICK     ELEQLKSNLTVMETKLKEREEREQQLTEAKVKLENDIAEIMKSSGD---SSAQLMKMNDELRLKERQLEQ
QN1_RAT         ----------------------------------------------------------------------
GOGB1_HUMAN     ---------------------------------------------------------------RKSEEGK
DMD_CANFA       ----------------------------------------------------------------------
CING_SORAR      --------------------------------------------------------------------GK
CE164_HUMAN     ----------------------------------------------------------------------
SGM1_SCHPO      ----------------------------------------------------------------------
NF70_LOLPE      ----------------------------------------------------------------------
NF60_LOLPE      ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYO2_SCHPO      ----------------------------------------------------------------------
MYH8_MOUSE      ----------------------------------------------------------------------
GOGA5_RAT       ----------------------------------------------------------------------
GOGA5_HUMAN     ----------------------------------------------------------------------
GOGA4_HUMAN     ----------------------------------------------------------------------
FIL1L_HUMAN     ----------------------------------------------------------------------
TPM2_SCHMA      ----------------------------------------------------------------------
SYCP3_RAT       ----------------------------------------------------------------------
SMC4_DICDI      ---------------------------------------------------------------KNEIAAK
SAS6_DANRE      ----------------------------------------------------------------------
MLP1_YEAST      ----------------------------------------------------------------------
HMMR_MOUSE      ----------------------------------------------------------------------
CNPD_PELLD      ----------------------------------------------------------------------
PU92_SCICO      ----------------------------------------------------------------------
MYH8_HUMAN      ----------------------------------------------------------------------
HMW2_MYCGA      SFESMRKQSLAALNNLQDELKQKHN----------------LLERKKHEQDGIVNEKISELEGYRSDLVD
GCOM1_XENTR     ----------------------------------------------------------------------
CEP63_CHICK     ----------------------------------------------------------------------
CC150_MOUSE     LLESIARLQGELKASLQKSLLEKNE-----------WFQREINKTEKEVAKEKCNLEK------------
BPA1_HUMAN      ----------------------------------------------------------------------
ALM1_SCHPO      ----------------------------------------------------------------------
SYCP3_MESAU     ----------------------------------------------------------------------
MYH8_CANFA      ----------------------------------------------------------------------
MYH3_MOUSE      ----------------------------------------------------------------------
KIF7_HUMAN      -------------------------------------------------AGARPGSPERKGPGSRAVGGS
KIF15_MOUSE     ----------------------------------------------------------------------
DMD_MOUSE       ----------------------------------------------------------------------
CUX2_HUMAN      ---------------------------------------------------GIPGKALLTETLLQRNEAE
CNPD_PROVI      ----------------------------------------------------------------------
APSB_EMENI      ----------------------------------------------------------------------
SAS6_CHICK      ----------------------------------------------------------------------
NUF1_YEAST      ----------------------------------------------------------------------
MYO1_CAEEL      ---------------------------------------------------------------EKNMANE
MYH7_RAT        ----------------------------------------------------------------------
MYH7_PAPHA      ----------------------------------------------------------------------
MYH7_MOUSE      ----------------------------------------------------------------------
MYH7_MESAU      ----------------------------------------------------------------------
MYH7_HUMAN      ----------------------------------------------------------------------
MYH7_CANFA      ----------------------------------------------------------------------
MYH3_RAT        ----------------------------------------------------------------------
MYH3_HUMAN      ----------------------------------------------------------------------
MRCKB_HUMAN     ----------------------------------------------------------------------
MRCKA_HUMAN     ----------------------------------------------------------------------
MPP9_HUMAN      ----------------------------------------------------------------------
IMH1_ASHGO      -------------------------------------------------------------TSSELELGE
IFA1_CAEEL      ----------------------------------------------------------------------
GRDN_MOUSE      ----------------------------------------------------------------------
GOGA3_HUMAN     -----------------------------------------------------------------AALKK
GOGA1_HUMAN     ----------------------------------------------------------------------
FKB15_MOUSE     ----------------------------------------------------------------------
CP250_MOUSE     ----------------------------------------------------------------------
CGNL1_HUMAN     ----------------------------------------------------------------------
BRE1_ASPFU      TNIQLREEAAKLRSERTAYRNQVDEETQNVIAEKEAQ----LMRAETDLARIRNARDELLADQQMRKAAQ
UACA_CANFA      ----------------------------------------------------------------------
SWP70_CHICK     ----------------------------------------------------------------------
SMC2_HUMAN      ----------------------------------------------------------------------
NEMO_DROME      ------------------------------------------------------------------IMGE
MRCKA_RAT       ----------------------------------------------------------------------
BRE1_CRYNE      ----------------------------------------------------------------------
TAXB1_PONAB     THKAIEKETESLKDKLKKAQHEREQLECQLKTEKDEKELYKVHLKNTEIENTKLMS---EVQTLKNLDGN
SMC1_YEAST      --------------------------------------------------------------------GQ
MYSS_CYPCA      ----------------------------------------------------------------------
MYO3_CAEEL      -----------------------------------------------------------EAVQRGEIARS
MYH9_RAT        ----------------------------------------------------------------------
MYH9_MOUSE      ----------------------------------------------------------------------
MRCKB_MOUSE     ----------------------------------------------------------------------
GFAP_DANRE      ----------------------------------------------------------------------
GFAP_CARAU      ----------------------------------------------------------------------
EFG_ACIAC       ---------------------------------------------------------KMDRTGANKVYDQ
EEA1_HUMAN      ----------------------------------------------------------------------
DAPLE_XENLA     ----------------------------------------------------------------------
CE290_HUMAN     ----------------------------------------------------------------------
CACO1_BOVIN     ----------------------------------------------------------------------
ANT1_ONCVO      ----------------------------------------------------------------------
YNP9_CAEEL      AVDVLKSENEKLLAKNEEFSAKLVXXXXXXXXXXXXXXXVLEKKGKQEDET-RKAIEKLEKSKVTITELE
VIME_RAT        ----------------------------------------------------------------------
VIME_MOUSE      ----------------------------------------------------------------------
VIME_MESAU      ----------------------------------------------------------------------
VIME_CRIGR      ----------------------------------------------------------------------
VIME_BOVIN      ----------------------------------------------------------------------
SPTCB_DROME     ----------------------------------------------------------------------
NIN_MOUSE       --------------------------------------------------------------------GQ
MYSN_DROME      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
MYO2_CAEEL      ---------------------------------------------------------------------E
MYH6_RAT        ----------------------------------------------------------------------
LIPA1_HUMAN     ---------------------------------------------------------------------Q
K1C9_HUMAN      ----------------------------------------------------------------------
HOOK3_MOUSE     ----------------------------------------------------------------------
HOOK3_HUMAN     ----------------------------------------------------------------------
HMW2_MYCGE      ----------------------------------------------------------------------
HIP1_HUMAN      ----------------------------------------------------------------------
GRDN_HUMAN      LSVELKAKIRRLRQELEEKTEQLLDCKQELEQMEIELKRLQQENMNSDARSARMYRDELDALREKAVRVD
GPTC8_MOUSE     ----------------------------------------------------------------------
GPTC8_HUMAN     ----------------------------------------------------------------------
CP135_HUMAN     ----------------------------------------------------------------------
CNPD_CHLPD      ----------------------------------------------------------------------
CASC4_CHICK     ----------------------------------------------------------------------
WAP_ARATH       ----------------------------------------------------------------------
TAXB1_HUMAN     THKAIEKETESLKDKLKKAQHEREQLECQLKTEKDEKELYKVHLKNTEIENTKLMS---EVQTLKNLDGN
SYCP3_MACFA     ----------------------------------------------------------------------
ROCK2_MOUSE     ----------------------------------------------------------------------
NDE1_CHICK      ----------------------------------------------------------------------
MYH8_RAT        ----------------------------------------------------------------------
MYH7_PIG        ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
MYH6_HUMAN      ----------------------------------------------------------------------
MRCKA_MOUSE     ----------------------------------------------------------------------
LIPB1_MOUSE     ----------------------------------------------------------------------
KINH_DROME      ----------------------------------------------------------------------
K1C9_RAT        ----------------------------------------------------------------------
GRIP_ARATH      ----------------------------------------------------------------------
GOGA1_MOUSE     ---------------------------------------------------------------------E
FIL1L_MOUSE     ----------------------------------------------------------------------
EVI5L_HUMAN     --KRLRTENRLLKQRLEKGQVTRAQEAEENYVIKRE-----LAVVRQQCSSAAEDLQKAQSTIRQLQEQQ
DESP_HUMAN      ----------------------------------------------------------------------
CD158_HUMAN     ----------------------------------------------------------------------
CCHCR_MOUSE     ----------------------------------------------------------------------
CCD41_RAT       ----------------------------------------------------------------------
YOND_BACSU      ----------------------------------------------------------------------
VIME_ONCMY      ----------------------------------------------------------------------
SMC_BACSU       ----------------------------------------------------------------------
SMC2_XENLA      ----------------------------------------------------------------------
SKI_XENLA       -CSGLEAELEHLKQALDSGLDSKEAKEKFLHEVV-----------------------KMRVKQEEKLNAA
SBCC_BACSU      ----------------------------------------------------------------------
RB6I2_HUMAN     ----------------------------------------------------------------------
PLST_CARAU      ----------------------------------------------------------------------
OPTN_CHICK      ----------------------------------------------------------------------
MYSP_MYTGA      ----------------------------------------------------------------------
MYSP_CAEEL      ----------------------------------------------------------------------
MYH6_MOUSE      ----------------------------------------------------------------------
MY18A_MOUSE     ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
KINH_SYNRA      ANQDLMAELEELKKNLSEMRQAHKDATDSDKEKRKAEKMAQMMSGFDPSGILNDKERQIRNALSK-LDGE
EP15R_MOUSE     ----------------------------------------------------------------------
EEA1_MOUSE      ----------------------------------------------------------------------
CUT_CAEEL       ----------------------------------------------------------------------
CGNL1_MOUSE     REKVLKEENEKLQGRIAE-LERR----------------AAQLQRQMEDVKGDEAQAKETLRKCESEVQQ
CCD41_MOUSE     ----------------------------------------------------------------------
CCD18_HUMAN     ----------------------------------------------------------------------
CC151_BOVIN     ----------------------------------------------------------------------
CASP_CAEEL      ----------------------------------------------------------------------
ATG11_PICST     ----------------------------------------------------------------------
Y1002_CHLCV     ----------------------------------------------------------------------
VIME_PANTR      ----------------------------------------------------------------------
VIME_MACFA      ----------------------------------------------------------------------
VIME_HUMAN      ----------------------------------------------------------------------
VIME_CERAE      ----------------------------------------------------------------------
SMC2_MOUSE      ----------------------------------------------------------------------
OPTN_MOUSE      ----------------------------------------------------------------------
OPTN_DANRE      ----------------------------------------------------------------------
NDE1_HUMAN      ----------------------------------------------------------------------
MYO5C_HUMAN     ----------------------------------------------------------------------
MYH9_HUMAN      ----------------------------------------------------------------------
MYH9_CANFA      ----------------------------------------------------------------------
MYH13_HUMAN     ----------------------------------------------------------------------
EP15R_HUMAN     ----------------------------------------------------------------------
DZIP1_DANRE     ---------------------------------------------------------KEELKQRKKIIAS
DIAP1_HUMAN     ----------------------------------------------------------------------
CD158_MOUSE     ---------------------------------------------------------EITGLTEKASSAR
SYCP3_HUMAN     ----------------------------------------------------------------------
MYS_AEQIR       ----------------------------------------------------------------------
MYH7_HORSE      ----------------------------------------------------------------------
MYH6_MESAU      ----------------------------------------------------------------------
MYH13_CANFA     ----------------------------------------------------------------------
MY18A_HUMAN     --EKLQREKDMLLAELKQQLEEKDM--------------------------------DIAGFTQKVVSLE
MOES_LYTVA      ----------------------------------------------------------------------
MLP2_YEAST      ----------------------------------------------------------------------
MFP1_ARATH      ---------------------------------------------------------ELEGTKKTLQASR
LRCC1_MOUSE     ----------------------------------------------------------------------
KIF7_DANRE      ----------------------------------------------------------------------
GOGA4_MOUSE     ----------------------------------------------------------------------
FLIP1_HUMAN     ----------------------------------------------------------------------
SGM1_YEAST      ----------------------------------------------------------------------
ROCK2_RAT       ----------------------------------------------------------------------
NDE1_XENTR      ----------------------------------------------------------------------
MYSP_BRUMA      ----------------------------------------------------------------------
MYO1_YEAST      ----------------------------------------------------------------------
ITSN1_XENLA     ----------------------------------------------------------------------
GOGA5_MOUSE     ----------------------------------------------------------------------
GCC2_MOUSE      ---------------------------------------------------------RLQGENEKLLSQQ
GCC2_HUMAN      ----------------------------------------------------------------------
ETP1_YEAST      ----------------------------------------------------------------------
CTK2_XENLA      --------------------------------------------------------PKNSGPGITSTSFS
CC146_RAT       ----------------------------------------------------------------------
SPDLY_MACFA     ----------------------------------------------------------------------
RRBP1_MOUSE     ---------------------------------------------------------------------Q
RMUC_NEIMA      ----------------------------------------------------------------------
OPTN_XENLA      ----------------------------------------------------------------------
NUF2_EMENI      ----------------------------------------------------------------------
MYSP_SARSC      ----------------------------------------------------------------------
MYO4_CAEEL      ----------------------------------------------------------------------
MOEH_CULQU      ----------------------------------------------------------------------
MAD1_YARLI      ----------------------------------------------------------------------
KIF8_DICDI      ----------------------------------------------------------------------
KIF4_XENLA      ----------------------------------------------------------------------
K1C10_MOUSE     ----------------------------------------------------------------------
HOOK_AEDAE      ----------------------------------------------------------------------
DCTN1_CHICK     ----------------------------------------------------------------------
CENPE_MOUSE     ----------------------------------------------------------------------
CD72_HUMAN      ----------------------------------------------------------------------
CCD68_HUMAN     ----------------------------------------------------------------------
CACO1_DANRE     ----------------------------------------------------------------------
ANR26_HUMAN     RLSQLQSENMLLRQQLDDAHNKAD---------------------NKE---------------KTVINIQ
XNIF_XENLA      ----------------------------------------------------------------------
TRIPB_HUMAN     ----------------------------------------------------------------------
TPM_MIMNO       ----------------------------------------------------------------------
ROCK2_HUMAN     ----------------------------------------------------------------------
PMFBP_MOUSE     ---------------------------------------------------------KLQCTTKELDTSL
ODFP2_CHICK     ---------------------------------------------------------------KKALKDE
NU211_SCHPO     ----------------------------------------------------------------------
NMCP_ARATH      ----------------------------------------------------------------------
NDC80_NEUCR     ----------------------------------------------------------------------
MYSU_RABIT      ----------------------------------------------------------------------
MYSP_ONCVO      ----------------------------------------------------------------------
KIF15_HUMAN     ----------------------------------------------------------------------
KI20B_MOUSE     ----------------------------------------------------------------KEVKFR
K1C15_PROAT     ----------------------------------------------------------------------
HOOK_CULQU      ----------------------------------------------------------------------
HOOK2_HUMAN     ----------------------------------------------------------------------
FBF1_HUMAN      ----------------------------------------------------------------------
CUX1_MOUSE      ----------------------------------------------------------------------
CTGE5_MOUSE     ----------------------------------------------------------------------
CT2NL_PONAB     ----------------------------------------------------------------------
CT2NL_HUMAN     ----------------------------------------------------------------------
CROL2_HUMAN     ----------------------------------------------------------------------
CNTLN_HUMAN     ----------------------------------------------------------------------
CING_CANFA      ----------------------------------------------------------------------
YD72_SCHPO      ----------------------------------------------------------------------
WIT2_ARATH      ----------------------------------------------------------------------
TANA_XENLA      ----------------------------------------------------------------------
STX4_BOVIN      ----------------------------------------------------------------------
ROCK1_BOVIN     ----------------------------------------------------------------------
RAD50_SULSO     ----------------------------------------------------------------------
PLPA_MYCGA      ----------------------------------------------------------------------
NIN_HUMAN       ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYSP_DIRIM      ----------------------------------------------------------------------
MYSP_BLOTA      ----------------------------------------------------------------------
MTS1A_DANRE     ----------------------------------------------------------------------
MEU1_SCHPO      ----------------------------------------------------------------------
MBO1_SCHPO      ----------------------------------------------------------------------
KIFC1_MOUSE     ----------------------------------------------------------------------
HOOK3_XENLA     ----------------------------------------------------------------------
HOOK1_CHICK     ----------------------------------------------------------------------
GCOM1_HUMAN     ----------------------------------------------------------------------
FBF1_MOUSE      ----------------------------------------------------------------------
CYTSA_TAKRU     ----------------------------------------------------------------------
CCD91_RAT       ----------------------------------------------------------------------
ATG11_NEUCR     ----------------------------------------------------------------------
YOMI_BACSU      ----------------------------------------------------------------------
YG3A_YEAST      ----------------------------------------------------------------------
SPDLY_HUMAN     ----------------------------------------------------------------------
SPC25_CANAL     ----------------------------------------------------------------------
ROCK2_BOVIN     ----------------------------------------------------------------------
RMUC_NEIMB      ----------------------------------------------------------------------
NUF2_ASPFU      ----------------------------------------------------------------------
NEMO_RAT        ----------------------------------------------------------------------
NDE1_RAT        ----------------------------------------------------------------------
MYSS_RABIT      ----------------------------------------------------------------------
MYSP_BOOMI      ----------------------------------------------------------------------
MIX1_CAEEL      ----------------------------------------------------------------------
LRC45_MOUSE     ----------------------------------------------------------------------
KINH_RAT        LSDELNQKSATL-ASIDAELQQKKRAAEMMASLLKDLAEIGIAVGNEEFTVARLYISKMKSEVKTMVKRC
KIF4_CHICK      ----------------------------------------------------------------------
KI20B_HUMAN     ----------------------------------------------------------------------
K1C9_CANFA      ----------------------------------------------------------------------
K1C10_CANFA     ----------------------------------------------------------------------
IFEB_ASCSU      ------------------------------------------------------------GGGRVLKMVT
HMMR_HUMAN      ----------------------------------------------------------------------
GAS8_BOVIN      ---------------------------------------------------------------------E
FIP37_ARATH     -------------------------------------------------------------------AFQ
CCD18_MOUSE     ----------------------------------------------------------------------
APOA1_COTJA     ----------------------------------------------------------------------
Y451_HELPY      ----------------------------------------------------------------------
VIMB_CARAU      ----------------------------------------------------------------------
SYCP1_MESAU     ----------------------------------------------------------------------
STAT3_RAT       ----------------------------------------------------------------------
STAT3_PIG       ----------------------------------------------------------------------
STAT3_MOUSE     ----------------------------------------------------------------------
STAT3_HUMAN     ----------------------------------------------------------------------
RUFY2_PONAB     ----------------------------------------------------------------------
RUFY2_HUMAN     ----------------------------------------------------------------------
PIBF1_HUMAN     ----------------------------------------------------------------------
PHLB2_MOUSE     ----------------------------------------------------------------------
PHLB2_HUMAN     ----------------------------------------------------------------------
ODFP2_RAT       ---------------------------------------------------------KLELAREKHQASQ
ODF2L_MOUSE     ----------------------------------------------------------------------
NDL1A_XENLA     ----------------------------------------------------------------------
MYS3_HYDAT      ----------------------------------------------------------------------
LAMB4_DANRE     ----------------------------------------------------------------------
KTN1_CHICK      ECEKYKSETEGILQRLQRSVEEEESKWKI----------------------------KVEESQKEL---K
KIF5C_MOUSE     ----------------------------------------------------------------------
KIF4_MOUSE      ----------------------------------------------------------------------
KIF27_MOUSE     ------------------------------------------------------GDLKME-----SLQES
K1C20_RAT       ----------------------------------------------------------------------
K1C10_BOVIN     ----------------------------------------------------------------------
F184B_HUMAN     ----------------------------------------------------------------------
EFG_AZOSB       ---------------------------------------------------------KMDRSGANKVVDQ
DCTN1_DROME     ----------------------------------------------------------------------
CNPD_ARCB4      ----------------------------------------------------------------------
CLIP1_MOUSE     ----------------------------------------------------------------------
CENPJ_PANTR     ----------------------------------------------------------------------
CENPF_HUMAN     ----------------------------------------------------------------------
CENPE_HUMAN     ----------------------------------------------------------------------
CE290_BOVIN     ----------------------------------------------------------------------
CCPG1_CHICK     ----------------------------------------------------------------------
CC147_HUMAN     ----------------------------------------------------------------------
CACO1_RAT       ----------------------------------------------------------------------
C3H41_ARATH     ---------------------------------------------------------------------Q
BRE1_ASHGO      ----------------------------------------------------------------------
ATG16_XENTR     ----------------------------------------------------------------------
YQOE_CAEEL      -------------------------------------------------------------TELKSLKGD
Y4A0_ENCCU      ----------------------------------------------------------------------
TIG_PROM5       ----------------------------------------------------------------------
TAXB1_RAT       ----------------------------------------------------------------------
SYGP1_HUMAN     ----------------------------------------------------------------------
SYCP1_HUMAN     ----------------------------------------------------------------------
STAT3_CHICK     ----------------------------------------------------------------------
SMC6_MOUSE      ----------------------------------------------------------------------
SLMAP_HUMAN     ----------------------------------------------------------------------
QN1_HUMAN       ----------------------------------------------------------------------
OPTN_RAT        -----------------------------------------------------------KANGHSAIETQ
ODFP2_MOUSE     ---------------------------------------------------------KLEMAREKHQASQ
NEMO_BOVIN      ----------------------------------------------------------------------
NDEL1_XENTR     ----------------------------------------------------------------------
MYH2_PIG        ----------------------------------------------------------------------
MYH10_RAT       ----------------------------------------------------------------------
MYH10_MOUSE     ----------------------------------------------------------------------
KIF1_DICDI      ---------------------------------------------------------------KKIDLTN
GRAP1_RAT       ----------------------------------------------------------------------
FAT1_SCHPO      ----------------------------------------------------------------------
DIXC1_RAT       ----------------------------------------------------------------------
DCTN1_XENLA     ----------------------------------------------------------------------
CTTB2_RABIT     ----------------------------------------------------------------------
CLPB_HELPY      ----------------------------------------------------------------------
CEP63_PONAB     ----------------------------------------------------------------------
CEP63_MACFA     ----------------------------------------------------------------------
CEP63_HUMAN     ----------------------------------------------------------------------
CENPC_HUMAN     ----------------------------------------------------------------------
CCD69_XENTR     ----------------------------------------------------------------------
CACO2_BOVIN     ----------------------------------------------------------------------
BFR1_YEAST      ----------------------------------------------------------------------
AKAP9_HUMAN     ----------------------------------------------------------------------
AGLZ_MYXXD      ----------------------------------------------------------------------
ZIP1_YEAST      ----------------------------------------------------------------------
YB145_PLAF7     ----------------------------------------------------------------------
YA046_HUMAN     ----------------------------------------------------------------------
VIME_CHICK      ----------------------------------------------------------------------
UACA_HUMAN      ----------------------------------------------------------------------
TNNT2_RAT       ----------------------------------------------------------------------
T4AF1_HUMAN     ----------------------------------------------------------------KTVYSL
SYCP1_MOUSE     ----------------------------------------------------------------------
RFIP4_MOUSE     ----------------------------------------------------------------------
RAD50_THEAC     ----------------------------------------------------------------------
RAD50_ARATH     ----------------------------------------------------------------------
PUMA_PARUN      ----------------------------------------------------------------------
PFDA_IGNH4      ----------------------------------------------------------------------
MYO5A_HUMAN     ---------------------------------------------------------KLRSDLERLQLSE
MYH10_HUMAN     ----------------------------------------------------------------------
MYH10_BOVIN     ----------------------------------------------------------------------
MD1L1_MOUSE     ----------------------------------------------------------------------
KIF15_STRPU     ----------------------------------------------------------------------
KI21A_HUMAN     ----------------------------------------------------------------------
GOGA2_HUMAN     -------------------------------------------------------------------ANQ
EVI5_HUMAN      ----------------------------------------------------------------------
CING_XENTR      ----------------------------------------------------------------------
CING_XENLA      ----------------------------------------------------------------------
CI117_RAT       ---------------------------------------------------------------KKKIGGR
CC146_HUMAN     ---------------------------------------------------------KVEMEKKKIVLEQ
CAR14_HUMAN     ----------------------------------------------------------------------
BPAEA_MOUSE     ----------------------------------------------------------------------
ZWINT_RAT       ----------------------------------------------------------------------
ZWINT_MOUSE     ----------------------------------------------------------------------
YM92_CAEEL      ----------------------------------------------------------------------
YL139_YARLI     ----------------------------------------------------------------------
YA046_MOUSE     ----------------------------------------------------------------------
VIM4_XENLA      ----------------------------------------------------------------------
SYS_SYNE7       ----------------------------------------------------------------------
SYS_DESHY       ----------------------------------------------------------------------
SYCP2_MOUSE     ----------------------------------------------------------------------
SPC24_HUMAN     ----------------------------------------------------------------------
SHE9_ASHGO      ----------------------------------------------------------------------
RIMB1_HUMAN     ----------------------------------------------------------------------
RHG17_RAT       ----------------------------------------------------------------------
RHG17_MOUSE     ----------------------------------------------------------------------
P54_ENTFC       ----------------------------------------------------------------------
ODFP2_HUMAN     ---------------------------------------------------------KLEMAREKHQASQ
NFM_PIG         ----------------------------------------------------------------------
NFM_HUMAN       ----------------------------------------------------------------------
NDE1_DROME      ----------------------------------------------------------------------
MYH2_HUMAN      ----------------------------------------------------------------------
MYH2_HORSE      ----------------------------------------------------------------------
MTUS1_MOUSE     ----------------------------------------------------------------------
MEDB_GIALA      ----------------------------------------------------------------------
LCA5L_PAPAN     ----------------------------------------------------------------------
KLPA_EMENI      ----------------------------------------------------------------------
K1C10_RAT       ----------------------------------------------------------------------
HOOK_BRAFL      ----------------------------------------------------------------------
GAS8_RAT        ----------------------------------------------------------------------
EZRA_BACLD      ----------------------------------------------------------------------
EFG_YERPY       ------------------------------------------------------------------VVGQ
EFG_YERPS       ------------------------------------------------------------------VVGQ
EFG_YERPP       ------------------------------------------------------------------VVGQ
EFG_YERPN       ------------------------------------------------------------------VVGQ
EFG_YERPG       ------------------------------------------------------------------VVGQ
EFG_YERPE       ------------------------------------------------------------------VVGQ
EFG_YERPB       ------------------------------------------------------------------VVGQ
EFG_YERPA       ------------------------------------------------------------------VVGQ
EFG_YERP3       ------------------------------------------------------------------VVGQ
DEFI6_XENLA     ----------------------------------------------------------------------
CWLO_BACSU      ----------------------------------------------------------------------
CP135_DANRE     ----------------------------------------------------------------------
CK5P2_HUMAN     EIHFLRKQNQALNAMLIKGSRDK-QKENDKLRESLSRKTVSLEHLQREYASVKEENERLQKEGSEKERHN
CCD93_XENTR     -----------------------------------------------------------------AATGM
ATPF_DESDG      ----------------------------------------------------------------------
YDEM_CAEEL      ----------------------------------------------------------------------
YBAC_SCHPO      ----------------------------------------------------------------------
Y4862_ARATH     ----------------------------------------------------------------------
Y147_TNAVC      ----------------------------------------------------------------------
VIM1_XENLA      ----------------------------------------------------------------------
UACA_BOVIN      ETRPLKRELENLKAKLAQHVKPEEH---------------EQLKSRLEQKSGELGKRITELTSK------
TMF1_MOUSE      ---------------------------------------------------------------------E
TAXB1_BOVIN     THKAIEKETESLKDKLKKAQCEREQLECQLKTEKDEKELYKVHLKNTEIENTKLVS---EVQTLKNLDGN
ROCK1_RABIT     ----------------------------------------------------------------------
RBCC1_MOUSE     ----------------------------------------------------------------------
NFM_MOUSE       ----------------------------------------------------------------------
NFM_BOVIN       ----------------------------------------------------------------------
NDE1B_XENLA     ----------------------------------------------------------------------
NDC80_ASHGO     ----------------------------------------------------------------------
MYSP_ANISI      ----------------------------------------------------------------------
MYSA_DROME      ----------------------------------------------------------------------
MYH2_CANFA      ----------------------------------------------------------------------
MYH11_MOUSE     ----------------------------------------------------------------------
MIP1_ARATH      ---------------------------------------------------------------KKVKERK
MAD1_DEBHA      ----------------------------------------------------------------------
K2C7_RAT        ----------------------------------------------------------------------
K2C7_MOUSE      ----------------------------------------------------------------------
K1C20_MOUSE     ----------------------------------------------------------------------
HOOK_DROMO      ----------------------------------------------------------------------
HAUS3_MOUSE     ----------------------------------------------------------------------
GG8L1_HUMAN     ----------------------------------------------------------------------
FBF1_CHICK      ---------------------------------------------------------------------Q
EDE1_YEAST      ---------------------------------------------------------------KKSRATQ
CTRO_HUMAN      ----------------------------------------------------------------------
CNPD_PELPD      -----------------------------------------------------------------AVAAY
CNPD_NITSB      ----------------------------------------------------------------------
CNPD_CHLTE      ----------------------------------------------------------------------
CING_MOUSE      --------------------------------------------------------------------GK
CI117_MOUSE     ------------------------------------------------------GGKEMQG---KKIGGK
CI117_HUMAN     ----------------------------------------------------------------------
CASP_MOUSE      ----------------------------------------------------------------------
CAO1B_XENLA     ----------------------------------------------------------------------
BRE1_DEBHA      ----------------------------------------------------------------------
BICD2_MOUSE     ----------------------------------------------------------------------
BICD2_HUMAN     ----------------------------------------------------------------------
AV71_ACAVI      ----------------------------------------------------------------------
APOA1_CHICK     ----------------------------------------------------------------------
ANR24_MOUSE     ----------------------------------------------------------------------
A16L1_MOUSE     ----------------------------------------------------------------------
YIBP_ECOLI      ---------------------------------------------------------------------Q
YF82_SCHPO      ----------------------------------------------------------------------
TNNT2_BOVIN     ----------------------------------------------------------------------
TG278_CAEEL     ----------------------------------------------------------------------
STX4_RAT        ----------------------------------------------------------------------
STX4_MOUSE      ----------------------------------------------------------------------
SPTA2_HUMAN     ----------------------------------------------------------------------
SMC4_XENLA      ----------------------------------------------------------------------
ROCK1_RAT       ----------------------------------------------------------------------
RIMB1_RAT       ----------------------------------------------------------------------
OPTN_HUMAN      ----------------------------------------------------------------------
NFM_RAT         ----------------------------------------------------------------------
MYOJ_DICDI      ----------------------------------------------------------------------
MYH4_PIG        ----------------------------------------------------------------------
MYH2_BOVIN      ----------------------------------------------------------------------
MYH1_HUMAN      ----------------------------------------------------------------------
MYH11_RAT       ----------------------------------------------------------------------
MYH11_HUMAN     ----------------------------------------------------------------------
MTUS1_PONAB     ----------------------------------------------------------------------
MCP3_SCHPO      ----------------------------------------------------------------------
LEKR1_HUMAN     ----------------------------------------------------------------------
LAML1_XENLA     ----------------------------------------------------------------------
KINH_HUMAN      ----------------------------------------------------------------------
KI21B_MOUSE     ----------------------------------------------------------------------
KI21B_HUMAN     ----------------------------------------------------------------------
KI15A_XENLA     ----------------------------------------------------------------------
K1C10_HUMAN     ----------------------------------------------------------------------
ESIP1_RAT       -----------------------------------------------------PKGPKLERQGH----GD
CUX1_HUMAN      ----------------------------------------------------------------------
CTTB2_FELCA     ----------------------------------------------------------------------
CNPD_STAS1      ----------------------------------------------------------------------
CLPB_CHRVO      ----------------------------------------------------------------------
CLIP2_MOUSE     ----------------------------------------------------------------------
CK5P2_PANTR     EIHFLRKQNQALNAMLIKGSRDK-QKENDKLRESLSRKTVSLEHLQREYASVKEENERLQKEGSEKERHN
CIP2A_HUMAN     ----------------------------------------------------------------------
CCD57_MOUSE     ----------------------------------------------------------------------
CB039_HUMAN     ----------------------------------------------------------------------
CASP_PONAB      ----------------------------------------------------------------------
CASP_HUMAN      ----------------------------------------------------------------------
CACO1_MOUSE     ----------------------------------------------------------------------
ATK1_ARATH      ----------------------------------------------------------------------
ATG11_ASPFU     ----------------------------------------------------------------------
AP1_ARATH       ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           QQASVTAGKVPEVVALGAAEKKVKMLEQQRSELLEVNKQWDQHFRSMKQQYEQKITELRQKLADLQKQVT
TNIP1_HUMAN     QQASVTAGKVPEVVALGAAEKKVKMLEQQRSELLEVNKQWDQHFRSMKQQYEQKITELRQKLADLQKQVT
TNIP1_MOUSE     XXXSVMASKVPEAGAFGAAEKKVKLLEQQRMELLEVNKQWDQHFRSMKQQYEQKITELRQKLVDLQKQVT
TNIP3_HUMAN     ---------------MNSLEQKIRCLEKQRKELLEVNQQWDQQFRSMKELYERKVAELKTKLDAAERFLS
CEP55_RAT       --------------------------EMQLKDALEKNQQWDQQREAYVKGLLAKIFELEKRTASLPQQMK
CEP55_MOUSE     --------------------------EMQLKDALEKNQQWDQQREAYVKGLLAKIFELEKRTASLTQQMK
TPR_HUMAN       QEQHVSVQEMQELKTLNQAETKSKSLESQVENLQKTLSEKETEARNLQEQTVQLQSELSRLRQDLQDRTT
HMW2_MYCPN      -----------ETAAKSERELKVALLNQAKKAFLQIRKQQLLEIASVKQQLAQKANLLKNQQAELDKQTE
CEP55_HUMAN     -------------------------MEIQLKDALEKNQQWDQQREVYVKGLLAKIFELEKKTESLPQQTK
MPP9_MOUSE      SQLPGTANSVPECISLASLEDPV-MLSKIRQNLKEKHAR---HVADLRAYYESEISSLKQKL-----EAK
HMMR_RAT        ------------------AEKRVEDVQQQILTAESTNQEYAKVVQDLQNSSTLKEAEIKEITSSYLEKIT
IMH1_YEAST      -------------------ESSSKQNEEVKTVKLELDDLRHKN-ATMIEAYEAKNTELRSKIELLSKKVE
CCD46_HUMAN     ---------------------KIELKKTHAAETEMTLEKANSKLKQIEKEYTQKLAKSSQIIAELQTTIS
CCD46_MOUSE     ------------VKKLKAESERVKM-ELKKTHAAETEEKANSRLKQIEKEYTQKLAKSSQIIAELQTTIS
CCD41_HUMAN     -----------EILKAAVEHHKVLLVEKDRELIRKVQAAKEEGYQKLVVLQDEKL-ELENRLADLEKMKV
CC150_HUMAN     KVEKITESKNKLAYENGKLQIKVKQLEEQVQSFTDTSLQND-HLRKMNKKYAQANSELSAKRVHLQQHLK
TNIP2_MOUSE     -------------------EKEVVLLRRSVAEKEKARAASDVLCRSLADETHQ----LRRTLAATAHMCQ
MOEH_ANOGA      -------------------------------------QEYEDRLRSMQEEMERKLSEAQDTIRRLQEQLN
CLIP1_HUMAN     QEAEI---KVKELEVLQACNEQTKVIDNFTSQLKATEEKLLDALRKASSEGKSEMKKLRQQLEAAEKQIK
SPTB2_MOUSE     ------------------------------------------------------VMALQRKLTGMERDLV
SPTB2_HUMAN     ------------------------------------------------------VMALQRKLTGMERDLV
SMC3_RAT        -------------------------------------QKWDKMRRALEYTYNQELNETRAKLDELSRQLR
SMC3_PONAB      -------------------------------------QKWDKMRRALEYTYNQELNETRAKLDELSRQLR
SMC3_MOUSE      -------------------------------------QKWDKMRRALEYTYNQELNETRAKLDELSRQLR
SMC3_HUMAN      -------------------------------------QKWDKMRRALEYTYNQELNETRAKLDELSRQLR
SMC3_BOVIN      -------------------------------------QKWDKMRRALEYTYNQELNETRAKLDELSRQLR
SYCP3_MOUSE     -----------------ASNQKIEQIKTQQEEIQKLNNEYSQQFMNVLQQWEQKFEEQGEKLSNLQQQKI
RUD3_YEAST      -------------------ESRIEALEDEKHDIIEKHSKELNTYRKEKDQLNLQVQELMIILENNKQDIS
MYSP_DERFA      ELRRKMAQKISEYEELEALLNKCSSLEKQKSRLVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLE
IFE_BRALA       ---------------------KVRYLQERNSKLAQIKIQESREAPNIKDLYEKELRDLRALVDELSNDKA
FKB15_HUMAN     ELAAATAQVSHLQLKMTAHQKKETELQMQLSELQETSEQAQSKFKSEKQQLELKVTSLEEELTDLRVEKE
CTRO_MOUSE      ERRHSLENKVKRLETMERRENRLKDDIQTKSEQI--------------QQMADKILELEEKHREAQVSAQ
CE290_DANRE     -----------EIVSVSRRITTLEMKELNERQRAEHAQKMYEHLRNSLKQVEERNFELETKFAELTK--L
GOGA3_MOUSE     --------------------QSLKFDKEQMIALTEANETLKKQIEELQQEAKKAITEQKQKMKRLGSDLT
EZRI_RABIT      --------EVQQMKAQAREEKHQKQLERQQLESEKVEQEKEQMLREKEQDYEQKTKKAEKELSDQIQRAL
DMD_PIG         ---------------------------QRRKKALEISHQW--------YQYKRQADDLLKCLDDIEKKLA
DMD_HUMAN       ---------------------------QRRKKALEISHQW--------YQYKRQADDLLKCLDDIEKKLA
CP250_HUMAN     EEVETLRGQIQELEKQREMQKAALELRNQEVDLQQEQIQELEKCRSVLEHLPMAVQEREQKLTVQREQIR
DIAP1_MOUSE     ---------------------------------IDIERLVDQMIDKTKEKSEAKATELEKKLDSELTARH
TNIP2_HUMAN     -------------------EKEVVLLRRSMAEGERARAASDVLCRSLANETHQ----LRRTLAHMCQHLA
KIF15_RAT       LQHKLNXXXXXXXXXXXXYNLKMKQLEHVMGSAPEYPQSFQTHLAKLLETQEQEIEDGRASKMSLQHLVT
MYH9_CHICK      -------------------------------------------------------SDLHDQIAELQAQIA
USO1_YEAST      -----------------SAEEDIKNLQHEKSDLISRINESEKDIEELKSKLRSELETVKQELNNAQEKIR
SPO15_SCHPO     --------------------------------------------RTSNSQLEEEMVELKESNRTIHSQLT
M12_STRPY       ESKLADAKKDFELAALGLAEKQIKQLEEQK-QILDASRKGTEAVRQAKKATEAELNNLKAELAKVQKQIL
CROCC_MOUSE     --------------------KEIAALQQERDEGLLLAESEKQQALSLK---ESEKTALSEKLMGTRHSLA
CLIP1_CHICK     IQLELTKANEKAVQLQKNVEQTAQKAEQSQQETLKTHKKMQDQLTDMKKQMETSQNQYKDLQAKYEKETS
QN1_RAT         -------------------ERRIKKLEAKDEEAKKSLRTMEQQFQKMKIQYEQRLEEQEQMLAHRQREAT
GOGB1_HUMAN     QRSAAQPSTSPAEVQ--SLKKAMSSLQNDRDRLLKELKNLQQQYL----QINQEITELHPLKAQLQEYQD
DMD_CANFA       ---------------------------QRRKKALEISHQW--------YQYKRQADDLLKCLDDIEKKLA
CING_SORAR      QREALRRGKAELEEQKRLLDRTVERLNKELEQIGEDSKQALHQLQSQLEDYKEKS---RREVADAQRQAK
CE164_HUMAN     -------------------KQRAELLGHLTGELERLQRAHERELETVRQEQHKRLEDLRRRHREQERKLQ
SGM1_SCHPO      --------------SLSEAETKLKRLEKQATPELQVSKEMEEQLELQKSQFEKRISILEKEKEDLQRKME
NF70_LOLPE      --------------------EKVRFLEAQNKELEELKSKWGKETSAIKEMYETELEEAR-KLIDLDVRVT
NF60_LOLPE      --------------------EKVRFLEAQNKELEELKSKWGKETSAIKEMYETELEEAR-KLIDLDVRVT
MYO3_CAEBR      -------------------------LETEKANLADAEER-NEKLNQLKATLESKLTDITGQLEDMQERHE
MYO2_SCHPO      --------------SLSESLKRVKKLERENSTLISILKQQKEELSVLKGVQELTINNLEEK-------VN
MYH8_MOUSE      --------KIAEQELLDASER-VQLLHTQNTSLINTKKKLENDVSQLQSEVEEVIQESRNAEEKAKKAIT
GOGA5_RAT       -------------------QKLMGQIHQLRSEL-----------QDMEAQQVSEAESAREQLQDLQDQIA
GOGA5_HUMAN     --------------AITLAERKYSDEKKRVDELQQQVKLYKLNLESSKQEYKQKATRILQSK---EKLIN
GOGA4_HUMAN     -------------------EMKEEEIAQLRSRIKQMTTQGEE-LREQKEKSEQKTEEARRKLAEMDEQIK
FIL1L_HUMAN     ---------------LALAEARVQEEEQKATRLEKELQTQTTKFHQDQDTIMAKLTQLQQKLAALSRQID
TPM2_SCHMA      -------------------KKKMLAMKLDKENAVDEADQLEAKLREKELEMQTKDEEVAEVLKKIQQVDT
SYCP3_RAT       -----------------ASNQKIEQIKTQQEEIQKLNNEYSQQFLSVLQQWEQKFEEQGEKLTNLQQQKI
SMC4_DICDI      QEM-VEKQLEQELVTQKASNDKLKNLKQQNKQLDELNKQMNELLTTEKKKYKEETKHLKTKV----KKNN
SAS6_DANRE      -------------------QTKVSELETANRELIDKKYKSDSTIRDLKAKLEEECQRSKQQVLSLRRENS
MLP1_YEAST      -----------------SCQKKIDELEDALSELKKETSQKDHHIKQLEEDNNSNIEWYQNKIEALKKDYE
HMMR_MOUSE      ------------------AEKSVEDVQQQILTAESTNQEYARMVQDLQNRSTLKEEEIKEITSSFLEKIT
CNPD_PELLD      ---------------LEAEERAVQIVQEAQKEVTEVNQEWKKKRREFDQEFNQLQKQVQQREAQLKKQLQ
PU92_SCICO      -------------------ENLKETIEQLKKELAEAQKALEKCKKELADCKKEN-AKLLNKIEELNCTIT
MYH8_HUMAN      --------KIAEQELLDASER-VQLLHTQNTSLINTKKKLENDVSQLQSEVEEVIQESRNAEEKAKKAIT
HMW2_MYCGA      QKLKIEREKENQERRYKAAEASLNKKRQEIDELLEANTKLNEASLKENDLNNQK-REILAKLRNLEKIQL
GCOM1_XENTR     ---------------------------------------------------ENKIEERDAKIAELDKLVH
CEP63_CHICK     ---------------------------------LGVREQELSSARAALEEKHKEVGKLRQQLEDMEAAKQ
CC150_MOUSE     --------------ELAESKEDINVLNQNLQTLMEENKHLTNKMASLEHHYQGKVEKALEKITDLQTKVK
BPA1_HUMAN      RQLNQTTGKAEEAMQEASDLKKIKRNYQLELESLEVDRITRAHAVAEKQHLNSQIHSFRDEKELERLQIC
ALM1_SCHPO      -ESELNSSKIKNESLLNERNLLKEMLATSRSSILSHNKSIDESTRELEKNYEVYRNEMTAIQESLSKRNQ
SYCP3_MESAU     -----------------ASNQKIEQIKTQQEEIQKLNSEYSQQFMSVLQQWEQKFEEQGEKLTNLQQQKI
MYH8_CANFA      ------------------ASERVQLLHTQNTSLINTKKKLENDVSQLQSEVEEVIQESRNAEEKAKKAIT
MYH3_MOUSE      ------------------SNERVQLLHTQNTSLIHTKKKLETDLTQLQSEVEDACRDARNAEEKAKKAIT
KIF7_HUMAN      K-ARVQARQVPPATALAQAQQKIRMKEELIGELVRLNRQHSQRIRELEQEAEQ----VRAELSEGQRQLR
KIF15_MOUSE     ------------------------------------------HLAKLLETQEQEIEDGRASKTSLQHLVT
DMD_MOUSE       ---------------------------QRRKKALEISHQW--------YQYKRQADDLLKCLDEIEKKLA
CUX2_HUMAN      KQKGLQEVQITLAARLGEAEEKIKVLKATQAELLELRRKYDEEAASKADEVQREVESLREQLASVNSSIP
CNPD_PROVI      ---------------LEAEERAVQIVQEAQKEVTEVNQEW----KKKRREFDQEVVIKNNKFNQMQKQVQ
APSB_EMENI      ------------------AEEDIQTLQQERDQAMQVAEERDAAFQELRDELDQKIEECQRLTEDLRTQDD
SAS6_CHICK      -------------------QRSIQQLQNRLSELEVINKKGDSTVRELKAKLEDECQRAKQEVVSLRRENT
NUF1_YEAST      -------------------QKKVKQLE---NDLFVIKKTHSESKTITDNELESKIKILENDLKVAQEKYS
MYO1_CAEEL      DQMAMIRRKNNDQISLDALQKSKAKIEKEKGELDDINAQVDQETKSLAKQYEIQVAELQQKVSDLARQVE
MYH7_RAT        --------------------ERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECRNAEEKAKKAIT
MYH7_PAPHA      --------------------ERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECRNAEEKAKKAIT
MYH7_MOUSE      --------------------ERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECRNAEEKAKKAIT
MYH7_MESAU      --------------------ERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECRNAEEKAKKAIT
MYH7_HUMAN      --------------------ERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECRNAEEKAKKAIT
MYH7_CANFA      --------------------ERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECRNAEEKAKKAIT
MYH3_RAT        ------------------SNERVQLLHTQNTSLIHTKKKLETDLTQLQSEVEDASRDARNAEEKAKKAIT
MYH3_HUMAN      ------------------SNERVQLLHTQNTSLIHTKKKLETDLMQLQSEVEDASRDARNAEEKAKKAIT
MRCKB_HUMAN     -----------------AYERRIRRLEQEKLELSRKLQESTQTVQSLHKKLNEEIERLKNKIADLERQLE
MRCKA_HUMAN     -------------------------LEQQLEEANAVRQELDDAFRQIK-AYEKQIKTLQQEREDLNKEL-
MPP9_HUMAN      -----TANSVPECISLTSLEDPV-ILSKIRQNLKEKHAR---HIADLRAYYESEINSLKQKLE--AKEIS
IMH1_ASHGO      EKTPSTSSAGDEIIEAIETKQKYENLVEEHQQLLEKSRHWEQECLDSRKKVETLETELKDVKPKLKNSNE
IFA1_CAEEL      --------------------EKVRFLEAQNRKLAALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRK
GRDN_MOUSE      --------------------EKLETLEQENSELERENRKFKKTLDSFKSQLDEENLELRRRMAQLQLENK
GOGA3_HUMAN     QMQKIKEQFLQQKVMVEAYRRDATSKDQLISELKATRKRLDSELKELRQELEAELSRLHREVAQVRQHMA
GOGA1_HUMAN     ------------------AESKITALEQKEQELQALIQQLSQKVTAETQEKEDVITHLQEKVASLEKRVQ
FKB15_MOUSE     ----------------------VTRLQADLSELREASEQTQTKFKSEKQQLELKVTSLEEELTDLRAEKT
CP250_MOUSE     --------------------------------------------RSVLEHLPMAVQEREQKLSVQRDQIR
CGNL1_HUMAN     --------------------KRERELTALKGALKEEVSSHDQEMDKLKEQYDAELQALRESVEEATKNVE
BRE1_ASPFU      EQEKIATTKVQELA--DAAQARINALE---SEVDRLRLQLDNTKAAHTEIDDVPLEELRAKYQNLERQYS
UACA_CANFA      -------------------EKSLTEIRQLRRELENCKAKLAQHVKP--EEHEQLKSRLEQRAGELAKKVT
SWP70_CHICK     ------------------------------------------------KEARQKRKELRQKLLELERQMK
SMC2_HUMAN      ---------------------------KQQEELDALKKTIEESEETLKNTKEIQ-RKAEEKYEVLENKMK
NEMO_DROME      IQSDVLKNSVPSLCSLGSAEEVVKLQNMMKSTLDKVNQQWRQEAADREHQYKEHVKE-------CQAQIA
MRCKA_RAT       ---------------------EVNHLEQQLEEANSVRRELDDAFRQIK-AFEKQIKTLQQEREELNKEL-
BRE1_CRYNE      ------------------------------SEVEGLSKLWEALDQTVKSKVEQKITRLATEKAKADKEAV
TAXB1_PONAB     KESVITHFK-EEILQLCLAEKE----NLQRTFLLTTSSKEDTFFKEQLRKAEEQVQATRQEVVFLAKELS
SMC1_YEAST      RSNSIRAREVENSVSLDIANLRTQVTQQKRS-LDENRLEIKYHNDLIEKEIQPKITELKKKLDDLENTKD
MYSS_CYPCA      ---------------------------KETNERLEDEEEINAELTAKKRKLEDECSELKKDIDDLELTLA
MYO3_CAEEL      QLESQVADLVEEKNALFLS------LETEKANLADAEER-NEKLNQLKATLESKLSDITGQLEDMQERNE
MYH9_RAT        ----------------------------------------------------------RLKKANLQDQIT
MYH9_MOUSE      ----------------------------------------------------------RLKKANLQDQIT
MRCKB_MOUSE     -----------------AYERRIRRLEQEKLELSRKLQESTQTVQSLHKRLNEELERMKSKMADLERQLE
GFAP_DANRE      --------------------EKVRFLEQQNKMLVELNQLRGKEPSRLGDIYQEELRELRRQVDGLNAGKA
GFAP_CARAU      --------------------EKVRFLEQQNKMLVELNQLRGKEPSRLGDIYQEELRELRRQVDGLNAGKA
EFG_ACIAC       MRLRLKANPVPVVIPIGAEEGFKGVVDLLKMKAII----WDEASQGMKFNYEEIPADLAESAKEWREKMV
EEA1_HUMAN      --------------------KQMKDLFEQKAEIADIKSKYDEE-RSLREAAEQKVTRLTEELNKEATVIQ
DAPLE_XENLA     ----------------------------KKSERLEVSYQGDENWR-----LQQMLDTGNKKINDLEKELH
CE290_HUMAN     --------------------KKITMLEMKERQRAEHCQKMYEHLRTSLKQMEERNFELETKFAELTK--I
CACO1_BOVIN     ---------VPKATVL---QNQLDESQQERNDLMQLKLQLEGQVTELKQELEKALAAARQEHAELAEQYK
ANT1_ONCVO      --------------------KSEKIIVKHETKIYEINK------------YRAELEKLESDKDDLEKRII
YNP9_CAEEL      QQADQTRQEHFKTVSRDKAERLEKTLKVLKSELTESEKA---HTTAI-DELQSSSSKLIQRLDEELRLMR
VIME_RAT        ---------------------KVRFLEQQNKILLELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKA
VIME_MOUSE      ---------------------KVRFLEQQNKILLELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKA
VIME_MESAU      ---------------------KVRFLEQQNKILLELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKA
VIME_CRIGR      ---------------------KVRFLEQQNKILLELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKA
VIME_BOVIN      ---------------------KVRFLEQQNKILLELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKA
SPTCB_DROME     -------------------------------EILERQNHLNQEWSTLREKAEAKMDDLKSAIEDKKRILT
NIN_MOUSE       KEEELKAMMQDLQITCGEMQRKVELLRYESEKLQEENSILRNEITTLNEESNLKLEELNGSQEELWQKIE
MYSN_DROME      --------------------KDIEALERQVKELIAQNDRLDKSKKKIQSELEDATIELEAQRTKV-----
MYSC_CHICK      -----------------------------------------------RKELEEKQVSLVQEKNDLLLQ--
MYO2_CAEEL      DQARATAAQIE------LGKKKDAELTKLRRDLEESGLKFGEQLTVLKKKGSDAIQELSDQIEQLQKQKG
MYH6_RAT        --------------------ERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECRNAEEKAKKAIT
LIPA1_HUMAN     ENTPSTSGKRSSDGSLSHEEDLAKVIELQ--EIISKQSREQSQMKERLASLSSHVTELEEDLDTARKDLI
K1C9_HUMAN      ---------------------KVQALEEANNDL--ENKIQDWYDKKGPAAIQKNYSPYYNTIDDLKDQIV
HOOK3_MOUSE     ---------------LGDLRRQVKLLEEKNTMYMQNTVSLEEELRKANETYKRQVVELQNRLSDESKKAD
HOOK3_HUMAN     ---------------LGDLRRQVKLLEEKNTMYMQNTVSLEEELRSQLETYKRQVVELQNRLSEESKKAD
HMW2_MYCGE      -------------------QKKVEAIFQLKEKVAQERKELEELYLVKKQKQDQKENELLFFEKQLKQHQA
HIP1_HUMAN      ----------------------------------------------------------------LYREIS
GRDN_HUMAN      KLESEVSRYKERLHDIEFYKARVEELKEDNQVLLETKTMLEDQLEGTRARSD-KLHELEKENLQLKAKLH
GPTC8_MOUSE     -----------DVMGMGRMEMELDYAEDERRRVLEVEKEDTEELRQKYKDYVDKEKAIAKALEDLRANYC
GPTC8_HUMAN     -----------DVMGMGRMEMELDYAEDERRRVLEVEKEDTEELRQKYKDYVDKEKAIAKALEDLRANYC
CP135_HUMAN     -------------------DQLAQQLERHKEELLETA---DKELGEAKKEIKRKLSEMQDLEETMAKLQL
CNPD_CHLPD      ---------------LEAEERAVQIVQEAQKEVSEVNQEW----KKKRREFDQEVVIKNNKFNQMQKQVL
CASC4_CHICK     ---------------------------------------------------------LREELAELQSQAK
WAP_ARATH       --------------------------------------------------YKEAVKEAHKKIVELNLHVT
TAXB1_HUMAN     KESVITHFK-EEILQLCLAEKE----NLQRTFLLTTSSKEDTCFKEQLRKAEEQVQATRQEVVFLAKELS
SYCP3_MACFA     -------------------DQRQKLNQEYSQQFLTLFQQWDLDMQKAEEQEEKILNMFRQQQKILQ-QSR
ROCK2_MOUSE     -------------------QKKLYALEEHLSSEVQAKEELEQKCKSINTRLEKTAKELEEEIT-LRKSV-
NDE1_CHICK      --------------------------------------------KAIKDQLQKYIRELEQANDDLERAIM
MYH8_RAT        --------KIAEQELLDASER-VQLLHTQNASLINAKKKLENDVSQLQSEVEEVIQRARNXXXXXXXXIT
MYH7_PIG        --------------------ERVQLLHSQNTSLINQKKKMEADLSQLQTEVEEAVQECRNAEEKAKKAIT
MYH7_BOVIN      --------------------ERVQLLHSQNTSLINQKKKMEADLSQLQTEVEEAVQECRNAEEKAKKAIT
MYH6_HUMAN      --------------------ERVQLLHSQNTSLINQKKKMESDLTQLQSEVEEAVQECRNAEEKAKKAIT
MRCKA_MOUSE     ---------------------EVNHLEQQLEEANSVRRELDDAFRQIKAS-EKQIKTLQQEREELNKEL-
LIPB1_MOUSE     -------------------------LEEHREKLNATEEMLQQELLSRTSLETQKL-ELMAEISNLKLKLT
KINH_DROME      -----------ECAKLKAAESAVNAEEKQRAE--ELRSMFDSQMDELREAHTRQVSELRDEIAAKQHEMD
K1C9_RAT        QLTGLNDGDVNVEINVAPSTDLTQVLNDMREELISKNRQIEQHYESQMTQIEHQLTNSGPEMETNMKQVS
GRIP_ARATH      -----------------AAEQALEHLREAYSEADAKSQEYSSKFSQVEQKLDQEIKERDEKYADLQKEKD
GOGA1_MOUSE     QRDHLTASKA-------GAEHKIVVLEQKEQELQAIIQQHSQKVTAETQEKEKVITHLQEKVIFLEKRL-
FIL1L_MOUSE     -----------------------RLEKELQTQTTEFHQNQDKIMAKLTNEDSQN-RQLRQKLAALSRQID
EVI5L_HUMAN     ENPRLTESRLRETETLGALREKVLDMEKRNSSLPDENNQLQEELKALKVREGQAVASTRELKLQLQELSD
DESP_HUMAN      -------------------EIELKQVMQQRSEDNARHKQSLEEAAKTIQDKNKEIERLKAEFQEEAKRRW
CD158_HUMAN     --------KVKLVNAGSERLRAVKDIKQERDQLLNEVKTSRSELNNLSEEYEVLKRNFRNKSEEMEMTTN
CCHCR_MOUSE     --------------ALAGAEMVRKNLEEAKKELEEIQSLHQEQLSSLTQAHQKALDSLASKAEGLEKSLN
CCD41_RAT       -----------EILKSTVEHHKVLLVEKDRELIRKVQAAKEEGYQKLVVLQDEKL-ELENRLSDLEKMKV
YOND_BACSU      -------------------------LNQKDEQIKDLTKQVNQ-INKDKVGIEQQFNTASEKLVQLNSEVE
VIME_ONCMY      ---------------------KVRFLEQQNKILLELEQLKGKGASRIGDLYEDEMRDLRRQVDQLTNEKA
SMC_BACSU       --------------------EELEKLEGRKEVLKERKKNAVQNQEQLEEQFQQKETVLKEELSTLQAEVK
SMC2_XENLA      --------KPPEILAMIEEAAGTRMYECKKIAAQKTIEKKEAKLKEIQTILEEEITPTIHKLKE--ERSS
SKI_XENLA       LQAKRSLQQELEFLRVAKKEKLREATEAKRNLRKEIERLRAEHEKKMKEANESRLRLKRELEQARQIRVC
SBCC_BACSU      ------------------SEKEPELLQEQLSRLQEIEIKLSE----AKQEEERKKADLRQKEEALQSVMN
RB6I2_HUMAN     ------------------------------------------HSKFMKNKVEQLKEELSSKEAELKKKAA
PLST_CARAU      --------------------EKVRHLEQQNSKLLELGQYKDQHQGSINELCQQEMRELRRQLELMAKDRD
OPTN_CHICK      ------------------------------SEVESLKKQICALFKELQEAHEKKEAELIQK--KLQEKCQ
MYSP_MYTGA      ---------------LSVSERKRITIQQE----LEDARSLLEHAERARKNAENELGEVTVRLTEVQLQVT
MYSP_CAEEL      -------------------------------------------------EYEEQIEIMLQKISQLEKAKS
MYH6_MOUSE      --------------------ERVQLLHSQNTSLINQKKKMESDLTQLQTEVEEAVQECRNAEEKAKKAIT
MY18A_MOUSE     ----ISSQESKDEASLAKVKKQLRDLEKDQEEELDEQAGSIQMLEQAKLRLEMEMERMRQTHS---KEME
MRCKB_RAT       -----------------AYERRIRRLEQEKLELSRKLQESTQTVQSLHKRLNEELERMKSKMADLERQLE
KINH_SYNRA      QQQTLT---VEDLVSLRRELAESKMLVEQHTDAMEAKKELEGRLGALEKEYEELLDKIAEEEANMQNADV
EP15R_MOUSE     --------------------KELDDISQEIAQLQREKYSLEQDIREKEEAIKQKTSEVQELQNDLDRETS
EEA1_MOUSE      --------------------KQMKDLFEQKAEIADIKSKYDEE-KSLRAAAEQKVTHLTE---DLNKQTT
CUT_CAEEL       --------------------------------------------KKAEQELNDRLTELIAEKEKMKEQNE
CGNL1_MOUSE     LEEALVHARKEEKEATCARRALEKELEQAQRELSQVSQEQKELLEKLRDEAEQK-EQLRKLKNEMESERW
CCD41_MOUSE     --------------------------EELHNQLLSVDPTRDS--KRMEQLVREK-THLLQKLKSLEAEVA
CCD18_HUMAN     --------------------KQGKRAERQRNEALYNAEELSKAFQQYKKKVAEKLEKVQAEEEILERNLT
CC151_BOVIN     --------------------EKVKQLNALRHQL-GLRQKWLEELQLQHSLRELEIAEAQDSNTEVAKTMR
CASP_CAEEL      --------------------------------------------KKAEQELNDRLTELIAEKEKMKEQNE
ATG11_PICST     -----------------------------RLELIKIKKE-NTELINENSALHQSNDESQKLIKDLRKEIE
Y1002_CHLCV     --------------SIGLREKQLKMAAGQ-----------------LLQTKIRKIVEKDEGLRKICESVE
VIME_PANTR      ---------------------KVRFLEQQNKILLELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKA
VIME_MACFA      ---------------------KVRFLEQQNKILLELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKA
VIME_HUMAN      ---------------------KVRFLEQQNKILLELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKA
VIME_CERAE      ---------------------KVRFLEQQNKILLELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKA
SMC2_MOUSE      -----------------------------------------------------------EKYEALENKMK
OPTN_MOUSE      -------------------EKEDKGQESVGSEVETLSIQVTSLFKEL-QEAHTKLSEAELMKKRLQEKCQ
OPTN_DANRE      ------------------ASTEVKNLEDQLLKLCNELKQAQDEAESMKRNLQDRCKDLEQDLGTLKTQLG
NDE1_HUMAN      ------------------------------------------YWKDLAMTYKQRAENTQEELREFQEGSR
MYO5C_HUMAN     --------------------------------LKKATRVLESHFQSQKDCYEKEIEALNFKVVHLSQEIN
MYH9_HUMAN      ----------------------------------------------------------RLKKANLQDQIT
MYH9_CANFA      ----------------------------------------------------------RLKKANLQDQIT
MYH13_HUMAN     ---------------------------QEAEEKTETANSKCASLEKTKQRLQGEVEDL---MRDLERSHT
EP15R_HUMAN     ----------------------VKELDDISQEIAQLQREK----YSLEQDIREKEEAIRQKTSEVQELQN
DZIP1_DANRE     QQAMFSAGISANYHKCQHCEKAFMNASFLQSHMQRRHSEFDMKLMTDNQKKIQTV-KLQDEINKLQEQLT
DIAP1_HUMAN     ----------------------------------------------------------------------
CD158_MOUSE     SQANSVQSQLE--IIQEQARNQNSMYMRQLSDLESTVSQLRSELRESKRMYEDKIEELEKQLVLANSELT
SYCP3_HUMAN     -------------------DQRQKLNQEYSQQFLTLFQQWDLDMQKAEEQEEKILNMFRQQQKILQ-QSR
MYS_AEQIR       ---------------------RTEELEDQKRKLLGKLSEAEQTTEAANAKLEKAKSRLQQELEDMSIEVD
MYH7_HORSE      --------------------ERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECRDAEEKAKKAIT
MYH6_MESAU      --------------------ERVQLLHSQNTSLINQKKKMEADLTQLQTEVEEAVQECRNAEEKAKKAIT
MYH13_CANFA     ------------------ASDRVQLLHSQNTSLINTKKKLEVDIAQCQAEVENSLQESRNAEEKAKKAIT
MY18A_HUMAN     AELQISSQESKDEASLAKVKKQLRDLEKDQEEELDEQAGTIQMLEQAKLRLEMEMERMRQTHS---KEME
MOES_LYTVA      -------------------EEKYKRLQQQEKELAEEKKRWEEESRAMQEQQQMESEEYQSKVAAMEMQMN
MLP2_YEAST      ----------------GLAKEKERMLEEAIDHLLEKQKSWPSYIHVEKERASTELSQSRIKIKSLEYEIS
MFP1_ARATH      DRVSDLETMLDESRAL--CSKLESELAIVHEEWKEAKERYERNLDAEKQKNEISASELRRRVKDELEGVT
LRCC1_MOUSE     -------------------------LDEQKTGVIKVDKNFSDNYRSLVEQLDQE-REMRWKAEQTEKKLM
KIF7_DANRE      ----------------------IRMKEELIKELVKTGKD----AQAMNRQYSRKISELRVELTEAQKQLQ
GOGA4_MOUSE     --------------------------------------------REQAGAYEEQLAQMQQKVLDLEKQVV
FLIP1_HUMAN     ---------------------KLVGLTQRIEELEETNKNL--------QKAEEELQELRDKIAKGECGNS
SGM1_YEAST      -------------------------LIKEKDDLIDQLRKEGAKLAETELRQSNQIKALRTKVKDLEYEVS
ROCK2_RAT       -------------------QKKLYALEEHLSSEVQAKEELEQKCKSINTRLEKTAKELEEEIT-FRKNV-
NDE1_XENTR      -------------------------IEGRNRDLFSENNRLRMELDGIKEKYEEQHSENYVQICSLEGDLS
MYSP_BRUMA      --------------------------------------QWKSKFDAEVALHHEEVEDLRKKML-------
MYO1_YEAST      --------------------------------------------KESKLKLENEIKRLKDVINSKEEEIK
ITSN1_XENLA     ---------IPEKQSLIDQLKQVQQNSLHRDSLLTLKRALETKEQQLRDQLDEVEKETRAKLQEIDVFNN
GOGA5_MOUSE     --------------AVTLAERKYSEEKKKVDELQQQVKLHRASLESAKQEYKQKATRIKEKLINSLKEGS
GCC2_MOUSE      EL-------VPEL------ESTIKNLQADNSMYLASLGQKD----TMLQELEAKISSLAKEKDDFISKIK
GCC2_HUMAN      -----------------AKEEQGCVIEKLKSELAGLNKQFEQHNRSLKEQHQKEISELNETLSDSEKEIQ
ETP1_YEAST      ---------------------------------------------SQREYYELKLQEKDQTASDLKKSME
CTK2_XENLA      GKTKVSSS-VTQPAAIGAEKKK--------------RAAWD--LKGQVNDMRDTVSNYKGKMQNLTGENA
CC146_RAT       ---------------------------------------------------------LRNCLMDKQNYHD
SPDLY_MACFA     -------------------------LDKCRNEMMTMTESYEQEKYTLQREVELKSRMLESLSCECQQQKM
RRBP1_MOUSE     QENSILRDALNQATSQVESKQNTE-LAKLRQELSKVNKELVEKSEASRQE-EQQRKALEAKAATFEKQVL
RMUC_NEIMA      -----------------AAEKQIAHLQEKEAESVRLKQSYQEKAQGLAVENERLATQLRKAFADLERQIT
OPTN_XENLA      ------------------------------------------------QETNDKLNEAKQFKNSLQEKCI
NUF2_EMENI      --------------AISERGNNVREVEQTEKLLQRQLARWNERIEALRNTAHEKAQVAQKRMEELREVQI
MYSP_SARSC      -----------------------KRLAQKEEEIEALRKQYQIEIEQLNMRLAEAEAKLKTEIARLKKQIT
MYO4_CAEEL      ------------------AEKRATLLQSEKEELLVANEAAER----ARKQAEYEAADARDQANEANAQVS
MOEH_CULQU      -------------------------------------QEYEDRIRNMQEEMERSLIEAQDMIRRLEEQLK
MAD1_YARLI      ---------------------------------------------------KKTISQLRYDLEALKQEQQ
KIF8_DICDI      -------------------EKKLNELKQQLDQHAGSNKKDYQRLLDLKRKSEEKIDSLQQDIKDTKRQKS
KIF4_XENLA      --------------------QEIQGMKMQRVQLMRQMKEDAEKFRTWKQQKTKEVIQLKEKDRKRQYELL
K1C10_MOUSE     ---------------------KVRALEESNYELEGKIKEWYEKHGNSSQREPRDYSKYYKTIEDLKGQIL
HOOK_AEDAE      -------------------KKQIKMLEECSAEYLKQNLQHEEEYSGLKGQYKKEIQDLHAKLDSEMSKTV
DCTN1_CHICK     -------------------EEKLETLKIKRNEDKAKLKELEKYKIQLEQVQEWK-SKMQEQQADLQRRXX
CENPE_MOUSE     ---------------------------------------------AQNQDLREKEHQLSQVKADLRETVD
CD72_HUMAN      -------------ICLGVRYLQVSQQLQQTNRVLEVTNS------SLRQQLRLKITQLGQSAEDLQGSRR
CCD68_HUMAN     --------------------EEVRKKQEDSKQLLQVNKLEKE--QKLKQHVEN-LNQVAEKLEEKHSQIT
CACO1_DANRE     ----------------------MKKKQKEVEDLGEALTEEKRALLAQKEANEQRIRELEEDIKILTQRET
ANR26_HUMAN     DQFHAIVQKLQ-----AESEKQSLLLEERNKELIECNKERQYQYENEKAEREVVVRQLQQELADTLKKQS
XNIF_XENLA      --------------------EKVHHLEQQNSEVTLLRQKHSEPSR-LSHIYEQEIRELRSKL-------E
TRIPB_HUMAN     --------------------------EQMNATHTQLFLEKDEEIKSLQKTIEQIKTQLHEERQDIQTDNS
TPM_MIMNO       -------------------ERSEEKLNSTTEKLEEASKAADESERNRKNSYEERIDELEKQLETAKNVAT
ROCK2_HUMAN     -------------------QKKLYTLEEHLSNEMQAKEELEQKCKSVNTRLEKTAKELEEEIT-LRKSV-
PMFBP_MOUSE     QEARQSTSKI-DCEALRAEIQKLKDSLEEAREQLKVS---DQNLTQSKEEAHLSASSLE----DAHRKIE
ODFP2_CHICK     MNKELELARKQFQSQLAELEKLPEILRITETQLAECQDQL--------QSYEKKNMDLSVMIADLRQRI-
NU211_SCHPO     --------------------------------------------RNKEKKFEEAISSLQLEKSNIQLQLT
NMCP_ARATH      -------------------EERDALRNQHKNDVESLNREREEFMNKMVEEHSEWLSKIQRERADIEMQKR
NDC80_NEUCR     -----------------------KIMEEDKIKFEEYNTLAMQR----TEKYENRIQVLREELGKLHVELK
MYSU_RABIT      -----------------ALEQQVEEMRTQLEELLEVNTQ------AMKAQFERDLEQSEEKKRLLTKQVR
MYSP_ONCVO      --------------------------------------QWKSKFDAEVALHHEEVEDLRKKML-------
KIF15_HUMAN     ------------------------------------------HLAKLLETQEQEIEDGRASKTSLEHLVT
KI20B_MOUSE     EEVTRLANNLHDTKQLLQSKEEENEISRQETEKLKANSILTQNLKADLQKKEEDCAELKEKFIDAKKQIE
K1C15_PROAT     ------------------------MLDQMRREAERWYNEKAKDVKDKAGEAQETLVSHTSEISDLKRSIQ
HOOK_CULQU      -------------------KKQIKMLEERSAEYLKQNSDFEEEYAGLKGQYKKEIQDLHAKLDSEMGKTM
HOOK2_HUMAN     ---------------------------------------------------QQQLSELRAQVEDLQK---
FBF1_HUMAN      ----------------------IHQMEKFSSSLHELSSRVEASHLTTSQERELGIRQRDEQLRALQEQQR
CUX1_MOUSE      -------------------------LEKTRTELFDLKTKYDEETTAKADEIEMIMTDLER--ANQRAEVA
CTGE5_MOUSE     -------GALKKLIYAAKLNASLKALEGERNQVYTQLSEVDQ----VKEDLTEHIKSLESKQASLQSEKT
CT2NL_PONAB     ------------------------MLEKERERLLEFEKSQVKKFEKEQKKLSSQLEEERSRHKQLSKKAT
CT2NL_HUMAN     ------------------------MLEKERERLLEFEKSQVKKFEKEQKKLSSQLEEERSRHKQLSKKAT
CROL2_HUMAN     ------------------AQREVQRLRSAK-ELLRREKSNLAHSLQVAQQQAKELRQERKKLQAAQEELR
CNTLN_HUMAN     KRLQVTNPDLTQVVSLVVEREKQKSEAKDRKEILQVKDAKIQEFEQRESVLKQEINDLKRKIAFLRKEFS
CING_CANFA      -----------------------------------------------QSELSQKVEELQQKLDEEVKKRP
YD72_SCHPO      -----------------------KLSEQSGNVTADTNEHYDRAMQYLKQLVENILNRSLDNLIDTLKQVQ
WIT2_ARATH      -------------VQLEAKDLLVQKLESENSEIVSEVLTLREYVKSAEQKLKNTDLELKSVNASKQEILV
TANA_XENLA      ---NAAADPIEEVISESVSYQTVHFEKQELSNLLEIENTHENHFNSCEQDGHDRASTLENNEPDVQQYIR
STX4_BOVIN      -------------------ENKVRELEKQQVTILATPLPEE----SMKQDLQNLRDEIKQLGRDIRAQLK
ROCK1_BOVIN     ----------------GERKEAQDMLNHSEKEKNNLEIDLNYKLKSLQQRLEQEVNEHKVTKARLTDKHQ
RAD50_SULSO     -----------------ALESKILDLENKRVKLDEMKKK-----KGILEDYIRQVKLLQEEVKNLREEVN
PLPA_MYCGA      -----------------ALEDSNKRIESQLQALLDSNNQPSQEEVDSRSKLEQRLEELAYKL-DQTKEII
NIN_HUMAN       -----------------AVQKMVENLKKQISELKIKNQQLDLENTELSQQNQEKLQELNQRLTEMKEKEP
MYSP_OPIFE      -------------------------LKSQVNDLVDKNAALDRENRQLSDQ----VKDLKSTLRDANRRLT
MYSP_DIRIM      --------------------------------------QWKSKFDAEVALHHEEVEDLRKKML-------
MYSP_BLOTA      -------------------------IEQLNMRLAEAEAKLKTEVARLKKKYQAQITELELSLIDLQKQIT
MTS1A_DANRE     -------------------EKKNQTIRQLENTLLSNNRRFEEHDEVMKQRRDQELVTLREELVSSGHSCE
MEU1_SCHPO      ----------------------------------------------------------------------
MBO1_SCHPO      -------------------QKRLQTLEEENNKAKEDSTSKTSNLLEQLKMTEAEVDSLRKENEE-NKQVI
KIFC1_MOUSE     ----------PVVVGKRAGKRPAWDLKGQLCDLNEELKR----YREKTQTLELENRGLREQLREVQEQAT
HOOK3_XENLA     ---------------LGDLRRQVKLLEEKNTMYMQNTVSLEEELRSQLETYKRQVVELQNRLSEESKKAD
HOOK1_CHICK     -------------------ENKMLLLQQEGSEIMELQKQLEQELGTEKRLNKERIGELQQQIEDLQKTLQ
GCOM1_HUMAN     ----------------------------------------------------------------------
FBF1_MOUSE      -----------------AEQARAELVAQHQRQMAMAEQERDQEVARLRELQQASILEMRQRLKMLKDQEI
CYTSA_TAKRU     -------------------------LEQAHSDLGHLQETFSKLDREYREFREQAQRQLSEQERALEKQRM
CCD91_RAT       -------------------------------------------------------SQLRQKISSLE---T
ATG11_NEUCR     -----------------------------KKDLLQNMEALKREFTEERKSLEEEVKQLKARLEYTEDEIE
YOMI_BACSU      -------------------------------------------------QAKSDLLSLQGDISSVNDQIQ
YG3A_YEAST      ----------------------------------KIHQAWLADLRAKKDKYDAKNKEYKEKLQDLQNQID
SPDLY_HUMAN     -------------------------LDKCRNEMMTMTESYEQEKYTLQREVELKSRMLESLSCECQQQKM
SPC25_CANAL     -------------------------------------------FDNLKIEMNELAVDLDQQLSDKQSLIL
ROCK2_BOVIN     -------------------QKKLYTLEEHLSTEIQAKEELEQKCKSVNTRLEKVAKELEEEIT-LRKNV-
RMUC_NEIMB      -----------------AAEKQIAHLQEKEAESARLKQSYQEKAQGLAVENERLATQLRKAFADLERQIT
NUF2_ASPFU      ----------------------VREVEQTEKLLQRQLARWNERIEALRKNAQEKAEVAQARMDELRDVQK
NEMO_RAT        -----------------AIRQSNQMLRERCEELLQVSQREEKEFLMCKFQEARKLVER------LSLEKL
NDE1_RAT        ------------------------------------------HTKAIKDQLQKYIRELEQANDDLERAIM
MYSS_RABIT      ------------------------------AEELKKEQDTSAHLERMKKNMEQTVKDLQQRLDEAEKQIQ
MYSP_BOOMI      ------------IMDLEKATAHAQNLEKRVAQLEKLNIDLKSKVEELTILLEQSQRELRQKVAEIQKLQH
MIX1_CAEEL      -------GNKPALIALEPMYARRPQIEAQQRELDALNRELQ-----LTEASSQKCRDLNNQLATAMRKLA
LRC45_MOUSE     ---------------LQMTEAALALSEQKVRDLGELLVAGDQERQSLSQRHEKERKLERQEAADREKLLR
KINH_RAT        KQLESTQXXXXXXXXLAACQLRISQHEAKIKSLTE----YLQNVEQKKRQLEESVDSLGEELVQLQEKVH
KIF4_CHICK      --------------------------------------QNDSQLEPIQSQYQTNIKDLELEVSNLQKEKE
KI20B_HUMAN     -------------------------------EELSASSARTQNLKADLQRKEEDYADLKEKLTDAKKQIK
K1C9_CANFA      -----------------------KILNDMREEYERISKDIEEQYETQMSQMEQEVMSSGQEMESNHKEVT
K1C10_CANFA     ---------------------KVRALEESNYELEGKIKEWYEKHGNSSQRAPRDYSKYYQTIEDLKNQIL
IFEB_ASCSU      EMGSASIGGISPALSANAAKSFLEATDKEKKEMQGLNDRLGNYIDRVKKLEEQN----RKLVADLDELRG
HMMR_HUMAN      ------------------AAKAGKNAEDVQHQILATNQEYVRMLLDLQTKSALKETEIKEITVSFLQKIT
GAS8_BOVIN      HQSSLTEMKAEGTVVMKLAQKEHRAQEGTKVELKEQELANEVMVKNLRLKHTEEITKMRN---DFERQVR
FIP37_ARATH     NESFVPAGKSPEPRFLIDYIQNLKSSEKSLKEQLEIAKRKEASCIVQYAKREQEMAELKSAVRDLKSQL-
CCD18_MOUSE     -------------------------LEKSELELKECNKQVE----SLNEKLQNAKEQLREKMLQNEQEIS
APOA1_COTJA     -----------------------KDLEEVKEKIRPFLDQFSAKWTEEVEQYRQRLAPVAQELKDLTKQKV
Y451_HELPY      ----------------------------------------------------------------------
VIMB_CARAU      --------------------EEVRFLEQQNKILTELEQMRGKGSSRVGDLYEDEMRELRRQVDQLINEKA
SYCP1_MESAU     -------------------EKMILAFEELRVQA--ENARLDMHFK-LKEDHEKLQEEYKKEVNDKENQVS
STAT3_RAT       ----------------------------------------------------EKQQMLEQHLQDVRKRVQ
STAT3_PIG       ----------------------------------------------------EKQQMLEQHLQDVRKRVQ
STAT3_MOUSE     ----------------------------------------------------EKQQMLEQHLQDVRKRVQ
STAT3_HUMAN     ----------------------------------------------------EKQQMLEQHLQDVRKRVQ
RUFY2_PONAB     --------------AMRQLEQRLQQAEKAQMEAEDEDEKYLQECLSKSDSLQKQISQKEKQLVQLE---T
RUFY2_HUMAN     --------------AMRQLEQRLQQAEKAQMEAEDEDEKYLQECLSKSDSLQKQISQKEKQLVQLE---T
PIBF1_HUMAN     ---------------------------------------------NLKVDYLTKIEELEEKLNDAQKQLL
PHLB2_MOUSE     -EKNIVGEKTKEKVKLDAEREKLERLQELYSEQ---KTQLDNCPESMREQLQQQLKRDADLLDVESKHFE
PHLB2_HUMAN     -------------------------LEELKQKIKDINDQMDESFRELDMECEQKLDHLNRKIAELEKNIV
ODFP2_RAT       KENKQLSQKVDEL------ERKLEATSTQNVEFLQVIAKREEAIHQAQLRLEEKTRECGSLARQLESAIE
ODF2L_MOUSE     ----------------GQVESNLKQVEQARSSFTSAEQRL--------QECQEKLQRCKEKCAEQALTIR
NDL1A_XENLA     ------------------------------------------YWRELSKRLKQSYQEARDELIEFQEGSR
MYS3_HYDAT      ------------------------------------------------QEAEEKIDELTEKTEELQSNIS
LAMB4_DANRE     ----------------------------------------------LAEMTEKNITALRSQLKEADAQLS
KTN1_CHICK      QMRSSVASLEHEVERLKEEIKEVETLKKER-EHLESELEKAEIERST---YVSEVRELKDLLTELQKKLD
KIF5C_MOUSE     ------------------AEEVKKALEQQMESHREAHQKQLSRLRDEIEEKQRIIDEIR----DLNQK--
KIF4_MOUSE      --------------------QEIRMMKNQRVQLMRQMKEDAEKFRQWKQQKDKEVIQLKER--DRKRQYE
KIF27_MOUSE     QEINLQKLRTSELI-LNKAKQKMRELTRMKEDLIKELIKTGNNAKSVSRQYSLKVTKLKVELTETRKQLQ
K1C20_RAT       --------------------EKVRSLEQSNSKLEAQIKQWETNAPSTIRDYSSYYAQIK----ELQDQIK
K1C10_BOVIN     ---------------------KVRALEESNYELEVKIKEWYEKYGNSRQREPRDYSKYYQTIDDLKNQIF
F184B_HUMAN     --------------------------------------------QAMQQSVSQALWQWQEKESDLRKQVR
EFG_AZOSB       MKMRLKANPVPIVLPIGAEEKGVVDLIKMKAII------WDEASQGMKFEYQDIPAELQGDAETWREQMV
DCTN1_DROME     --------------AQASLQKELLRAKQEAKDAIEAKEQHAQEMADLKEMAEEKADTLQLELESSKERIE
CNPD_ARCB4      -------------VFIEQAKAKAKVIEHEKDAQLKAKIECDREFKSAKREYEAMLLKIERKERELNEHLS
CLIP1_MOUSE     -------------------------------------------------QKEEQFNVLSSELEKLRENLT
CENPJ_PANTR     --------------------EEIQTLKQQIADLREDLKRKETKWSSTHSRLRSQIEMLVRENTDLREEIK
CENPF_HUMAN     -------------------EQKIQVLQSKNASLQDTLEVLQSSYKNLENELE--LTKM-DKMSFVEK-VN
CENPE_HUMAN     -----------------------------------------QNFKTLHMDFEQKYKMVLEENERMNQEIV
CE290_BOVIN     --------------------KTMIQLQNDKLKIMEEMKNSQQEHRSLKN----KTLEMELKLKGLEDLIS
CCPG1_CHICK     ---------------LTSTEVEKKSFESQKKSLAAEN----QHLRESLEKEEKALVSLQEELRKLRQQIR
CC147_HUMAN     ------------------AESEIKLKQQQN--LYEAVRSDRNLYSKNLVEAQDEITDMKRKLKIMIHQVD
CACO1_RAT       ---------VPKATVL---QNQLDESQQERNDLMQLKLQLEDQLRSRVQELEAALATARQEHSELTEQYK
C3H41_ARATH     TGGAPSSSEQPKPVVVTTSGPKVTPLQQKKADTLERLKET---LRKKQEMLEQKRNEYRKKLATLEKQGT
BRE1_ASHGO      ----------------------------------------------------------------------
ATG16_XENTR     -----------------------------------------QDMAQMRIKHQEELTELHKKRGELAQTVI
YQOE_CAEEL      LDDTVTARKVAEKRATQTNEKVNKLANELKDER-EINQMLRKDQQVWKGQVEKLIESQKTARTEYEKKIE
Y4A0_ENCCU      -------------------------IDELRTRCLNM-KRWKDEYAELREDYEALQKKLKDEVEDMQNEIR
TIG_PROM5       ----------------------------------------------VRNNIEQTAQRFAQQGMDIKSTFT
TAXB1_RAT       ------------------------------------NKEDTLLLKEQLRKAEEQVQATRQELIFLAKELS
SYGP1_HUMAN     -------------------------IEREEYKLKEYSKSMDESRLDRVKEYEEEIHSLKERLHMSNRKLE
SYCP1_HUMAN     -------------------EKMITAFEELRVQA--ENSRLEMHFKHLEQEYKKEINDKEKQVSLLLIQIT
STAT3_CHICK     ----------------------------------------------------EKQQMLEQHLQDVRKRVQ
SMC6_MOUSE      -----------------AEENKIKM--QMVEKNMEQQKENMENLKSLKIEAENKYDTIKLKINQLSELAD
SLMAP_HUMAN     ----------------------------------------------------------------------
QN1_HUMAN       -------------------QQENERLYNQVKDLQEQNKKNEERMFKENQSLFSEVASLKEQMHKLSQVVE
OPTN_RAT        TEGSTQKDKDPESVGIEVETLNVQVASLFK-ELQEAHTKLSEA-ELMKKRLQEKCQALERKNSATPSELN
ODFP2_MOUSE     KENKQLSQKVDEL------ERKLEATSAQNVEFLQVIAKREEAIHQAQLRLEEKTRECGSLARQLESAIE
NEMO_BOVIN      ---------------------------RQSNQMLRERCEELQHFQGNQREEKQKFQEARDLVVRLSLEKR
NDEL1_XENTR     ------------------------------------------YWRELAKRLKQSYQEARDELIEFQEGSR
MYH2_PIG        --------KVAEQELLDASER-VQLLHTQNTSLINTKKKLETDISQMQGEMEDILQXXXXXXXXXXXXIT
MYH10_RAT       -------------------EKSKRALEQQRTQLEELEDELEVNMQAMKAQFERDLEQNEEKKRLLLKQVR
MYH10_MOUSE     -------------------EKSKRALEQQRTQLEELEDELEVNMQAMKAQFERDLEQNEEKKRLLLKQVR
KIF1_DICDI      SSVAITQDEVP----FGFAIIQLRRVWLLQANSVEDRDKWVQTLDPLRKVTELKDEELRTAKQQIEKSSS
GRAP1_RAT       -------------------------LNSQLQESLRANSRLLEQLQEMGQEKEQLIQDLQEKSAEKRKVML
FAT1_SCHPO      -------------------------------------KNMQLELASLKQISAAFFTRIPLKIKDFKKEIN
DIXC1_RAT       -----------------------RKLDERNRLLGEYKKDLGQKDRLLQQQ-QAKLEDALRKLSDASYQQV
DCTN1_XENLA     -------------------EEKLETLKMKRAEDKAKLKEMEKSKLQLEQVQEWK-SKMQEQQADIQRQXX
CTTB2_RABIT     ----------------------VKECKQLSGKVIEEAQKLEEVMASLEEE-KKKTNDLEEQLCTEKRRSA
CLPB_HELPY      -----------EPAKLSSVKRSIQRLEMEK-QALEMEK---------KESNAKRMQEILKELSDLKEEKI
CEP63_PONAB     ---------------LDVTHKEVGMLHQQVEEHEKIKQE-------MTMEYKQELKKLHEELGILKRSYE
CEP63_MACFA     ---------------LDVTHKEVGMLHQQVEEHEKIKQE-------MTMEYKQELKKLHEELGILKRSYE
CEP63_HUMAN     ---------------LDVTHKEVGMLHQQVEEHEKIKQE-------MTMEYKQELKKLHEELCILKRSYE
CENPC_HUMAN     ----------------------------------------------------------------------
CCD69_XENTR     ---------------------------QEPNELLQKIKKYEQETRDILQKHQAEKAALADTKADVEARTL
CACO2_BOVIN     -----------EDILVVTTQSEVEEIEQHNKELCKENR------------------ELKDSCVSLQKQNS
BFR1_YEAST      -------------------------LKKIDTEIGLIRKQIDQH------QVNDTTQQERKKLQDKNKEII
AKAP9_HUMAN     -------------------QKQVKALEEQVSRFIELEQEKNTELMDLRQQNQALEKQLEKMRKFLDEQAI
AGLZ_MYXXD      ---------------LSARAKKIQDLELAVENAQGAKSRAEKELNAKVAAAESKAHEASTRLAAAQKERK
ZIP1_YEAST      -------------------------LKQRIQQLVEI-KENEQKDHTTKLEAFQKNNEQLQKLNVEVVQLK
YB145_PLAF7     ------------------------MKEEYEDKMNTLNEQNEDKMNSLKEEYENKINQINSKIKDVVEEVD
YA046_HUMAN     -------------------EKRIYDLKKKNQELGKFKFVLDYKIKELKKQIEEQIQEMEAELENFHKQNT
VIME_CHICK      ---------------------KVRFLEQQNKILLELEQLKGKGTSRLGDLYEEEMRDVRRQVDQLTNDKA
UACA_HUMAN      -------------------EKSLSEIRQLKRELENVKAKLAQHVKP--EEHEQVKSRLEQKSGELGKKIT
TNNT2_RAT       ----------------------------------------------------------------IQKAQT
T4AF1_HUMAN     QPPSALSGGQPADTQTRATSKSLLPV---RSKEVDVSKQLHS---GGPENDVTKITKLRRENG--QMKAT
SYCP1_MOUSE     -------------------EKMILAFEELRVQA--ENARLEMHFK-LKEDHEQHLEEEYQKVNNKENQVS
RFIP4_MOUSE     -------------------------LEREKSTELEL-------LNTRVQQLEEENTDLRTTVARLKSQTE
RAD50_THEAC     -------------VKIGALRQKEEEIRRNMNMLEGHNKLGDEGSRRIREHYSEDLNRLNEEIDHLEREAS
RAD50_ARATH     -----------------------------------------------KDKLHGELEKLRDDQIYMERDIS
PUMA_PARUN      --------------------------------------------RAELRDHKQHLHDAISRIAELQRQLQ
PFDA_IGNH4      ----------------------------------------------------------------------
MYO5A_HUMAN     EEAKVATGRV-----LSLQEEIAKLLEQTRSE----KKCIEEHADRYKQETEQLVSNLKEENTLLKQEKE
MYH10_HUMAN     -------------------EKSKRALEQQRTQLEELEDELEVNMQAMKAQFERDLEQNEEKKRLLIKQVR
MYH10_BOVIN     -------------------EKSKRALEQQRTQLEELEDELEVNMQAMKAQFERDLEQNEEKKRLLIKQVR
MD1L1_MOUSE     -------------------------LQQRELTLKEKNNSITSSARGLEKVQQQLQDEVRQANAQLLEERK
KIF15_STRPU     -------------------------LKGKKAEITQLQEEIQKHLEKLDSERDKSMAELRQDLLDAQELID
KI21A_HUMAN     -----------------------------KQKLIDELENSQKRLQTLKKQYEEKLMMLQHKIRDTQ----
GOGA2_HUMAN     QLQQAMEERAQLEAHLGQVMESVRQLQMERDKYAENLKGESAMWRQRMQQMSEQVHTLREEMSRVQELET
EVI5_HUMAN      -----------ELIAVKLREAEAIMLKELRQQVKDLEEHWQRHLARTTGRWKDPMNELQDELMTIRLR--
CING_XENTR      -------------------EQDAMQTKRSYEELVKINKRLESELERVRQVIENNLQESREENDDLRRKIL
CING_XENLA      -------------------EQDALMTKRSYEELVKINKRLESELERVRQVIENNLQESREENDDLRRKIL
CI117_RAT       KDTS--GSKTPELAMVEELKEFYKQIQDLEDRLARYQRKWDEQEKLFRQEFEQLANNKKEIVAFLKREIT
CC146_HUMAN     EVKTLNDSKVENKVSAIVDEKEIKEVEGKRALLEIKEREHNQLVKLLELARENEATSLRNSLIDKQNYHD
CAR14_HUMAN     --------------------------EEKEQTLLQFQKS-----KMACQLYREKVNALQAQVCELQKERD
BPAEA_MOUSE     ---------------LDETNNTLKCLKEDLERKDQAQERYSQQLRDLGGQLNQKAEEVRQEANDLKKELE
ZWINT_RAT       --------------------------DTSRQKATETKEQWKEHVDVIKCALSEQVKEAHRKYTELQKAFE
ZWINT_MOUSE     --------------------------DASRQKATETKEQW----KDMKATYMDQVKEAHRKYTELQKAFE
YM92_CAEEL      ---------------------------------------------AMNNRHQKVVACLDEKISEAEKQCE
YL139_YARLI     ------------------------MSEEQLFEVIKLTTQLDQS-QARVREVEELVQQCSEQLNERSVEID
YA046_MOUSE     -------------------ENEIKVMKEQIQEM----EAELERFHKQNTQLELNITELLQKL-----RAT
VIM4_XENLA      ----------------------------EKAEMIELNDRFANFIRFLEQQNKILVAELEQLKGKGTSRIG
SYS_SYNE7       -----------DIQPLLSLDQQVRQWEQERTQLQEIGRSVGQKMREGADPQSEEIAALREEGNQLKQQIA
SYS_DESHY       ----------------------------------------------------------------------
SYCP2_MOUSE     ----------------------------------------------------EKVEKDSQTLRDLEKELV
SPC24_HUMAN     -----------------AAFRDIEEVSQGLLSLLGANRAEAQQ-RRLLGRHEQVVERLLETQDGAEKQLR
SHE9_ASHGO      -------------------------LEKARASVQEANKKLVQQEREGENSMLTFNDDLENK-----SKIV
RIMB1_HUMAN     ---------------------------------------------------EQRVQQLESELSKKRKKCE
RHG17_RAT       ----------------GIAEVEIPNIQKQRKQLARLVLDWD----SVRARWNQAHKSSGTNFQGLPSKID
RHG17_MOUSE     ----------------GIAEVEIPNIQKQRKQLARLVLDWD----SVRARWNQAHKSSGTNFQGLPSKID
P54_ENTFC       -------------------------------------------FDSQIQQQDKKIADLQNQQASAQSQIE
ODFP2_HUMAN     KENKQLSLKVDEL------ERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRELESAIEDARRQVE
NFM_PIG         --------------------EKVHYLEQQNKEIIQALRQKQASHAQLGDAYDQEIRELRATLAQVQLDSD
NFM_HUMAN       --------------------EKVHYLEQQNKEIIQALRQKQASHAQLGDAYDQEIRELRATLAQVQLDSD
NDE1_DROME      ----------------------------------ERSKQYHKEWTDVKQEYDEFVEQSREMEIEMQKQIK
MYH2_HUMAN      --------KIAEQELLDASER-VQLLHTQNTSLINTKKKLETDISQMQGEMEDILQXXXXXXXXXXXXIT
MYH2_HORSE      --------KIAEQELLDASER-VQLLHTQNTSLINTKKKLETDISQLQGEMEDILQXXXXXXXXXXXXIT
MTUS1_MOUSE     ---------------LVAASSACEKLEKARADLQTAYQEFVQ---KLNQQHQTDRTELENRLKDLYTYIE
MEDB_GIALA      ------------------------------AEIENIQRQIDDANSSASSEHELRMLRAEVETLRAQKSVT
LCA5L_PAPAN     -------------------------------------------------KYENSQNNLPQIMAKHQNEVK
KLPA_EMENI      -----------------------ELMSRQRAECESVRYESQKSLDALKAQHESELKELRRQ---FERELE
K1C10_RAT       ---------------LASYMNKVRDLEESNYELEGKIKEWYEKHGNSSQREPRDYSKYYKTIEDLKGQIV
HOOK_BRAFL      ------AGKNEELMALAAETQLLKDEMDILRQSAEKTSKYEQTIETYKKKLED-LADLRRTVEQLQEETY
GAS8_RAT        -----------------ANEVVIKNLRKQAEEITKMRNDFERQVREIEAKYDKKMKMLRDEL-DLRRK-T
EZRA_BACLD      -------------------EKRLEMIEKQ--------------FEQVRERLDQKYSLLKEELADIEKQME
EFG_YERPY       LKSRLGANPVPLQLAIGAEEKFTGIIDLVKMKAI----NWNEADQGVTFEYEEIPADMAELAAEWHQNLV
EFG_YERPS       LKSRLGANPVPLQLAIGAEEKFTGIIDLVKMKAI----NWNEADQGVTFEYEEIPADMAELAAEWHQNLV
EFG_YERPP       LKSRLGANPVPLQLAIGAEEKFTGIIDLVKMKAI----NWNEADQGVTFEYEEIPADMAELAAEWHQNLV
EFG_YERPN       LKSRLGANPVPLQLAIGAEEKFTGIIDLVKMKAI----NWNEADQGVTFEYEEIPADMAELAAEWHQNLV
EFG_YERPG       LKSRLGANPVPLQLAIGAEEKFTGIIDLVKMKAI----NWNEADQGVTFEYEEIPADMAELAAEWHQNLV
EFG_YERPE       LKSRLGANPVPLQLAIGAEEKFTGIIDLVKMKAI----NWNEADQGVTFEYEEIPADMAELAAEWHQNLV
EFG_YERPB       LKSRLGANPVPLQLAIGAEEKFTGIIDLVKMKAI----NWNEADQGVTFEYEEIPADMAELAAEWHQNLV
EFG_YERPA       LKSRLGANPVPLQLAIGAEEKFTGIIDLVKMKAI----NWNEADQGVTFEYEEIPADMAELAAEWHQNLV
EFG_YERP3       LKSRLGANPVPLQLAIGAEEKFTGIIDLVKMKAI----NWNEADQGVTFEYEEIPADMAELAAEWHQNLV
DEFI6_XENLA     ------------------AQSKLLMQEEEKLRVLEEQTQYVERAQKEKQELQQEMAVTSKELQEAQKQLE
CWLO_BACSU      ----------------------------------------DKDLIKQQEQDKAKLEDSEADLNDKLKEVQ
CP135_DANRE     ------------------------------------DREIQEHLNAL-QAYEAQVSSLARAMSRLEEEVQ
CK5P2_HUMAN     QQL------IQEVRCSGQELSRVQEEVKLRQQLLSQNDKLLQSLRVELKAYEKLDEEHRRPFRDLHSLLM
CCD93_XENTR     EEGRLTASTVGQIVGLQSKEIK-QMVSEYAEKQSELSAEDRAEYLGAAQQHRRKVASLSKLIGQ------
ATPF_DESDG      ---------------------------------------------------ETRKTDAKKQLGDVEKRIA
YDEM_CAEEL      ----------------------------ETGELARVKEEMAELYRS-KCQNDQRLIDANHRIADFEKKSS
YBAC_SCHPO      -------------------------LRQQNASLVEENKQWERRARDEHEMQE----SLAVRLADCEEQLA
Y4862_ARATH     --------------ALAKAQMEIKEERESVACLLKRIEMLDL-FENQNIQMQKEVERFKEMVEESSRFQT
Y147_TNAVC      -------------------------IEYRDGNIASLEKERDD----LKQKYNNEKRNSRNAVAKLKINMK
VIM1_XENLA      ----------------------------EKAEMIELNDRFANFIRFLEQQNKILVAELEQLKGKGTSRIG
UACA_BOVIN      ---NQTLQKEIEKVCLDN-----KLLTQQVNNL---TTEMKNHYEEMKKSHDVIVDDLNKKLSDVTHKYT
TMF1_MOUSE      ESSSISSLKDEFTQRIAEAEKKVQLACKER----------DAAKKEMKTIKEELATRLNSQTADLLKEKD
TAXB1_BOVIN     KENMITHFK-EEISRLSLAEKE----NLQRTFLLTTSSKEDTFIKEQLRKAEEQIQATRQEAVFLAKELS
ROCK1_RABIT     ---------------------------QERNRILENSKQTDKDYYQLQAVLEAERRDRSEMIGDLQARIT
RBCC1_MOUSE     ------------------------LLEQETENLRTEISKLNQKIHDNNESYQVGLSELRALMTIEKDQIS
NFM_MOUSE       --------------------EKVHYLEQQNKEIIQALRQKQASHAQLGDAYDQEIRELRATLAQVQLDSD
NFM_BOVIN       --------------------EKVHYLEQQNKEIIQALRQKQASHAQLGDAYDQEIRELRATLAQVQLDSD
NDE1B_XENLA     --------------------------EGRNRDIFSENNRLRMELDSIKEKYEEQHSENYIQISTLEGDLS
NDC80_ASHGO     -KANITLTDSTAITPSTILEGCTDILSSIKPNLLKVNKEIDERISALQTENNQLEKELRHMLESMENELS
MYSP_ANISI      --------------------------------------QWKSKFDAEVALHHEEVEDLRKKMM-------
MYSA_DROME      ------------------------------------------------QDYQERNAKLTAQKNDLENQLR
MYH2_CANFA      --------KIAEQELLDASER-VQLLHTQNTSLINTKKKLETDISQIQGEMEDIIQXXXXXXXXXXXXIT
MYH11_MOUSE     --------------AMSDRVRKATLQAEQLSNELATERSTAQKNESARQQLERQNKELRSKLAKLKSTVA
MIP1_ARATH      EWAQKNAMQAAQKVSEELAELKTLSSEREGIQLLKKGKQAVEE--STAKRFTDKEIELRKACSQLENQNA
MAD1_DEBHA      ----------------------ISNLQFQISSLKTEKSLLQQNKESMAEKYEALLITKNEEVVSLQNDFD
K2C7_RAT        ---------------------KVRFLEQQ-NKMLETKWALLQEQKSAKSSFEAQIAGLRQQLETLQLDGG
K2C7_MOUSE      ---------------------KVRFLEQQ-NKMLETKWALLQEQKSAKSSFEAQIAGLRQQLETLQLDGG
K1C20_MOUSE     --------------------EKVRSLEQSNSRLEAQIKQWETNAPSTIRDYSSYYAQIK----ELQNQVK
HOOK_DROMO      -------------------KKHVKMLEERSADYVQQNAQFEEDAKRYANTKGQ-IELFKKEIQDLHTKL-
HAUS3_MOUSE     -----------ELVLNELIKQKASFELVQLSYEIELRKHWDTYLESLVQQLSQRNTVLCQHLAVL----S
GG8L1_HUMAN     ----------------------------------------------------------------------
FBF1_CHICK      RDMEEERSRLQEVIAKMEAREQTRLLEQERSKVESLQRSLEEQRRLMTQQLSMERAELRAKSALLEEQKS
EDE1_YEAST      ELKRVTEMKNSIQIKLNTHDQNVKQTEQLEAQVLQVNKENEQQLAVSEANYHAAESKLNELTTDLQEQIT
CTRO_HUMAN      ---------------INAMDSKIRSLEQRIVELSEANKLAANSSRNMKAQ-EEMISELRQQKFYLETQAG
CNPD_PELPD      FAGSRVNKKDSGLIVKQSEELAAKMIDDARREAETITKEADLKARAAKAGHDREITEKKKDLQILEKRL-
CNPD_NITSB      ----------------------------------------------LKRDFEKKLEELKRDYEERFNELM
CNPD_CHLTE      ---------------LEAEERAVQVIQEAQKEVNEVNQEW----KKRKREFDSEVTIKNNKFAQLQKQIR
CING_MOUSE      QREALRRSKAELEEQKRLLNRTVDRLNKELEQIGDDSKLALQQLQAQMEDYKEKA---RKEVADAQRQAK
CI117_MOUSE     KDASGT--KTPELAMVEELKEFYKQIQDLEDRLARYQRKWDQEFEQLANNKKEIVAFLKRTLNQKVDEIT
CI117_HUMAN     --------------------------------------------KEMKEFYHIQIRDLEDRLARYQRKWD
CASP_MOUSE      -------------VTIKALKEKIREYEQSQAETIALEKEQERKLQETQMSTTSKLEEAEHKLQTLQTALE
CAO1B_XENLA     --------------------------------------QWWQEKTALNHSMEAKRDQIVNLKAEKLSLEN
BRE1_DEBHA      -------------------------------ELAAHNKQLNESVNNL-----QKINDTTNKLNELENKQT
BICD2_MOUSE     -----------------------------------------QESASKEQYYVRKVLELQTELKQLRNVLT
BICD2_HUMAN     -----------------------------------------QESASKEQYYVRKVLELQTELKQLRNVLT
AV71_ACAVI      -EEEVTRIKKDNLYLVNELNKARSDLDQETLNRIDFQNQLQEEIDFMRRVHDQEITELQAMAAELSSAIR
APOA1_CHICK     -----------------------KDLEEVKEKIRPFLDQFSAKWTEELEQYRQRLTPVAQELKELTKQKV
ANR24_MOUSE     ------------------AYEEIVRLRQERGRLLQKIRGLEQHKRRRKEPLEAEASSVHS----LERQVQ
A16L1_MOUSE     -----------------------------------------QEMAQLRIKHQEELTELHKKRGELAQLVI
YIBP_ECOLI      QRASLLAQLKKQEEAISEATRK---LRETQNTLNQLNKQIDEMNASIAKLEQQKAAQERSLAAQLQLILS
YF82_SCHPO      -----------------------------------------EFMENLEHRYEMTVSEVRR----LSHEVN
TNNT2_BOVIN     ----------------------------------------------------------------IQKAQT
TG278_CAEEL     --------------------------EREKEQALELRKEHQKEIQVLEQRFDTQLLNLEQKIQRLEEERK
STX4_RAT        -------------------ESKVRELEKQQVTILATPLPEE----SMKQGLQNLREEIKQLGREVRAQLK
STX4_MOUSE      -------------------ESKVRELEKQQVTILATPLPEE----SMKQGLQNLREEIKQLGREVRAQLK
SPTA2_HUMAN     --------------------------ETIRTRLMELHRQWELLLEKMREKQAQKLVQYLRECEDVMDWIN
SMC4_XENLA      ----------------GEKLNRVKMVEKEK-DALEGEKNKAIEFLTVENETFKKKNQLCQYIHDLQKRSR
ROCK1_RAT       --------------------KSVSQLESLNRELQERNRMLENSKSQADKDYYQLQAVLEEMIGDLQARIT
RIMB1_RAT       ----------PQVV-LGEPEKQLRV-QQLESELCKKRKKCE----SLEQEARKK-----------QRRCE
OPTN_HUMAN      ----------------------------------------------MKKRLQEKCQALERKNSAIPSELN
NFM_RAT         --------------------EKVHYLEQQNKEIIHALRQKQASHAQLGDAYDQEIRELRATLAQVQLDSD
MYOJ_DICDI      ---------------------------------------------------KEKITTLKSTIEELNKSIG
MYH4_PIG        -----------------------------------------------------KCASLEKTKQRLQNEVE
MYH2_BOVIN      -----------------------------------------------------KCASLEKTKQRLQNEVE
MYH1_HUMAN      ------------------------------AEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEKQIQ
MYH11_RAT       --------------AMSDRVRKATLQAEQLSNELVTERSAAQKNESARQQLERQNKELRSKLQEVEGAV-
MYH11_HUMAN     --------------AMSDRVRKATQQAEQLSNELATERSTAQKNESARQQLERQNKELRSKLAALEAKIA
MTUS1_PONAB     ---------------LVTASTTCEKLEEARNELQTAYEAFVQQHQAEKTERENRLKEFYEKLRD--TYIE
MCP3_SCHPO      --------------------------------------------------YEEKLSIAQNSINEIQTQNR
LEKR1_HUMAN     ------------------------LLNQTREEVLTLKNERELMLISHQKSIEQLQETLRQKLLSKEKIEA
LAML1_XENLA     ---------------------RIDSLTSQLSELQKESRAWHDRMQELEDMLAKEKDNSRKMLAEREREMA
KINH_HUMAN      ---------------LRVEHEKLKATDQEKSELTVMQDRREQARQDLKGLEETVAKEL-QTLHNLRKLFV
KI21B_MOUSE     -----------------------------KQKLIDELENSQRRLQTLKHQYEEK-------LILLQNKIR
KI21B_HUMAN     -----------------------------KQKLIDELENSQRRLQTLKHQYEEK-------LILLQNKIR
KI15A_XENLA     ----------------------------EHETLLEEKRSLQDAFDNLEEVMKFEIDQLKQEISDSKHENE
K1C10_HUMAN     ---------------------KVRALEESNYELEGKIKEWYEKHGNSHQGEPRDYSKYYKTIDDLKNQIL
ESIP1_RAT       QRST---GTYTLIAPNETRRQKIQRIAEQELADLERWKQQNKHLVPQRLGGSQSEAEVRQK-----QQLQ
CUX1_HUMAN      -------------VTIKALKEKIREYEQNQAETIALEKEQERKLQETQMSTTSKLEEAEHKVQSLQTALE
CTTB2_FELCA     ---------------LAAAESRQKKLEMEKLQLQAVEQE-HQKLAARLEEERGKNKHVVLMLVKECKQLS
CNPD_STAS1      ---------------------------------------------------EQSEIELRERRGDLQKQ--
CLPB_CHRVO      -----------------AMDKLDRRLIQLKIEREAVNKESDEASQKRLKLIEDEIAELSREYADLEE---
CLIP2_MOUSE     -------------------------LQEVQEELAGLQQHWREQLEEQASQHRLELQEAQDQCRDAQLRAQ
CK5P2_PANTR     QQL------IQEVRCSGQELSRVQEEVKLRQQLLSQNDKLLQSLRVELKAYEKLDEEHRRPFRDLHSLLM
CIP2A_HUMAN     -----------------STEKKNKDLQITCDSLNKQIETVKKLNESLKEQNEKSIAQLIEK-EEQRKEVQ
CCD57_MOUSE     -------------------ELKIKLLNKELQALRDAGARAAESL----QKAEAEHVELERKLQERARELQ
CB039_HUMAN     ----------------GLLEDKNKLISELQQELKTKD---DQYVKDLKKQSDD-ICLLLERMEEQVKNVM
CASP_PONAB      -------------VTIKALKEKIREYEQNQAETIALEKEQERKLQETQMSTTSKLEEAEHKVQSLQTALE
CASP_HUMAN      -------------VTIKALKEKIREYEQNQAETIALEKEQERKLQETQMSTTSKLEEAEHKVQSLQTALE
CACO1_MOUSE     ---------VPKATVL---QNQLDESQQERNDLMQLKLQLEDQLRSRVQELEAALATARQEHSELTEQYK
ATK1_ARATH      -----------------------------------------------KMAAKQKVTSLEDMYKRLQEYNT
ATG11_ASPFU     ------------------ADERINQLETELQNL-HIHTEEELHRANLEQMQAQKMTELQQRINELEKQQS
AP1_ARATH       ----------------------------------DVNTNWSMEYNRLKAKIELLERNQRHYLGE------


                         .         .         .         .         *         .         .:420
query           DLEAEREQKQRDFDRKLLLAKSKIEMEETDKEQLTAEAKELRQKVKYLQDQLSPLTRQREYQEKEIQRLN
TNIP1_HUMAN     DLEAEREQKQRDFDRKLLLAKSKIEMEETDKEQLTAEAKELRQKVKYLQDQLSPLTRQREYQEKEIQRLN
TNIP1_MOUSE     ELEAEREQKQRDFDRKLLLAKSKIEMEETDKEQLTAEAKELRQKVRYLQDQLSPLTRQREYQEKEIQRLN
TNIP3_HUMAN     TREKD---------------------------------------------------KEKEHYECEIKRLN
CEP55_RAT       KTESEQEEKQK-YDHLLENAKKDLEVERQTVTQLRLELDEFRRKYEETQKEVEDLNQLLSSQRKDIQHLE
CEP55_MOUSE     KIESEGQVEKQKYDHLLENAKKDLEVERQAVTQLRLELDEFRRKYEEARKEVEDLNQLLSSQRKDIQHLE
TPR_HUMAN       QEEQLRQQKEEKTRKAIVAAKSKIAHLAGVKDQLTKENEELKQRNGALDQQKDEL---------------
HMW2_MYCPN      ELEAEQDTDKKELEKALHSVKSK-------QELLERERSFLLQKQREFAEHVAGFKRQVHFKTTQMQRLS
CEP55_HUMAN     KPESEQEEKQKCYNDLLASAKKDLEVERQTITQLSFELSEFRRKYEETQKEVHNLNQLLYSQRRDVQHLE
MPP9_MOUSE      DISAVEEWKKKNLDSALNEATSRVRTLEKNNNLLEIEVSDLRERFKVLQERIEEMRTSNKEKDNTITRLK
HMMR_RAT        DLQNQLRQQNEDFRKQLEEEGAKMTEKETAVTELTMEINKWRLLYEELYDKTKPFQQQLDAFEAEKQAL-
IMH1_YEAST      HLKTEKEKEQTTSQNKVAKLNEEISQLTYEKSNITKELTSLRKTVSYLEEQVKQFSEQKDVAEKSTEQLR
CCD46_HUMAN     SLKEENSQQQLAAERRLQDVRQKFEDE---KKQL---IRDNDQAIKVLQDELENRSNQVRCAEKKLQ--H
CCD46_MOUSE     SLKEESSRQQLAAERRL---QDVIQKFEDEKQQL---IRDNDQAIKALQDELETRSHQVRSAEKKLH--H
CCD41_HUMAN     EHDVWRQSEKDQYEEKL---RASQMAEEITRKELQSVRLKLQQQIVTI-----------ENAEKEKNENS
CC150_HUMAN     EVKSILERSKEELSRTVKCRNAALKESQKLKEDLEAVEDRENKKVGNFQRQLA---EAKEDNCKVTIMLE
TNIP2_MOUSE     HLAKERQCAQGDAGEK-----SPAELEQTSSDKLQEENRLLKQKVTHVEDLNAKWQREPELMKKEISRLN
MOEH_ANOGA      QVQAAKEELEQ---RQNELHEMMQRLEETKNMEATERAK-LEEEIRVKQLEMQKIQEEVTLKDSETKRLH
CLIP1_HUMAN     HLEIEKNA------------------ESSKASSITRELQGRELKLTNLQENLSEVSQVKETLEKELQILK
SPTB2_MOUSE     AIEAKLSDLQKEAE--------KLESEHPDQAQAILSRLA---EISDVWEEMKTTLKNREASLGEASKLQ
SPTB2_HUMAN     AIEAKLSDLQKEAE--------KLESEHPDQAQAILSRLA---EISDVWEEMKTTLKNREASLGEASKLQ
SMC3_RAT        DAQQDARDKMEDIERQVRELKTKISAMKEEKEQLSAERQELELKAKDLQDELA-----------------
SMC3_PONAB      DAQQDARDKMEDIERQVRELKTKISAMKEEKEQLSAERQELELKAKDLQDELA-----------------
SMC3_MOUSE      DAQQDARDKMEDIERQVRELKTKISAMKEEKEQLSAERQELELKAKDLQDELA-----------------
SMC3_HUMAN      DAQQDARDKMEDIERQVRELKTKISAMKEEKEQLSAERQELELKAKDLQDELA-----------------
SMC3_BOVIN      DAQQDARDKMEDIERQVRELKTKISAMKEEKEQLSAERQELELKAKDLQDELA-----------------
SYCP3_MOUSE     FQQSRIVQSQRMFAMKQIFIKSLEDVEKNNDNLFTGTQSELKKEMAMLQKKV-----MMETQQQEMANVR
RUD3_YEAST      DLRTERDELRQALEEKAVLKNSELKIEEVDNKR-EEEARERDQEVKSLRSQLDTEIETHNNDTEALESMK
MYSP_DERFA      EVTMLMEQAQKELRVKIALQKLQHEYEKLQRDQLARENKKLTDDLAEAKSQLNDAHRRIHEQEIEIKRLE
IFE_BRALA       QLEIERQEQAEDYDEAGLRSELEAEIERLKKEAATMARLDLENKLSTAQEEIDFLKR---VHDEEIRQLQ
FKB15_HUMAN     SLEQERSQAEEEIDERQLLKKTRVSTDQAAAEQLSLVQAELQAKDEHLQQYQEVCAQRDAYQQKLVQLQE
CTRO_MOUSE      HLEVHLKQKEQHYEEKIKVLDNQIKKDLADKESLQRHEEEAHEKGKILSEQKAMINRSLEQRIVELSEAN
CE290_DANRE     NLEAQRIERESDADRKRI-----TELEKTE-ANLRIEVSKLREVSDVAKMQVSALDARQQSREKEVESLR
GOGA3_MOUSE     SAQKEMKTKHKAYENAVSILSRRLQEALASKEATDAELNQLREKIRALEVELQNVGQSKILLEKELQEVS
EZRI_RABIT      QLEDERKRAQEESERAALRAKEELERQAADQEQLAAELAEYTAKIALLEE-------ARRRKESEVEEWQ
DMD_PIG         SLEPQDEKKIKEIDRELQKKKEELDAVRRQAEGLSEDGAAM--AVEPTQIQLSKRWREIESKFAHFRRLN
DMD_HUMAN       SLEPRDERKIKEIDRELQKKKEELNAVRRQAEGLSEDGAAM--AVEPTQIQLSKRWREIESKFAQFRRLN
CP250_HUMAN     ELEKDRETQRNVLEHQLLELEKKDQMIESQRGQLALELEENHHKMECQQKLIKELEGQRETQRVALTHLT
DIAP1_MOUSE     ELQVEMKKMENDFEQKLQDLQGEKDALDSEKQQITAQKQDLEAEVSKLTGEVAKLSKELEDAKNEM----
TNIP2_HUMAN     KCLDERQHAQRNVGER-----SPDQSEHTDGEKLQEENRLLKQKVTHVEDQLRGLQHEPELMRKEISRLN
KIF15_RAT       KLNEDREVK----NAEILRMKDQL----CEMENLRLESQQLRERTWLLQTQLDDMKRQNEYEEEIIERLN
MYH9_CHICK      ELKIQLSKKEEE----LQAALARVEEEAAQKNMALKKIRELESQITELQEDLESERASRNKAEKQKRDLG
USO1_YEAST      -INAEEKSKLEDIERELKDKQAEIKSNQEEKELLTSRLKELEQELDSTQQKAQKSEEERRAEVRKFQVEK
SPO15_SCHPO     DAESKLEQENKSLKGSIDEYQNNLSSKDKMVKQVSSQLEEARSSLAHATGKLAEINSERDFQNKKIKDFE
M12_STRPY       DLEAVRKSKKQQVEAALKQLEEQNKISEASRKGLRRDLDTSREAKKQVEKDLANLTAELDKEEKQIKQVE
CROCC_MOUSE     AISLEMERQKRD-------AQSRQEQDRNTLNALTSELRDLRQTVKELEERTGNLGRQREACMREAEELR
CLIP1_CHICK     EMITKHDADIKGFKQNLLDAEEALKAAQKKNDELETQAEELKKQAE------------------------
QN1_RAT         ELGGIKEAHQRKLEAEIDVLKAHLEHKKNDKEEFQVEQAQARAKLARLNEELAAKGREIQDLTKTVERLQ
GOGB1_HUMAN     KTKAFQIMQEELRQENL---SWQHELHQLRMEKSSWEIHERRMKEQYLM-AISDKDQQLSHLQNLIRELR
DMD_CANFA       SLEPRDERKIKEIDRELQKKKEELNAVRRQAEGLSEDGAAM--AVEPTQIQLSKRWREIESKFAQFRRLN
CING_SORAR      EWASEAEKSSGGLSRTLQASQADLDTARLDKELLAQRLQGLEQEAEKKRRSQDDRTRQVKSLEEKVSRLE
CE164_HUMAN     DLELDLETRAKDVKARLALLEVQEETARREKQQLL----DVQRQVALKSEEATATHQQLEEAQKEHTHLN
SGM1_SCHPO      ELTVESMEVVRTLSTQYSIQRSQWVREDEKKKKEIQDLKELYEKSEHFQNQVSQMSKQLDSLEKLCERKD
NF70_LOLPE      ELIDQLERQQKDLEESR-------TYHQIDQEQIARQNQQLAD----LEGEISMLRRSIESLEKEKMRQS
NF60_LOLPE      ELIDQLERQQKDLEESR-------TYHQIDQEQIARQNQQLAD----LEGEISMLRRSIESLEKEKMRQS
MYO3_CAEBR      DLTRQKEQELSDTKKHVQDLELTLRKAEQEKQSRDHQIRSLQDEMANQDESVAKLNKEKKHQEESNRKLN
MYO2_SCHPO      YLEADVKQ----------LPKLKKELESNDKDQLATKNKELEAKVKECLNNIKSLTKELENKEEKCQNLS
MYH8_MOUSE      DAAMMAEELKKEQDTSAHLERMKKNMEQTDLQHRLDEAEQLKKQIQKLEARVRELEGEVENEQKRNAEAV
GOGA5_RAT       KQRASKQELETELDR----MKQEFHYVEEDKNTLQSRIKDREEEIQKLRNQLTNKTLSNSSQSELESRLH
GOGA5_HUMAN     SLK-----EGSGFEGLDSSTASSMELEE-----LRHEKEMQREEIQKLMGQIHQL--RSELQDMEAQQVN
GOGA4_HUMAN     TIEKTSEEERISLQQELSRVKQEVVMKKSSEEQIAKHEKELARKEQELTKKLQ--TREREFQEQMKVALE
FIL1L_HUMAN     ELE-ETNRSLRKAEEELQDIKEKISKGEYGNAGIMAEVEELRKRVLDMEGKDEELIK----MEEQCRDLN
TPM2_SCHMA      DKETAQTQ----------LAETNTKLEETDKRATEAEAESLQKRIRQLEDELESTETRLQEATVKLEEAS
SYCP3_RAT       FQQTRIVQSQRMKAIKQLFIKSLEDVEKNNDNLFTGTQSELKKEMAMLQKKV-----MMETQQQEMANVR
SMC4_DICDI      SVIEEETKKQAEFERSTIIHKQDIVRFEKEPKELIVEEKKLESMLNSLKGEVTELQREMEEKQKQLLPWS
SAS6_DANRE      ALDSECHEKERLLNQ-LQTRVAVLEQEIKDKDQLVLRTKEVLEATQQQKNSVEGNAESKQLQISKLESTV
MLP1_YEAST      SVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLDSLRKELEKSKINLTDAYSQIKEYKDLYEQSLQQTN
HMMR_MOUSE      DLKNQLRQQDEDFRKQLEEKGKRTAEKENVMTELTMEINKWRLLYEELYEKTKPFQQQLDAFEAEKQAL-
CNPD_PELLD      DVR-DTERKLQDQQKELDQAMETVGIRATELERIITEQNQRLESISNLQDEANMITKAREEATETIHKIH
PU92_SCICO      QLQEKLERRERDLQCQLDECKKKLNICNNELIACRKQQEELRCKIERLNTEIEKLRKQNAACEKDLNTLR
MYH8_HUMAN      DMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLKKQIQKLEARVRELEGEVENEQKRNAEAV
HMW2_MYCGA      DVESERADLQRERQQELLQYERDIKRQQTDFENVNWEQKKLSQREKELKDGYEQLQKQSEVQEKEINRAQ
GCOM1_XENTR     RMEQEREHLQDQLIRRIQDLDNRMQMQSPDRNQRLEEATSLRERIKHLDDMVHCQQKKVKHMIEEIELLK
CEP63_CHICK     DLVREYEQQLKKFQEE--LARLRRSYEKLQKKQLREAREEATKRQGDDQCEMSRLSRKEEFRQKSLDWEK
CC150_MOUSE     QLEAQETMLQKDHLHKLTQANSELSASKAYLEQTEAHLKEMKSILGKNEEELAQAVKCRDAALKESQKLK
BPA1_HUMAN      QRKSDHLKEQFEKSHEQLLQNIKAEKENNDKQRLNEELEKSNECAEMLKQKVEELTRQNNETKLMMQRIQ
ALM1_SCHPO      DLLSEMEAIRKELENSKYLSTDRLTNANNDVEAFKKEAKELRSINQNLQDIIS----------RQDQRAS
SYCP3_MESAU     FQQSRIVQSQRLKAIKQLFIKNLEDVEKNNDNLFTGTQSELKKEMAMLQKKV-----MMETQQQEMANVR
MYH8_CANFA      DAAMMAEELKKEQDTSAHLERMKKNMEQTDLQHRLDEAEQLKKQIQKLEARVHELEGEVESEQKRNAEAV
MYH3_MOUSE      DMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLALKGGKKQIQLETRIRELEFELEGEQKRN
KIF7_HUMAN      ELEGKELQRLQEFRRRVAAAQSQVQVLKEKKQATERLVSLSAQSEKRLQE--------------------
KIF15_MOUSE     KLNEDREVKNAE----ILRMKDQL----CEMENLRLESQQLREKNWLLQRQLDDVKRQQESGDKERLAKN
DMD_MOUSE       SLEPRDERKLKEIDRELQKKKEELNAVRRQAEGLSENGAAM--AVEPTQIQLSKRWRQIESNFAQFRRLN
CUX2_HUMAN      RLEAALASKDREILRLLKLQSSLQELEEASANQIADLERQLTAKSEAIEKLEEKLQAQSDYEEIKTE---
CNPD_PROVI      QREGQQAQDNRDMERRL---QDQRKENEQVQESVTLRAAELERIISEQNERLESISGLQSEDARQMNMIS
APSB_EMENI      NLRALQAEMRS-------ASEGIIRLEE--------DAQNNLQRYKAVQQELEQCNEEMESLEKSLYEAN
SAS6_CHICK      TLDAECHEKEK-FINQLQTRVAVLEQEIKDKDQLVIRTKEV---LDATQEQKVILEENTEKKQSHIEKLE
NUF1_YEAST      KME--KELKEREFNYKI--SESKLEDEKTTLNELAAENSQLKNKI---EDNSTATHHMKENYEKQLESLR
MYO1_CAEEL      ELEATINRAKTAFSSQLVEAKKAAEDELHERQEFHAACKNLEHELDQCHELLEEQINGKDDIQRQLSRIN
MYH7_RAT        DAAMMAEELKKEQDTSAHLERMKNNMEQTDLQHRLDEAEQIEARVRELENELEAEQKRNAESVKGMRKSE
MYH7_PAPHA      DAAMMAEELKKEQDTSAHLERMKKNMEQTDLQHRLDEAEQIEARVRELENELEAEQKRNAESVKGMRKSE
MYH7_MOUSE      DAAMMAEELKKEQDTSAHLERMKKNMEQTDLQHRLDEAEQIEARVRELENELEAEQKRNAESVKGMRKSE
MYH7_MESAU      DAAMMAEELKKEQDTSAHLERMKKNMEQTDLQHRLDEAEQIEARVRELENELEAEQKRNAESVKGMRKSE
MYH7_HUMAN      DAAMMAEELKKEQDTSAHLERMKKNMEQTDLQHRLDEAEQIEARVRELENELEAEQKRNAESVKGMRKSE
MYH7_CANFA      DAAMMAEELKKEQDTSAHLERMKKNMEQTDLQHRLDEAEQIEARVRELENELEAEQKRNAESVKGMRKSE
MYH3_RAT        DMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLALKGGKKQIQLETRIRELEFELEGEQKRN
MYH3_HUMAN      DMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLALKGGKKQIQLETRIRELEFELEGEQKKN
MRCKB_HUMAN     DTVALRQERE-DSTQRLRGLEKQHRVVRQEKEELHKQLVEASERLKSQAKELKDAHQQRKLALQEFSELN
MRCKA_HUMAN     -VQASERLKNQSKELKDAHCQRKLAMQEEINERLTTQKQKLARHVRDKEEEVDLVMQKVESLRQELRRTE
MPP9_HUMAN      GVEDWKITNQGQLDSALHEATSRVRTLENKNNLLEIEVNDLRERFKILQERIEEMRTSSKEKDNTIIRLK
IMH1_ASHGO      ELETVRGM-LKTVGNELVHARDELKQEGTNEERLKSELQELRTQIATLKEQLQLLNDQKKALETDVEQHK
IFA1_CAEEL      DMEAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRAR
GRDN_MOUSE      ELESEKEQLRKGLE-LMRASFKKTERLEVSYQGLDTENQRLQKALENSNKKIQQLESELQDLEMENQTLQ
GOGA3_HUMAN     DLEGHLQSAQKERDEM----ETHLQSLQFDKEQMVAEANELKKQIEELQQEAKAITEQKQKMQKEMKTKH
GOGA1_HUMAN     ELLKEKEQNLEDTRQQLLAARSS---QAKAINTLETRVRELEQTLQASEEQLQQSKGIVAAQETQIQELA
FKB15_MOUSE     SLEKNLSERKKKSAQERCQAEA--EMDEIRKSH-QEELDRLRQLLK------------------------
CP250_MOUSE     ELENDREAQRSVLEHQLLDLEQKAQVIESQRGQLALELEESHHKVESQQKMITELEGQREMQRVALTHLT
CGNL1_HUMAN     VLASRSNTSEQD----QAGTEMRVKLLQEENEKLQGRSEELERRVAQLQRQIEDLAKAKETLKKEIRQLE
BRE1_ASPFU      MLNTELTSMQTACKKYSLLASQKVSALEEKVARLTAEKSKADQ--KYFAAMKSKEARELEVRTLRIQ---
UACA_CANFA      ELTSKNQVLQRDLDNKLLNQQVHNLTSEIKSHYVPLQVSEEMKKVEELKKQLLDVTQKCADKQLEMEKL-
SWP70_CHICK     ELQTANENKQKELERKQLXXQTQVELQDRFSLELERE-KMVRQKMEEQVAQKSSELEQYLQRVRELEEMY
SMC2_HUMAN      NAEAERERELKDAQKKLDCAKTKADAS-------SKKMKEKQQEVEAITLELEELKREHTSYKQQLEAVN
NEMO_DROME      ILRVENQELKRDLETKIIEGVHTIRLKEQDERKSVSEKQSLIDNMRVEIDKLKQLNHSFEFTESKSQELI
MRCKA_RAT       -VQASERLKNQSKELKDAHCQRKLAMQEEINERLTTQKQKLARHVRDKEEEVDLVMQKAESLRQELRRAE
BRE1_CRYNE      DMEAKAAQ--RSVEKQLRLLERAQEVETSLRSQITANEKALKNNALDLQNQLATVVAEKTQLELRLQQSQ
TAXB1_PONAB     DAVNVRDRTMADLHTARLVAELKLNAMKKDQDKTDTLEHELRREVEDLKLRLQMAADHYKEKFKECQRLQ
SMC1_YEAST      NLVKEKEALQNNIFKEF---TSKIGFTIKEYENHSGELMRVENKLQFETDRLSTTQRRYEKAQKDLENAQ
MYSS_CYPCA      KVEKEKENKVKNLTEEMASQDESIAKLTKEKKALQEAHQQTLDDLQAEEDKVNTLTKAKTKLEQQVDDLE
MYO3_CAEEL      DLARQKKKTDQELDTKKHVQDLELSLRKAEQEKQSRDIRSLQDEMANQDEAVAKLNKEKKHQEESNRKLN
MYH9_RAT        DLNLERSHAQKNLERQNKELKAKLEMESAVKSKYKASIAALEAKIAQLEEQLDNETKERQAASKQVRRAE
MYH9_MOUSE      DLNLERSHAQKNLERQNKELKAKLEMESAVKSKYKASIAALEAKIAQLEEQLDNETKERQAASKQVRRTE
MRCKB_MOUSE     DTVTLR-QEHEDSTHRLKGLEKQYRLARQEKEELHKQLVEASERLKSQTKELKDAHQQRKRALQEFSELN
GFAP_DANRE      RLEIERDNKQRLQDETALRAENNLNTFRQDVDEAALNRVQLERKIEALQDEINFLKKVHEEEMREL----
GFAP_CARAU      RLEIERDNKQRLQEENALRAENNLNTFRQDVDEAALNRVQLERKIDALQDEISFLRKVHEEEMRQLQ---
EFG_ACIAC       EAAAEASEE--------LMNK---YLEEGD---LSEEEIKLGLRTRTIATEIQPMLCGTAFKNKGVQRML
EEA1_HUMAN      DLKTELLQRPGIEDVAVL--KKELVQVQTLMDNMTLERERESEKLK---DECKKLQSQYASSEATISQLR
DAPLE_XENLA     DTEKENKDLQRTLEEMKICNKRLERMEEENKAK-EQEMVQLEKDNKILQKESKRLWQQVELKDADLEKEN
CE290_HUMAN     NLDAQKEQMLRDADRQRILELEKNEME------LKVEVSKLREISDIARRQVEILNAQQQSRDKEVESLR
CACO1_BOVIN     ELTEERDILSRELEEDIQTISEKVLMKEVELDRVRDSVKALTREQEKLLGQLKEVQADKEQSEAELQRLN
ANT1_ONCVO      GLQDELNEKDRDTDR------LNAEIDDL-KRKLQTEIEKVRKETTTVQERYHEWDEERDNHQKKIDSMN
YNP9_CAEEL      SSRDTAEQKIKDIE----IAKEKVD------HLLQNERQRSENENGSLKSKLSSATKQIHSLEKELQELR
VIME_RAT        RVEVERDNLAED----IMRLREKLQEEMLQREEAESTLQSFRQDVDNASLARLDLERKVESLQEEIAFLK
VIME_MOUSE      RVEVERDNLAED----IMRLREKLQEEMLQREEAESTLQSFRQDVDNASLARLDLERKVESLQEEIAFLK
VIME_MESAU      RVEVERDNLAED----IMRLREKLQEEMLQREEAESTLQSFRQDVDNASLARLDLERKVESLQEEIAFLK
VIME_CRIGR      RVEVERDNLAED----IIRLREKLQEEMLQREEAESTLQSFRQDVDNASLARLDLERKVESLQEEIAFLK
VIME_BOVIN      RVEVERDNLAED----IMRLREKLQEEMLQREEAESTLQSFRQDVDNASLARLDLERKVESLQEEIAFLK
SPTCB_DROME     ETDSLEQRRLSGMDRDLAAIQAKLSSLEREEDEHPEEAKIIRERIAQIEEQLTQMLKERDSKLEEAGDLH
NIN_MOUSE       TIEQEKASIQTMVEKKKQVSDLKIKNQQLDSEELSQKNSQNKEELKTLNQRLAEMLCQRECTSEKWEQEN
MYSN_DROME      ---LELEKKQKNFDK--ILAEEKAISEQIAQERDTAEIEDLENKRKTLQNELDDLANTQGTADKNVHELE
MYSC_CHICK      -LQAEQDTLADAEERCDLLIKSKIQLE--------AKVKELTERVEDEEEMNSELTSKKRKLEDECSELK
MYO2_CAEEL      RIEKEKGHMQREFDESSAALDQEAKL-RADQERIAVRLLELRLKARQLQDENSDLARQVEELEAKIQAAN
MYH6_RAT        DAAMMAEELKKEQDTSAHLERMKKNMEQTDLQHRLDEAEQIEARVRELENELEAEQKRNAESVKGMRKSE
LIPA1_HUMAN     KSEEMNTKLQRDV-REAMAQKEDMEERITTLEKRYLAAQREATSVHDLNDKLENEIANKDSMHRQTEDKN
K1C9_HUMAN      DLTVGNNKTLLDIDNTRMTLRIKFEMEQNLRQGVDADINGLRQVLDNLTMEKSDLEMQYETLQEELMALK
HOOK3_MOUSE     KLDFEYKRLKEKVDG---LQKEKDRLR-TERDSLKETIEELRQEGQLTTQGLMPLGSQEEIREKRLQHEN
HOOK3_HUMAN     KL---------DFEYKRL--KEKVDSLQKEKDRLRTERDSLKETIEELRQGLMPLGSQEEIREKRLQHEN
HMW2_MYCGE      DFENELEAKQQEFEAKHALERSFIKLEDKEKD-LNTKAQQIANEFSQLKTDKSELMLQNEYEQQEKQKL-
HIP1_HUMAN      GLKAQLENMKTESQRVVLQLKGHVSELEAD----LAEQQHLRQQAEFLRAELDELRRQREDTEKAQRSLS
GRDN_HUMAN      DMEMER-----DMDRKKIXXAQKQSMDESELEQISRTSELSEAPQKSLGHEVNELTSSRLLKEMENQSLT
GPTC8_MOUSE     ELCDKQYQKHQEFDNHI------NSYDHAHKQRL----KDLKQR-EFARNVSSRSRKDEKKQEKALRRLH
GPTC8_HUMAN     ELCDKQYQKHQEFDNHI------NSYDHAHKQRL----KDLKQR-EFARNVSSRSRKDEKKQEKALRRLH
CP135_HUMAN     ELNLCQKEKERLSDELLVKSSKKVESFAVTERQLTLEVERMRLEHGIKRRDRSPIEEERDYYKKELERLQ
CNPD_CHLPD      QKEGQQSQDLRDMERKLQDQRKEIEQTMETVNLRSSELERITLEQNQRLESISNLQADEARQMLVDNMLA
CASC4_CHICK     RTEVAREKRNSDLLGRVDSHRKQLEQKEADYSQLSSQLQARDGQVKRCEDSRVKLQNNISYQMADIHRLK
WAP_ARATH       EKEGDKERLKEEIHRLGCLVKEKENLVQTAENNLATE----RKKIEVVSQQINDLQSQVERQETEIQDKI
TAXB1_HUMAN     DAVNVRDRTMADLHTARLVAELKLNAMKKDQDKTDTLEHELRREVEDLKLRLQMAADHYKEKFKECQRLQ
SYCP3_MACFA     IVQSQRLKTIRQLYEQFI--KSMEELEKNHDNLLTGAQNEFKKEMAMLQKKI-----MMETQQQEIASVR
ROCK2_MOUSE     ----ESTLRQLEREKALLQHKNAEYQRKADHE--ADKKRNLENDVNSLKDQLEDLKKRNQSSQEKVNQLQ
NDE1_CHICK      SLEDFEQRLNQAIERNAFLESELDEKENLSVQRLKDEARDLRQELAVQQKQEKPKTPMRTSLETE--RTD
MYH8_RAT        DAAMMAEELKKEQDTSAHLERMKKNMEQTDLQHRLDEAEQLALKGGKKQIQLEARVRELEGEVENEQKRN
MYH7_PIG        DAAMMAEELKKEQDTSAHLERMKKNMEQTDLQHRLDEAEQIEARVRELENELEAEQKRNAESVKGMRKSE
MYH7_BOVIN      DAAMMAEELKKEQDTSAHLERMKKNMEQTDLQHRLDEAEQIEARVRELENELEAEQKRNAESVKGMRKSE
MYH6_HUMAN      DAAMMAEELKKEQDTSAHLERMKKNMEQTDLQHRLDEAEQIEARVRELEGELEAEQKRNAESVKGMRKSE
MRCKA_MOUSE     -VQASERLKNQSKELKDAHCQRKLAMQEEINERLTTQKQKLARHVRDKEEEVDLVMQKAESLRQELRRAE
LIPB1_MOUSE     AVEKDREDRFRDTEGLIQINDLRLKVNEMDGERLQYE-----KKLKSTKDELASLKEQLEEKECEVKRLQ
KINH_DROME      EM--------KDVHQKLLLA----------HQQMTADYEKVRQEDAEKSSELQNINERREQARKDLKGLE
K1C9_RAT        QLQHSVQELNIELQTQLTTKSALEKALEDTKNRYCGQLQQIREQISEMEAQLAQVRAETECQEKEIETYR
GRIP_ARATH      DLDAQHSSMQQELERTRQQANEALKAMDAERQQLRSANNKLRDTIEELRGSLQPKENKIETLQQSLLDKD
GOGA1_MOUSE     ----EQNLSGEDHVQELLKEKTVAELEDTRQQLLAARVKDLERSLQAAEEQLSQSRNVVADQEAQIQKL-
FIL1L_MOUSE     ELE-ETNRSLRKAEEELQDIKDKINKGEYGNSGIMDEVDELRKRVLDMEGKDEELIK----MEEQCRDLN
EVI5L_HUMAN     TWQAHRGGRWKESPRKLVVGELQDELMSVREAQALAEGRELRQRVVELETQLNRVEAERAALQEKLQYLN
DESP_HUMAN      EYENELSKVRNNYDEEIISLKNQFETEKTTIHQLTMQKEE---DTSGYRAQIDNLTRENRSLSEEIKRLK
CD158_HUMAN     KLKMQLKSAQSELEQTRNTLKS---MEGSDQKQITAKRGQLQSKIQFLEEAMTNANKEKHFLKEEKSKLS
CCHCR_MOUSE     SLETKRAQKEADMLRNQL-SKTQEELEEFPSQEWELERKELLDTLKHLKEDRADLQATVELLQVRVQSLT
CCD41_RAT       EHDVWRQSEKDQCEEKLKLQQQIVNTEKAEKEKL--ENSELKQQISHLQIQVTSLTQ----SENDLLNSN
YOND_BACSU      QLKPYKEKHE-----KTLLEQKLSEKNEFYKAKFEALNAEEKFSTEEVQNLIHASVKQDEEGEKAVLQLN
VIME_ONCMY      HVEVDRDNMGEDIER----LREKLQDEMIQKEEAEHNLQSFRQDVDNASLARLDLERKVESLQEEIIFLR
SMC_BACSU       QLRAQVKEKQQALSLHNENVEEKIEQLKSDYFELLNSQASIRNELQLLDDQMSTLQRLADNNEKHLQ---
SMC2_XENLA      YLEYQKIMREIEHLSRLYVAYQFVCAEET-KVRSAEELKEMQDSILKLQDTMAENERKVKELGKEIAELE
SKI_XENLA       DKGCEAGRIRVKYSAQIEELQSKLQHAENDREQLRTEARELEKVVKDLQEQLWSKTSSSEHTRKDIE---
SBCC_BACSU      ELETVTDRLTRGQNRQTELKQQLKSLQVTDERKSCQQAAEMALRIRQTEEQIKKEKKRSEELNLVLQKMN
RB6I2_HUMAN     GLQAEIGQVKQELSRK----DTELLALQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALR
PLST_CARAU      QMQVERDQRLNEEMGKRQEAENNLTLFRKDVDDATLARLELERKIESLMDEIEFLKK-------------
OPTN_CHICK      TLEKVNSAAATELEEKQQLIKLELQVESVQAEVKLEQAKTQDEKTRYLQDAYNKLLAESEMKVKEHDRVD
MYSP_MYTGA      ALEADIAAMQSDLDDALNGQRAAEERADRLQAEVNRLADELRQE----QDNYKNAESLRKQLEIEIREIT
MYSP_CAEEL      RLQSEVEVLIVDLEK----AQNTIALLERAREQLERQVGELKVRIDEITVELEAAQRELRAVNAELQKMK
MYH6_MOUSE      DAAMMAEELKKEQDTSAHLERMKKNMEQTDLQHRLDEAEQIEARVRELENELEAEQKRNAESVKGMRKSE
MY18A_MOUSE     SRDEEVEEARQSCQKKLKQMEVQLEEEYEDKQKALREKRELESKLSTLSDQVN----QRDFESE--KRLR
MRCKB_RAT       DTVTLR-QEHEDSTQRLKGLEKQYRLARQEKEELHKQLVEASERLKSQTKELKDAHQQRKRALQEFSELN
KINH_SYNRA      DLEAQYAEKKEVQQKEIDDLKRELDRKQSGHEKLSAAMTDLRAANDQLQAALSEQPFQAPQKEKDIERTR
EP15R_MOUSE     SLQELEAQKQD--------AQDRLDEMDQQKAKLRDMLSDVRQKCQDETQTISSLKTQIQSQESDLKSQE
EEA1_MOUSE      VIDLKTELLQRPGIEDVAVLKKELVQVQTLMDNMTLERERESEKLK---DECKKLQSEHAHLEATINQLR
CUT_CAEEL       ILEKNMESKNKDIQRKLEIAKQTVEQKDLENEQLSIAMKDLKHKIVFLEERVSQLENEAE----------
CGNL1_MOUSE     HLDKTIQKLQKEMTSSLELQKQLGEYKEKNRRELAEMQTQLKEKVEKARLAASKMQDELRLKEEELQDYQ
CCD41_MOUSE     ELRAEKENSQRIQVRQLAEMQATLRSLEAEKQSAKLQAERLEKELQSSNEQNTCLISKLHRADREISTLA
CCD18_HUMAN     NCEKENKRLQ----ERCGLYKSELEILKEKLRQLKEENNNGKEKLRIMAVKNSEVMAQLTESRQSILKLE
CC151_BOVIN     NLENRLE---------------KARMKAEEAEHITSVYLQLKA---YLQEESLHLGNRLDFMEAEVVRTK
CASP_CAEEL      ILEKNMESKNKDIQRKLEIAKQTVEQKDLENEQLSIAMKDLKHKIVFLEERVSQLENEAE----------
ATG11_PICST     ELKAINASHRQEADAKLLMKEEEFRLFKLDNKVDTKLVENLEKKV--------------EQRDAQVSKLK
Y1002_CHLCV     ERQYESQQLRSQNQKQLLHVRSVFMKTKADTQRMEGAIAHLREENQCLQLQLDALSQECREKEEEAQQLN
VIME_PANTR      RVEVERDNLAED----IMRLREKLQEEMLQREEAENTLQSFRQDVDNASLARLDLERKVESLQEEIAFLK
VIME_MACFA      RVEVERDNLTED----IMRLREKLQEEMLQREEAENTLQSFRQDVDNASLARLDLERKVESLQEEIAFLK
VIME_HUMAN      RVEVERDNLAED----IMRLREKLQEEMLQREEAENTLQSFRQDVDNASLARLDLERKVESLQEEIAFLK
VIME_CERAE      RVEVERDNLTED----IMRLREKLQEEMLQREEAENTLQSFRQDVDNASLARLDLERKVESLQEEIAFLK
SMC2_MOUSE      NAEAEREKELKDAQKKLDCAKTKADAS-------SKKMKEKQQEVEAITLELEELKREHASNEQQLDAVN
OPTN_MOUSE      ALERKNSATPSELNEKLVYSNKKLELQEIKMEQAKTEEEKSRLATKLLQEHNKALKTIEELTKQQAEKVD
OPTN_DANRE      DKQVQAENDCLKVQMESLQAAIKLEQKKTQDEK--NNLNQLKDAYTKLFEDYSELQEEKKKRESCVSK--
NDE1_HUMAN      EYEAELETQLQQIERDLLSENNRLRMEETIKEKFEVQHSEGYRQISALEDDLAQTKAIKDQLQKYIRELE
MYO5C_HUMAN     HLESIRHEVTRLTSENMMIPDFKQQISELEKQKQDLEIR-LNEQAEKMKGKLEELSNQLHRSQEEEGTQR
MYH9_HUMAN      DLNLERSHAQKNLERQNKELKVKLEMEGTVKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRTE
MYH9_CANFA      DLNLERSHAQKNLERQNKELKVKLEMEGTVKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRAE
MYH13_HUMAN     AC-ATLDKKQRNFDKKQKLDESQAELEAAQKESLSTELFKMRNAYEEVVDQLETLRRENKNLQEEISDLT
EP15R_HUMAN     DLDRETSSLQ-ELEAQKQDAQDRLDEMDQQKAKLRDMLSDVRQKCQDETQMISSLKTQIQSQESDLKSLN
DZIP1_DANRE     LVTSQMETQQKDYEKELIQRQEEFKRQEEEKMRMNSKIDEVKQACQRDMDSINQRNRNLETELLKLQQKN
DIAP1_HUMAN     ELQVEMKKMESDFEQKLQDLQGEKDALHSEKQQIATEKQDLEAEVSQLTGEVAKLTKELEDAKKEMASLS
CD158_MOUSE     EARTERDQFSQESGNXXXXXXXXXXXXHKREKELSLE----KEQNKRLWDRIDHLRRELDDRNMEVQRL-
SYCP3_HUMAN     IVQSQRLKTIKQLYEQFI--KSMEELEKNHDNLLTGAQNEFKKEMAMLQKKI-----MMETQQQEIASVR
MYS_AEQIR       RANAQMEKKQRAFDKTTAEWQAKVELENSQKESYSAELYRIKASIEEYQDSIGALRRENKNLADEIHDLT
MYH7_HORSE      DAAMMAEELKKEQDTSAHLERMKKNMEQTIKD--------------------------------------
MYH6_MESAU      DAAMMAEELKKEQDTSAHLERMKKNMEQTDLQHRLDEAEQIEARVRELENELEAEQKRNAESVKGMRKSE
MYH13_CANFA     DMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQL--ALKGGKKQIQKLEARVRELESELDAEQ
MY18A_HUMAN     SRDEEVEEARQSCQKKLKQMEVQLEEEYEDKQKVLREKRELEGKLATLSDQVNRRDFESEKRRKDLKRTK
MOES_LYTVA      EATLEREEKEEMRARVEALAEEKARLEQSREESL-KESAEFAEKLR------------------------
MLP2_YEAST      KLKKEKESLTRDFEQQMRLKESEISHNE-NKMDFSSKEGQYKAKIKELENNLERLRSDLQSKIQEIESIR
MFP1_ARATH      HELKESSVKNQSLQKELVEIYKKVETSNKELEEEKKTVLSLNKEVKGMEKQILMEREARKSLETDLEEAV
LRCC1_MOUSE     DLHKQADEKKDVHSQALITTKDAIFKERHCKAQLEIIVHRLQNEVKKLTIELMKARDQQEDHIRHLRTLE
KIF7_DANRE      ELEAVDRSKAQECRRKIAAAQSKVQVKQRDTAQLASLSAQSERRVQELE---------------------
GOGA4_MOUSE     EMETHKKHVCEELDAQXXKVRSLAQLQDSQLKNSTVEKEQARQS---LMEKENIILQMREEQAKEIEILK
FLIP1_HUMAN     SLMAEVEN----------LRKRVLEMEGKDEEKTESQCRELRKKLQEEEHHSKELRLEVEKLQKRMSELE
SGM1_YEAST      ELNDSSAQSVENYNEQLAEATNKLKDADKQKESLETLEKNIKEKITILQQSLDNMRTLLEKEKSEFQTEK
ROCK2_RAT       ----ESTLRQLEREKALLQHKNAEYQRKADHE--ADKKRNLENDVNSLKDQLEDLKKRNQSSQEKVNQLQ
NDE1_XENTR      QTKAVRDQLQK-YIRELEQANDDLEMSLEDFEQRLNQAIE---RNAFLESELD----EKENLLESVQRLK
MYSP_BRUMA      -------QKQAEYEEQIEIMLQKISQLEKAKSRLQSEVEVLIVDLEKAQNTIAILERAKEQLEKTVNELK
MYO1_YEAST      SFNDKLSSSEEDLDIKLVTLEKNCNIAMSRLQSLVTENSDLRSKNENFKKEKAALNNQLKNKESELLKMK
ITSN1_XENLA     QLKELREQKQQDFETEKIKQKSELDLKEEDKRRMLEQDKLWQDRVKQEEERYKFQDEEKEKREESVQKCE
GOGA5_MOUSE     SFEGLESS-----------TASSMELEELEKEMQKEEIQKLMGQMHQLRSELQDMEAQ------QVSEAE
GCC2_MOUSE      TSHEEMDDLHQKWEREQRLS---VELREA-AGQAAQHNSELRQRVSELTGKLDELVREKSQNDQSITVQM
GCC2_HUMAN      GLKEQCENLQQEKQEAILNYESLREIMEILQTELGESAGKISQEVHELQQKLRTAFTEKDALLETVNRLQ
ETP1_YEAST      DLKLQFQVTQKEWQKREMAQKSKLEEDSKKQEQLERENKALEESKQDLEEQVKDLMFYLDSQEKFKDADE
CTK2_XENLA      RLLNSKEKLQREVE-VLASENSKLSQERCTLE---SQLREVRQQVSTFEREVARLTELCQRQEKELSSHT
CC146_RAT       ELSRKQREKERDFRNELLL---KVSLDALSQAQALNQRLLLEMEAIPKEDLLLPEQRKELHKEVDLAKRN
SPDLY_MACFA     HLEKLEEQLSRSHGQEVNELKSKIEKLKVELDEARLSEKQLKHQVDHQKELLSCKSEELRVMSERVQESM
RRBP1_MOUSE     QLQASHKESEEALQKRLEEVTRELCRAQTSHANLRADAQEQQQRVAELHSKL------------------
RMUC_NEIMA      DLEESR-QTVRDVQNDLADVGNRFEKQIAHLQEKEAEAERLRQSHTELQEKAQGLAVENERLATQIEQER
OPTN_XENLA      LLDKRLQENQVDLEEKQSLRYS-IKKLELQVESQESEIKLEQNKTEAEKNQLGILQLNSEYQEREIEKVS
NUF2_EMENI      KLREERTEKQRDMERR------RIRIEQTEKKM--ADLKE------------------------------
MYSP_SARSC      ELELSLDAAN----------KANIDLQKTIKKQLQAHYDEVHRQLQQAVDQLGVTQRRCQALQAELEEQR
MYO4_CAEEL      SLEGEIQAIHADLDETLNEYKAAEERSKKAIADATRLAEELRQEQEHSQ-HVDRLRKGLEQQLKEIQ---
MOEH_CULQU      QLQAAKEQRQNELQVMITRLEETKNMEAAERAKLEDEIRMKQEEVHKIQEEVS-------VKDSETKRLQ
MAD1_YARLI      VAQILQEEKERELEAKHKKELDRAEQAESDQVFLFNKQKELSDENRTLKEELRSLQSQHEADGRELNHEL
KIF8_DICDI      DL----LKKMRD------ELKKRDDAKQTQAKELDALKREARK---------------------------
KIF4_XENLA      KLE-------RDFQKQANVLRRK-----------TEEAASANKRLK------EALQRQKEAMEKRKDSQS
K1C10_MOUSE     TLTTDNANVLLQIDNARLAARLKYENEVTLRQSVEADINGLRRVLDELTLSKSDLEMQIESLNEELAYLK
HOOK_AEDAE      KTEFEYNQLQ-----------AKLSAVQREKENLLSERDVLRETCDELEDSESGNTMSKELHSSDVRDRI
DCTN1_CHICK     XXXXXXXXXXXXXXREMADTADAIEMATLDKEMAEERAESLQQEVDSLKEKVEYLTMDLEYQVKQLEEQN
CENPE_MOUSE     QME--------QLKKKLEAQSSTLESREIEKLELTQQLNENLKKITLVTKENDSLKIMDEALREERDQLR
CD72_HUMAN      ELAQSQEALQVE-QRAHQAAEGQLQACQADKETLQSEEQQLEQKLSNMENRLKP----------------
CCD68_HUMAN     ELEVQRMEKEKRLERKLSLENKLLQLKSS--ATYGKSCQDLQREISILQEQISHLQFVIHSQHQNLRSVI
CACO1_DANRE     DLERMREQKREDEDEHKNL---KLKMEQTEKESLSAEFQSLRSSLAQLRDTITTLTHKLNSAHRKEAANE
ANR26_HUMAN     MSEASLE----------VTSRYRINLED-ETQDLKKKLGQIRNQLQEAQDRHTEAVRCAEKMQDHKQKLE
XNIF_XENLA      EQEQDKDQAQLDYEHRREEAEDVMKNYRKDLDQATLNRLQLEKKVESLLDEIAFL---RKVHEEEIAELQ
TRIPB_HUMAN     DIFQETKVQSLNIEN----GSEKHDLSKAETERLVKGIKERELEIKLLNEKNISLTKQIDQLSKEVGKLT
TPM_MIMNO       D----ADHKFDEAARKLAITEVDLERAETRLEAADAKVXXVGANIKTLQVQNDQASQREDSYEETIRDLT
ROCK2_HUMAN     ----ESALRQLEREKALLQHKNAEYQRKADHE--ADKKRNLENDVNSLKDQLEDLKKRNQNSQEKVNQLQ
PMFBP_MOUSE     NCLLQDKQKEEVIKD----LQSQLHKLQKESSKIEEERKHNRQRLQELSSELSEGQRRLSNAEKEKSLLQ
ODFP2_CHICK     ELQGD----------KMEMTRERYQSAQEEKKQLTLKAEELERKLETTSTQNIEFLQVIAKREESIHQCQ
NU211_SCHPO     SLTSERSEKLNDLEKSLVLSRSKDELDESYK-SLQEQLASKKIEVQNVSSQLSICNSQLEQSNHIVDNL-
NMCP_ARATH      ELEYCIENKREELENSSRDREKAFEQEKKLEEERIQSLKEMAEKLEHVQVELKRLDAERERREREWAELK
NDC80_NEUCR     EAEEERRQMQKAVD------DQGISMQDIDR--MTSERERLQRSIESASQRLEDVKKKVAEREMEAQRLD
MYSU_RABIT      ELEAELEDERK--QRALAVAKKKMEIDLKDLEQIEAANKARERRVK----QLRRLQAQMKDYQRELEEAR
MYSP_ONCVO      -------QKQAEYEEQIEIMLQKISQLEKAKSRLQSEVEVLIVDLEKAQNTIAILERAKEQLEKTVNELK
KIF15_HUMAN     KLNEDREVK----NAEILRMKEQLR----EMENLRLESQQLIEKNWLLQGQLDDIKRQKENSDQDNQQLK
KI20B_MOUSE     --QVQREVSVMRDEEKLL--RIKINELEKKKNQYSQDLDMKQRTIQQLKEQLSNQKMEEAVQQYE-----
K1C15_PROAT     SLEIELQTQ--------LARKSSLESTLAGTEQYGMRIQEIQMKINVFEDQISDLRAKMEFQSQEYQML-
HOOK_CULQU      KTEFEHNQLQ-----------AKLSAVQREKENLLSERDALREACDELRNTMSKELHSNDVRERRLEREN
HOOK2_HUMAN     ---ALQEQGGKTEDAISILLKRKLEEHLQKLHEADLELQRKREYIEELEPPTDSSTARREELQHNLQKKD
FBF1_HUMAN      DMEEERSRQQEVIGKMEARLNEQSRLLEQERWRVTAEQSKAESMQRALEEQRKVTAQQMAMERAELERAK
CUX1_MOUSE      QREAETLREQLSSANHSLQLASQIQTRSSLEVELAAKEREIAQLVEDVQRLQASLTKLRENSASQISQLE
CTGE5_MOUSE     EFESESQKLQQKYQENEMKLHRKLTVEENYRLEKEEKLSKVDEKISHATEELETCRQRAKDLEEELER--
CT2NL_PONAB     NKAAEEGQKAGELSLKLEKEKSRVSKLE---EELAAERKRGLQTEAQVEKQLSEFDIEREQLRAKLNR--
CT2NL_HUMAN     NKAAEEGQKAGELSLKLEKEKSRVSKLE---EELAAERKRGLQTEAQVEKQLSEFDIEREQLRAKLNR--
CROL2_HUMAN     RQRYWLGEEQEDAVQDGVRVRRELERSHRQLEQLEGKRSVLAKELVEVREALSRATLQRDMLQAEKAEVA
CNTLN_HUMAN     DLEKKFKDKSQEIKDTKECVQNKEEQNRLVIKNLEEENKKLSTRCTDLLNDLEKLRKQEAHLRKE-----
CING_CANFA      KLESSRLGLERQLQEKAEECSQLQELLERRKGEAQQSTKEL-QNMKLLVDQSERVRCGLEAQVKELQDKL
YD72_SCHPO      DAENDEELKDRQFVRKVLLKKGYAKSDASDKE--------------------------------------
WIT2_ARATH      HL-AEMENANESVKENLFEAESRAESGEAKIKELDAANLELTEELNFLKDADDKKTKKVNSLEKQVRELE
TANA_XENLA      TLESNE------------IKESKIPSDNTEEAEIISKSRKVFLENEYIKDDLTEFTSHLENDSESSQSFD
STX4_BOVIN      AIEPQKEEADENYN------SVNTRMRKTQHGVLSQQFVELINKCNLMQS---------EYREKNVERIR
ROCK1_BOVIN     SIEEAKSVAMCEMEKKLKEERDAREKAENRVVQIEKQCSMLDVDLKQSQQKLEHLIENKDRMEDEVKNLT
RAD50_SULSO     IIQFD-ENRYNELKTSLDAYNLSLKEKENRKSRIEGELESLEKDIEEISNRIANYELQLKDREKIINAIN
PLPA_MYCGA      DSESSRESFQQSKDQLIENFEKKIEL-LTEKLNQTQESFNQSQEAKQQQDKIERIIEQTKEANDSLQ--N
NIN_HUMAN       GNSALEEREQEKFNLKEELERCKVQ-SSTLVSSLEAELSEVKIQTHIVQQE-------------------
MYSP_OPIFE      DLEALRSQLEAERDNASALHDAEEALREVDQKYQNAQASEMEQRLREKDEELETL---RKSTTRTIEELT
MYSP_DIRIM      -------QKQAEYEEQIEIMLQKISQLEKAKSRLQSEVEVLIVDLEKAQNTIAILERAKEQLEKTVNELK
MYSP_BLOTA      GLQAHYD----EVHRQLQQAVDQLGVTQRRCQALTAELEEMRVN---LEQALRAKRAAEQMHEEAVVRVN
MTS1A_DANRE     RLEQEKEDLRSAFDGVLVQEQHRLDLADLEERLKTFYSTEWEKVHQAYQEEADKCKAQMEQQLEEIRSKH
MEU1_SCHPO      ----------------LKVAEEKIEKLLKENGTLKNEEKCLRMQIVAQEEYVAPLIQKLEIIEKKLDKFR
MBO1_SCHPO      ALKESELVKSND--NKLLL-NEQIESLNDQLSQLKTEMESVTTSKESLADYLSNL---KERHNDELDSLN
KIFC1_MOUSE     TLGTER----NTLEGELASVRSRAEQDQQRLETLSARVLELEEXXXXXXXXXSTLSTQLEEQERRFQATE
HOOK3_XENLA     KLEFEYKR-----------LKEKIDSLQKEKDRLRSERDSLKETIEELRAGLMPLGNQEEIKEKRLQHEN
HOOK1_CHICK     EQGSKTEQKLAAHMEKLSEVHDELQKKEAALAELQPDVSQNPQKIGELEAALRKKDEDMKAMEERYKMYL
GCOM1_HUMAN     ---------------------------EKVRKRMYGDYDEMRQKIRQLTQELSVSHAQQEYLENHIQTQS
FBF1_MOUSE      DLNGIIEQMEK-FSSSLNTLSSRVEASHTTSQQRELGIRQQDEQLRALQERLGRQQRDMEEERNRLQEVI
CYTSA_TAKRU     DLQ-EKETEIADMKETIFELEDEVEQHRALKLHDNLIITDLENSVKKLQD-------QKHDMEREIKILH
CCD91_RAT       KLKASEEEKQR----------IKKDVESLMEKHSVLEKDFLKEKE---QDAVSFQARYRELQEKELEDMR
ATG11_NEUCR     HFGESRENEKASYDEKVLKADDQVVLLQNERERIAAQDIELRAA----QDEIRVLSKRLEAVTEDKQKYR
YOMI_BACSU      ELQYELVQSKLDFDKRIGDFDVRIAKDESMANRYTSDSKEFR---KYTSDQKKAVAEQAKIQQQKVNKTN
YG3A_YEAST      EIENSMKAMREETSEKIEVSKNRLV-----KKIIDVNAEHNNKKLMILKD-------TENMKNQKLQEKN
SPDLY_HUMAN     HLEKLEEQLSRSHGQEVNELKTKIEKLKVELDEARLSEKQLKHQVDHQKELLSCKSEELRVMSERVQESM
SPC25_CANAL     QQEQDHKQKVNDLTNQKLQAKSLKEKENATRDKLNLAMRSLEQKVEDLVKKKQSLVDTKQDLESQIKQLE
ROCK2_BOVIN     ----ESTLRQLEREKALLQHKNAEYQRKADHE--ADKKRNLENDVNSLKDQLEDLKKRNQNSQEKVNQLQ
RMUC_NEIMB      DLEESR-QTVRDVQNDLSDVGNRFEKQIAHLQEKEAEAERLRQSHTELQEKAQGLAVENERLATQIEQER
NUF2_ASPFU      KLREERAEKQRDMERR------RIRIEQTEKKM--ADLKE------------------------------
NEMO_RAT        DLRRQREQALEDLEH---LKKCQQQMAE-DKASVKAQVTSLLGELQESQSRLEAATKERQTLEGRIRAVS
NDE1_RAT        SLEDFEQRLNQAIERNAFLESELDEKENLSVQRLKDEARDLRQELAVQQKQDKPRTPMP--SSGETKRTD
MYSS_RABIT      KLEAELENEVESEQKRNVEAVKGLRKHERRVKELTYQTEEDRKNVLRLQDLVDKLQRQAEEAEEQFRKLQ
MYSP_BOOMI      EYEKMREQRQRE-NKKLVLSEAKSQLADAIRHEYELEIKRLENERDELAAAYKEAETLRKQEEAKCQRLT
MIX1_CAEEL      QVKTNINNSEFG----IVVRDLKVHSEEYEKNQAEIEAKDVEDKIKTLESMKNKDKNSQEKRKKELTALL
LRC45_MOUSE     DLSAANEKNRSQVDELERKARSQQEQLFLTKQELTNTSAELKIRAIQAEERLDVEKRRAKQNMEDLEKLH
KINH_RAT        EMEKEHLNKVQTANEVKQAVEQQIQSRETHQKQISSLRDEVEAKEKLLQDQNQKMVLEQERLRVEHERL-
KIF4_CHICK      ELILALSMAKKDVNQAKLSERRRKRLQELEKKKLNEQAKLLKLK-ESTERTVSKLNQEREMKNQRVQLMR
KI20B_HUMAN     QVQKE-VSVMRDEDK---LLRIKINELEKKKNQCSQELDMKQRTIQQLKEQLN-----NQKVEEAIQQYE
K1C9_CANFA      QLRHSIQEMEIELQSQLSKKSALEKSLEDTKNHYCGQLQQLQEQIRSLEGQITEIRGEIECQNQEYSLL-
K1C10_CANFA     NLTTDNANILLQIDNARLAARLKYENEVALRQSVEADINGLRRVLDELTLTKADLEMQIESLTEELAYLK
IFEB_ASCSU      RWGKDTSEIKIQYSDSLRDARKEIDDGARRKAEIDVKVARLRDDLAELRNRYEDVQHRRESDREKINQWQ
HMMR_HUMAN      DLQNQLKQQEEDFRKQLEDEEGRKAEKENTTAELTEEINKWRLLYEELYNKTKPFQLQLDAFEVEKQAL-
GAS8_BOVIN      EIEAKYDKKMKMLRDELLRRKTEIEVEERKNGQITTLMQRHEEAINSLKEQMEDMGKKEEHLEKEMTEVN
FIP37_ARATH     --------KPASMQARRLLLDPAIHEEFSRLKNL---VEEKDKKIKELQDNIAAVT--------------
CCD18_MOUSE     QLKKEIERTQQRMKEMESVIKEQEDYIATQYKEVIDLGQELRLTQEQMQNTHSELVRQEVQAQREIERLA
APOA1_COTJA     ELMQAKLTPVAEEVRDRLR-----EQVEELRKNLAPYSSELRQKLSQKLEEIREIPQASEYQAKVVEQLS
Y451_HELPY      -LQEQQESLNKDYRKKLESIKERSDRLESDKTQFDAQLEKWEQNFKGYEQQLTDILNEREQLDLDQQRLN
VIMB_CARAU      SVEVDRDNLGENIER----LRQKLQEEMLQREDAENSLRSFRQDVDNASLARLDLERKVESLQEEIAFLK
SYCP1_MESAU     LLRTEKENKMKDLTFLLEESRDKVNQLE-DKTKLQDEVKELNKKKDHLTSELTKMSLQRS------MNTQ
STAT3_RAT       DLEQKMENLQDDFDFNYKTLKSQGDMQDLNGNNQSVT----RQKMQQLEQMLTALDQMRRSIVSELAGLL
STAT3_PIG       DLEQKMENLQDDFDFNYKTLKSQGDMQDLNGNNQSVT----RQKMQQLEQMLTALDQMRRSIVSELAGLL
STAT3_MOUSE     DLEQKMENLQDDFDFNYKTLKSQGDMQDLNGNNQSVT----RQKMQQLEQMLTALDQMRRSIVSELAGLL
STAT3_HUMAN     DLEQKMENLQDDFDFNYKTLKSQGDMQDLNGNNQSVT----RQKMQQLEQMLTALDQMRRSIVSELAGLL
RUFY2_PONAB     DLKIEKEWRQ-TLQEDLQKEKDALSHLRNETQQIISLKKEFLN----LQDENQQLKKIYHEQEQALQELN
RUFY2_HUMAN     DLKIEKEWRQ-TLQEDLQKEKDALSHLRNETQQIISLKKEFLN----LQDENQQLKKIYHEQEQALQELN
PIBF1_HUMAN     TLRLDNQLQQKDASKYQELMKQEMETILLRQKQLEETNLQLREKAGDVRRNL----RDFELTEEQYIKLK
PHLB2_MOUSE     DLEFQQLEHESRLD----------EEKENLTQQLLREVAEYQRNIVARKEKISALKKQASHIVQQAQR--
PHLB2_HUMAN     KLDAEREKLERYSEQKTQLDNCPESMREQLQQQLKRDADLLDVESKHFEDQLEHESRLDEEKENLTQQLL
ODFP2_RAT       DARRQVEQTKEQALSKERAAQSKILDLETQLSRTKTELGQLRR----TRDDV-----DRRYQSR-LQDLK
ODF2L_MOUSE     ELQGQVDGNQSLLTKLSLLIQLKCENLKEKLEQMDAENKELEKKLADQEECLKHSDLELKEKAAEYTALS
NDL1A_XENLA     ELEAELETQAEQRNRDLLSDNQRLKCEESLKEKLEHQYAQSYKQVSLLEDELARARSIKDQLHKYVRELE
MYS3_HYDAT      RLETEKQNRDKQID----TLNEDIRKQDETISKMNAEKKHVDEELKDRTEQL------------------
LAMB4_DANRE     EMTSYVKDQAENMMDKINRTKTKYEQEKTD-------TKALIEKVKYLQDEL--------VKPEDIEKLA
KTN1_CHICK      DSYSEAVRQNEELNMKLSETLSKLKVDQNERQKVAGDLPKAQESLASLEREIGKVVGDANVIENSDVRTE
KIF5C_MOUSE     -LQLEQERLSSDY--------NKLKIEDQERXXXXXXXXXXNDKREQAREDLKGLEETVSIELQTLHNLR
KIF4_MOUSE      LLKLERNQKQSNVLRRKTEEAAAANKRLKDALQKQKEVAEKRKETQ-SRGMESTAARMKNWLGNEIE---
KIF27_MOUSE     ELESKKVKLQKEFRKKMDAAKMRVQVKQQDSKKLASRASELEHNVDHLKYQKVQLQRRREEGEKKKQ---
K1C20_RAT       DAQIENARCVLQIDNAKLAAEDKFETEEADLQGLSKVYDDLTLQKTDLEIQIEELNKKKEHQE-EVEVLR
K1C10_BOVIN     NLTTDNANILIQVDNARLAARLKYENEVTLRQSVEADINGLRRQIESLTEELAYLKKNHEEEMRDLQNVS
F184B_HUMAN     KLEGDLEHRGRKIDLKKYAQKLKERIQDLDNSELKGTAKKLGEKLAVAKDRMMLQTQQTDAMKTELVSEN
EFG_AZOSB       EAAAE--------------ANEDLMNEYLENGDLSEEKIKLGLRTRTIACEIQPMLCGTAFKNKGVQRML
DCTN1_DROME     ELEVDLELLRSEMQNKAESAIGNISGGGDSPGLSTYEFKQLEQQNIRLKETLVRLRDLSAHDKHDIQKLS
CNPD_ARCB4      ELKAIKLEKEQEKNRKITTLKDGLEEQKKTYEEKTLEA--------------------------------
CLIP1_MOUSE     DMEAKFKEKD-DREDQLVKAKEKLEMSGDNSSQLTKMNDELRLKVEELQLKLTKANENASFLQKSIGEVT
CENPJ_PANTR     VMERFR----LDAWKRAEAIESSLEVEKKDKSQISSGTQVEKYKKNYLPMQGNPPRRSKSAPPRDLGSLD
CENPF_HUMAN     KMTAKETELQREMHE---MAQKTAELQEEEKNRLAGELQLLLEEIKSSKDQLKELTLENSELKKSLDCMH
CENPE_HUMAN     NLSKEAQK----FDSSLGALKTELSYKTQELQEKTREVQERLNEMEQLKEQLEDSTLQTVEREKTLEKLQ
CE290_BOVIN     TLKDARGAQ------KVISWHTKIEELRLQELKLNRELVKDKEEIKYLNNIISEYENTISSLEEEIVQQN
CCPG1_CHICK     NLEDKG----------------------TSTESIVMENQKLREHLEEEKQRNHNFRRQKETLFAEAQMLR
CC147_HUMAN     ELKEDISAKESALV-KLHLEQQRIEKE---KETLKAELQKLRQQALETKHFI-------EKQEAEERKLL
CACO1_RAT       ELSEERDQQQGEHVARILTMSDKVLMKEVELDRVRDMVKALTREQEKLLGQLKEFQADKEQSEAELQHLN
C3H41_ARATH     EPDAKRVKLDTASDSGAAIASPKTE-SSTDKK--------------------------------------
BRE1_ASHGO      ------------------------------------QIEELQTEIRVLEDTVAQLTDWKRLNEQELTKLR
ATG16_XENTR     ELNNQMQQKDKEIEEKIAKYLQTIQDLETECQDLRNKLQELERANQTLKDEYDALQITFTALEDKLRKTT
YQOE_CAEEL      DLQSQVNDLLMHFETQNKL-KEQLDAGKITQEEITESQVEL-----------------------------
Y4A0_ENCCU      KISKEREELGR-MQKKLL---DDLEFERNRGSKLEKAFQELRGEYEAVEGQLQ---KERQFRDSTQESL-
TIG_PROM5       PAESTRPQAEKNVQRNLALKAL------SESENITVEDKEINQKMKEYDDEISKSQKQIDIQKLKEVVLN
TAXB1_RAT       DAVNVRDKTMADLHTARLLAELQLHAVKTDQEKTDTLEHELRREVEDLKLRLQMAADHYKEKFKECQRLQ
SYGP1_HUMAN     EYERRLLSQEEQTSKILMQYQARLEQSE----------KRLRQQQAEKDSQIKSIIGRLMLVEEELRRDH
SYCP1_HUMAN     ----EKENKMKDLTFLLEESRDKVNQLE---EKTKLQSENLKQSI----EKQHHLTKELEDIKVSLQRTQ
STAT3_CHICK     DLEQKMENLQDDFDFNYKTLKSQGDMQDLNGNNQSVT----RQKMQQLEQMLTALDQMRRGIVSELAGLL
SMC6_MOUSE      PLKDELNLADSEVDSQ---KRGKQHYEDKQKEHLDTKRRELDMKEKELQEKMSEVKKSASILDKEINRLR
SLMAP_HUMAN     --ENQTRAKESDFSDTLSPSKEKSSDDTTDAQMDEQDLNEPLAKVSLLKDDLQGAQSEIE-AKQEIQHLR
QN1_HUMAN       DSEPTRNQNFTDLLAELRMAQKEIKRLKQDKQALEVDFEKMKKERDQAKDQIAYVTGEKLYEKQEISRLQ
OPTN_RAT        EKQ-ELVYSNRKLELQVESMRSEIKMEQAKTEEEKSRLATLQATHKLLQEHNKALRTIEELTKQQAEKVD
ODFP2_MOUSE     DARRQVEQTKEQALSKERAAQSKILDLET---QLSRTKTELGQLRRTRDD------ADRRYQSR-LQDLK
NEMO_BOVIN      ELRQQREQALKEVERLKTCQQQMAEDKASVKAQVTSLLGELQES----QSRLEAATKERQALERQLESER
NDEL1_XENTR     ELEAELETQAEQRNRDLLSDNQRLKCEESLKEKLEHQYAQSYKQVSLLEDELARARSIKDQLHKYVRELE
MYH2_PIG        DAAMMAEELKKEQDTSAHLERMKKNMEQTDLQHRLDEAEQLALKGGKKQIQLEARVRELEGEVESEQKRN
MYH10_RAT       ELEAELEDERK--QRALAVAKKKMEIDLKDLEAQIEAANKARDEV---IKQLRKLQAQMKDYQRELEEAR
MYH10_MOUSE     ELEAELEDERK--QRALAVAKKKMEIDLKDLEAQIEAANKARDEV---IKQLRKLQAQMKDYQRELEEAR
KIF1_DICDI      QLDQIKSQLQT--GQQIVLAKQK-EIEELTNSQLQLEKEINTQQFDGLRDEIQNRDEELEYKSQQSQKIN
GRAP1_RAT       DLAMETLQEKSQHKEELGAVRLRHEKEMLGRARYERELRELHEDKKRQEEELRGQIREEKARTRELENLQ
FAT1_SCHPO      AFN-EKGSLDFQFGRGFVLSKDRIEREVKNVVEKFDEVNDLLRKVRPGLDQTSQLNEESAYLEKRIQTLE
DIXC1_RAT       DLERELEQKD-----VLLAHRVKGDTDESSDLQLVRDADSLEQGISSLIERLHVIETQKKQERKVRGRRN
DCTN1_XENLA     XXXXXXXXXXXXXXREMADTADAIEMATLDKEMAEERAESLQQEVDTLKDKLEILKHEIEYQVKQLEEQN
CTTB2_RABIT     EMEAQMEKQLSEFDTEREQLRAKLNREETDLXXXXXXXXXXXXQLKRGSDSKPSLSLPRKTKDRRLASVS
CLPB_HELPY      QLEAQFENEKEVFKE---ISRLKMEMESLKKEAERFKRNGDYQQAGEIEYSKIP---ENKKKEEELQRKW
CEP63_PONAB     KLQKKQMREFRGNTKNHREDRSEIE-------RLTAKIEEFRQ--KSLDWEKQRLIYQQQVSSLEAQR--
CEP63_MACFA     KLQKKQMREFRGNTKNHREDRSEIE-------RLTAKIEEFRQ--KSLDWEKQRLIYQQQVSSLEAQR--
CEP63_HUMAN     KLQKKQMREFRGNTKNHREDRSEIE-------RLTAKIEEFRQ--KSLDWEKQRLIYQQQVSSLEAQR--
CENPC_HUMAN     -----KTKKRLNFDDKVMLKKIEIDNKVSDEEDKTSEGQE-RKPSGSSQNRI----RDSEY---EIQRQA
CCD69_XENTR     ELQAQA-QKDRDAD----IAKLLLEQAATIKVEMEEKLAELQQLIDSLQERVDELTQLASFQEK-----M
CACO2_BOVIN     DMQATLQKKQEELETLKSINK---KLEQTMKEQMSSENEKMGVRVDQLQAQLSNQGREMEKLVQGVQDKT
BFR1_YEAST      KIQADLKTRRKQLDAQIKRKNNQIE-EKLGKKAKFSSTAEAKQRINEIEESIASSLVQEKLLVKEMQSLN
AKAP9_HUMAN     DREHERDVFXXXXXXXXXXXXVVPRFQPISEHQ-TREVEQLANHLKEKTDKCSELLLSKEQLQRDIQERN
AGLZ_MYXXD      DLEARHAKEQED-----LAAKQKAELERRDAIK--------AQEVARLQQSVQEKSKALKVAELELAR--
ZIP1_YEAST      AHELELEEQNRHL-------KNCLEKKETGVEESLSDVKTLKQQVIVLKSEKQDITAEK----LELQDNL
YB145_PLAF7     KLKVTLDEKKKQFDKEINYAHIKAH----EKEQLLTEMEELK----------------------------
YA046_HUMAN     QLETELWQKLRATDQEMRRERQK----ERDLEALVKRFKDLHNCVAYIQEPRLLKEKVRGLFEKYVQRAD
VIME_CHICK      RVEVERDNLADD----IMRLREKLQEEMLQREEAESTLQSFRQDVDNASLAGLDLERPVESLQEEIVFLK
UACA_HUMAN      ELTLKNQTLQKEIEKVYL--DNKLLKEQA--HNLTIEMKNHYVPLKVSED--------------------
TNNT2_RAT       ERKSGKRQTEREKKKKILAERRKVAIDHLNEDQLREKAKELWQSIHNLEAEKFDLQEKFKQQKYEINVLR
T4AF1_HUMAN     DT-ATRRNVRKGYKP---LSKQKSEEELKDKNQLLAVNKQLHQKLTETQGELKDLTQKVELLEKFRDNCS
SYCP1_MOUSE     ELSAEKENKMKDLTFLLEESRDKANQLEEKTKLQDENLKELSEKKDHLTSELEDI----KMSMQRSMSTQ
RFIP4_MOUSE     KLDEERQRMSDRLEDTSLRLKDEMDLYKRMMDKLRQNRLEFQKEREATQELIEDLRRELEH---------
RAD50_THEAC     AID---EKKRQLISMESYLAKGKIREYETYDRQM----KDLEAQITDDENSLSTIAKHTKYEQLDEEYRS
RAD50_ARATH     CLQARWHAVREEKAKAANLLRDVTKAEE-DLERLAEEKSQLDLDVKYLTEALGPLSKEKEYNDMKIRR-N
PUMA_PARUN      DANAE---KSRLTDRIIGLEKTIGTLRNTETE-LRAQLSTAADERKALNSELEEMRRRIVQMESEKKDVD
PFDA_IGNH4      -----------------------VEGVAEEKAQVGVEAKGGEEKVKLLQDELRSLLAQIEYLRDQIEAVN
MYO5A_HUMAN     ALNHRIVQQAKEMEKKLVEETKQLELDLNDEQNLLNEFSRLEERYDDLKEEMTLMVHVPKPGHKRTDSTH
MYH10_HUMAN     ELEAELEDERK--QRALAVAKKKMEIDLKDLEAQIEAANKARDEV---IKQLRKLQAQMKDYQRELEEAR
MYH10_BOVIN     ELEAELEDERK--QRALAVAKKKMEIDLKDLEAQIEAANKARDEV---IKQLRKLQAQMKDYQRELEEAR
MD1L1_MOUSE     KRETHEALARRLQKRNALLTKERSELTQTESTQLTQEAEDMVQKVSEMEAQLSQALEELGVQKQRADTLE
KIF15_STRPU     QFREERDDLLHRLDTEALLSSSKEDLEKTDVEQLMAALQGQKGMVKDKEEQLASMQMQLEDTRGQVSLLE
KI21A_HUMAN     ---LERDQVLQNLGSVESYSEEKAKKVRSEYEKLQAMNKEL-QRLQAAQKEHARLLKNQSQYEKQLKKLQ
GOGA2_HUMAN     SLAELRNQMXXXXXXXXXXXXSEVE------QQLQAEAEHLRKELEGLAGQLQAQVQDNE----------
EVI5_HUMAN      --EAETQAEIREIKQRMMEMETQNQINSNHLRRAEQEVISLQEKVQYLSAQKGLLTQLSEAKRKQAEIEC
CING_XENTR      GLEAQLKETNTDLQRAESRLKDKITKLETEREDTLGEAADQEQELAFVKRDLG---NKLEEAQRSLKRLS
CING_XENLA      GLEAQLKETNTDLQRAESRLKDKINKLEAERKRMEDSLGEVADQ----EQELAFVKRDLESKLDEAQRSL
CI117_RAT       DLNDQLQSLQKEMEKEAQLAQVRHEFQET-KDQLTTENIALGIKLSSLE--------EFRLQKEELTEKY
CC146_HUMAN     ELSRKQREKERDF-RNLRKMELLLKVSWDALRQTQALHQRLLLEMEAIPKDDSTLSERRRELHKEVEVAK
CAR14_HUMAN     QAYSARDSAQRE------ISQSLVEKDSLRRQELTDQVCELRTQLRQLQAELKQEARTREPCPREKQRL-
BPAEA_MOUSE     SLHQEKGKLQREVDRVTALAERNIQCLNSDEKDLSEERRRLCQKSDHLKEELQNIQAEKENNDK-IQKLN
ZWINT_RAT       QLEA----KKRVLEEKLQLAQKQWVLQQKRLQNLTAEVKRRREKLDGSHQELETLKQQAGQEQEKLQRNQ
ZWINT_MOUSE     QLEA----KKRVLEEKLQLAQKQWVLQQKRLQNLTAEVKRRREKLDGSHQELETLKQQAGQEQEKLQRNQ
YM92_CAEEL      QLNVDKKVLQNDCDHRNQMLTKEISSLQTALEMKSAEMKELRQKNQNLSLQVDEIPKSNEYKQMLDQKIN
YL139_YARLI     SLKSQYEEGQGE--KEMLVGQLEEQLKRVSEEKDV----ELRQATERMEKELNDVTATKDHEIQQLKQQV
YA046_MOUSE     DQEMRKEQ-QKERDLEALVRRFK-----TDLHNCVAYIQELKEKIKYVQDLQQEYARQREHLERNLATLK
VIM4_XENLA      DLY---EEEMREIRRQLDQAINEKARVEVDRDNLGDDLQRLREK---LQDEMI----QREEAEGNLQSFR
SYS_SYNE7       DLEQQERQVRSELDTYLL----------------------------------------------------
SYS_DESHY       -LEQEEERRKLLFEVESLKAKRNTVSEEVDAEQLILEMREVGQKVKNLEDKLGEIEQSMEAVLYEIPNI-
SYCP2_MOUSE     DIEEKLVQKMRAYHRKTSLDKSFLVYNSVYEESVTSEMCLMKANMKMLQDKL-----LKEMHEEEVLNIR
SPC24_HUMAN     ELTMEKEVAQ-----SLLNAKEQVHQGGVELQQLEAGLQEAGEEDTRLKASLLQLTRELEELEADLERQE
SHE9_ASHGO      DLPSERERKRRQWSRKLEFYIDSLQ------ETIFTATKALNDVTGYLRKSIDMMETQLQETKRKLMQLR
RIMB1_HUMAN     SLEQEARKKQRNENARLVEENSRLSGRATEKEQVEWENAELR-------GQLLGVTQERDSALRKSQGLQ
RHG17_RAT       TLKEEMDE-----------AGNKVEQ---CKDQLAADMYNFMAKEEYGKFFVTLLEAQADYHRKALAVLE
RHG17_MOUSE     TLKEEMDE-----------AGNKVEQ---CKDQLAADMYNFMAKEEYGKFFVTLLEAQADYHRKALAVLE
P54_ENTFC       ALEGQ-----------VSAINTKAQDLLTKQDTLRKESAQLKQEIKDLQERIEEATIQKQARETQVKNTS
ODFP2_HUMAN     QTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYV
NFM_PIG         HLEEDIHRLKERFEEEARLTEAAIRALRKDIEEASLVKVELDKKVQSLQDEVAFLRSNHEEEVADL----
NFM_HUMAN       HLEEDIHRLKERFEEEARLTEAAIRALRKDIEEASLVKVELDKKVQSLQDEVAFLRSNHEEEVADL----
NDE1_DROME      DLTAKLTMFERENESKLKLESHGIDMSNMEKQLET---------VKKDRDTMKVYLRQLEQKNDDLERAH
MYH2_HUMAN      DAAMMAEELKKEQDTSAHLERMKKNMEQTVKDQLEAEQLALKGGKKQIQ-KLEARVRELEGEVESEQKRN
MYH2_HORSE      DMMAEELKKEQDTSAHLERMKKNLEQTVKDLQQRLDEAEQL--ALKGGKKQIQKLEARVRELEGEVESEQ
MTUS1_MOUSE     EAEKYKTQLQEQFDNNAAHETTKLEIEASHSEKV-----ELLKKT--YETSLSEIKKSHEMEKKSLEDLL
MEDB_GIALA      RLEAENA----DLRRELQDIRGRAQEMSASQRYSANQAQELQEKAMQAEELLQ--------QKIELRRLH
LCA5L_PAPAN     NLEKERSRKLRETDSQLLKTKDTLQLQKLSEDKNLAEREELTHKLSIITTKMEANDKKIQSLEKQLRLNS
KLPA_EMENI      DEKCARVRELNQLHSKTALQLSQIELDKT--------IKELAATREDLQSLRTELDRERKNTNNLRQNLD
K1C10_RAT       NLTTDNANVLLQIDNARLAARLKYENEVALRQSVEADINGLRRVLDELTLSKADLEMQIESLTEELAYLK
HOOK_BRAFL      RLETGLSHCEL---RKANTLRSQLDMYKKQVQELHGKVSEETKRADKAEFELKRSTEKLDTVQKEKQRI-
GAS8_RAT        EIHEVEERKNGQISTLMQITLNNLALINSLKEQM----EDMRKKEEYLEREMAEVSLQNKRLAEPLQRAK
EZRA_BACLD      AAQREHDERKEELQARELLKQLKQTIKDTEKSNVPGIPEAITEKIRQSQTTVQKVTEQLNELPLNMDAVN
EFG_YERPY       ESAAEASDELMD---------KYLGGEELTEEEI---KKALRQRV--LKSEIILVTCGSAFKNKGVQAML
EFG_YERPS       ESAAEASDELMD---------KYLGGEELTEEEI---KKALRQRV--LKSEIILVTCGSAFKNKGVQAML
EFG_YERPP       ESAAEASDELMD---------KYLGGEELTEEEI---KKALRQRV--LKSEIILVTCGSAFKNKGVQAML
EFG_YERPN       ESAAEASDELMD---------KYLGGEELTEEEI---KKALRQRV--LKSEIILVTCGSAFKNKGVQAML
EFG_YERPG       ESAAEASDELMD---------KYLGGEELTEEEI---KKALRQRV--LKSEIILVTCGSAFKNKGVQAML
EFG_YERPE       ESAAEASDELMD---------KYLGGEELTEEEI---KKALRQRV--LKSEIILVTCGSAFKNKGVQAML
EFG_YERPB       ESAAEASDELMD---------KYLGGEELTEEEI---KKALRQRV--LKSEIILVTCGSAFKNKGVQAML
EFG_YERPA       ESAAEASDELMD---------KYLGGEELTEEEI---KKALRQRV--LKSEIILVTCGSAFKNKGVQAML
EFG_YERP3       ESAAEASDELMD---------KYLGGEELTEEEI---KKALRQRV--LKSEIILVTCGSAFKNKGVQAML
DEFI6_XENLA     DVRENRERADRD----VQVAQKKLRQASTNVRHWNIQMNRLMHPI-------------------------
CWLO_BACSU      AALAKLETMQKDLDKQL---------NEKDKDEAKASQKKTAKAISELKSEASELANQKANTEAEQARIK
CP135_DANRE     AARAEKASVLADLASVRELCVKLDSSKELTVRQLTSKSMELERVTGELEDVRSEMNRQKEFQEKESEL--
CK5P2_HUMAN     EIQALRLQLERSIETSSTL-QSRL------KEQLARGAEKAQE---------------------------
CCD93_XENTR     --------------RKKLL------------DQLQEKASELQSGCGETRKQLTEVTSHMEKLDQELSVL-
ATPF_DESDG      DLENERKAIIAEYQAQEALKAAIISKAETSARQIVEQAKKAENEVKYAKDAM-----REELADMIVDATE
YDEM_CAEEL      AIIAEKEATAKSICAKYAKTEVELQRLKVDNDQLNDERIASNTTVTMLTKQIQDIENDRIHFLNKIRELN
YBAC_SCHPO      -RETERQEQYEVEIQRHLTNQHQLEIEESTKASHTENLGELTRNWQKAMDDVTEASKSKEYEQNELDATQ
Y4862_ARATH     QMQEKMKEAENDYEEKLLQVCDALDNTNID---LVAE----REKVVSLTRQIESLGTVKEVMEKETQEYK
Y147_TNAVC      KSELERDEKCLKSDNIIMELKRQLEINNVDLERIRDERNEYQEKVKFLDAEI--LTNRNKFEE-QTNALN
VIM1_XENLA      DLY---EEEMRELRRQLDQATNDKARVEVDRDNLADDLQRLREK---LQDEMI----QKEEAEGNLQSFR
UACA_BOVIN      -XXXXXXXXXXXXNASLSKNVSRLETVFIPPERHEKEMMALKSNITELKKQLSELNKKCGEDQEKIYSLN
TMF1_MOUSE      EQEGEKLSKQQLHNSNII---KKLRAKDKDNENVIAKAKELEEELQHLRQVLDGKEEVEKQHRENIKKLN
TAXB1_BOVIN     DAVNVRDKTMADLHTAHLLAELKLSAVNKDQEKTDTLEHELRREVEDLKLRLQMAADHYKEKFKECQRLQ
ROCK1_RABIT     SLQEEVKHLKYNLERMEGERKEAQDMNHSEKEKNNLEI-DLNYKLKSLQQRLEQEVNEHKVTKARLTDKH
RBCC1_MOUSE     ELISRHEEESNELDNVTSLHRQAYEIEKKLKEQIVELQTRLNSELSALEKQKEKITQQEEKYEALIQNLE
NFM_MOUSE       HLEEDIHRLKERFEEEARLTEAAIRALRKDIEESSMVKVELDKKVQSLQDEVAFLRSNHEEEVADL----
NFM_BOVIN       HLEEDIHRLKERFEEEARLTEAAIRALRKDIEESSLVKVELDKKVQSLQDEVAFLRSNHEEEVADL----
NDE1B_XENLA     TTKAVRDQLQKDFEQRLNQAIERLESELDEKERLKDEARDLRQELAVQQKQEKP---KSNMVSPETERMD
NDC80_ASHGO     NIKSEYDEYQQVSHSKLLSQRIEIEKLENDRHKTQQRVAQAEQEIEDAAFKLKELTLKIQQERVVLHRLI
MYSP_ANISI      -------QKQAEYEEQIEIMLQKVSQLEKAKARLQSEVEVLIVDLEKAQNTIAILERAKEQLEKQVLEMK
MYSA_DROME      DIQ-ERLTQEEDARNQLFQQKKKADQEKKDIEDLELNVQKAEQDKATKDHQIRNLNDEIAHQDELINKLN
MYH2_CANFA      DAAMMAEELKKEQDTSAHLERMKKNMEQTDLQHRLDEAEQLALKGGKKQIQLEARVRELEGEVESEQKRN
MYH11_MOUSE     ALEAKEEQVEQEAREKQAATKSXXXXERKMAEQYKEQAEKGNTKVKQLKRQLEEAEEESQCINANRRKLQ
MIP1_ARATH      EIRAEREGSKLSASESLKACMEASXXXXXXXXXXVAWEKQIKEKIKALYKTLAQITEYEKEIEAKWRQEQ
MAD1_DEBHA      YVFKQRDELQSKYDNSQQINGKTVESLQVQLKDITERYDELKEEHEYLNSDFKKFCRDNNQVKSDLE---
K2C7_RAT        RLEVELRNMQEDFKNKYTAAENEFVLLKKDVDAAYTNKVELEAKADSLQDEINFLKTLHETELAELQ---
K2C7_MOUSE      RLEVELRNMQEDFKNKYTAAENEFVLLKKDVDAAYTNKVELEAKADSLQDEINFLKTLHETELAELQ---
K1C20_MOUSE     DAQVQNAQCVLRIDNAKLAAEDKFETEEADYDNLTLQKTDLEIQIEELNKDLALL--KKEHQE-EVEVLR
HOOK_DROMO      DNESSKNVK-LEFDNKNL--ESKALALQREKDSLLKERDNLREAFDELKGSLTGNTVSRELQPDKIQRLN
HAUS3_MOUSE     DIPASEQLTSRTIDTKDHSTHRLYELLEGDNEHLEEVAEKLKQDVSVIQDQLAVSTQE------------
GG8L1_HUMAN     ----------------------QIQTLNIQKEELNTDLYHMKRSLRYFEEKSKDLAVRLQHSLQRKGELE
FBF1_CHICK      VMQKCSEERRKEFHTQQQLSKERMERDIDRALQLDSQREGTIMSLAKEQAELKVRSRELKVKEEQLARDR
EDE1_YEAST      NLNSMTASLQSQLNEKQQQVKQERSMVDVNSKQLQVTVANLQKEIDGLGEKISVLTKQ-----KELNDYQ
CTRO_HUMAN      KLEAQNRKLEEQLEK-------------------------------------------------------
CNPD_PELPD      ------QQKEENLDKKFGLIEQK-ELDMLKKEQLAAKSEELSRASDVQQAKLEEISGMSASEAKK-----
CNPD_NITSB      EKEMSLKQMFKDELKHITLEKQEIKAEREEINRLKNEYEELKKRYKY-QEVLEALQQQAGLTLEEAKNLQ
CNPD_CHLTE      QKEVTLANQMRDIXXXXXXXXXXXXXXXHQTQNVQNRSAELEKTINQRLESISNLTAEEARQMLIDNMIA
CING_MOUSE      DWASEAEKNSGGLSRALQTSQAERDTARLDKELLAQRLQGLEQEAENKKRFQDDKARQLKSLEEKVSRLE
CI117_MOUSE     DLNDQLQSLEKDMEKEAQLAQVRHEFQEI-KDQLTTENIALGIKLSSLE--------EFRLQKEELTEKY
CI117_HUMAN     ELAVQEKMFRQEFEQ---LANNKKEIVAFLKRTLNQQVDEITDLNEQLQNLQLAKEMEKDAFEAQLAQVR
CASP_MOUSE      KTRTELFDLKTKYDEETTAKADEIEMIMTDLERANQRAEVAQREAETLREQLS--------------SAN
CAO1B_XENLA     SLQAERSQRQSENRRQLSELKSALKVAQMEKQQLREERQGILQYARSLEERLDKLA-------DELWKED
BRE1_DEBHA      NVKHLLDKELREENETL---KQQLQKSENDLVRIRTARDELLSKQTILKADF-----ENQTTNDELNKLN
BICD2_MOUSE     NTQSENEQELKEINQNVEIQRGRLRDDIKEEARLLQDYSELEEENISLQKQVSVLRQQVEFEEEETEYLN
BICD2_HUMAN     NTQSENEQELKEINQNVEIQRGRLRDDIKEEARLLQDYSELEEENISLQKQVSVLRQQVEFEEEETEYLN
AV71_ACAVI      DIRAEYDQNRTDMESWYKLKVQEIQTQSTEQGYAKEEVKRLRVQLSELRGKLADLEGRNSLLEKQTQELN
APOA1_CHICK     ELMQAKLTPVAEEARDRL----RGHVEEL-RKNLAPYSDELRQKLSQKLEEIKGIPQASEYQAKVMEQLS
ANR24_MOUSE     ELQAEKQEEKESLGREVESLQSRLSLLENERENTSYDVATLQDEVASLQEQVAQLTRQNQELLEKVQILE
A16L1_MOUSE     DLNNQMQQK----DKEIQMNEAKISEYLQTISDLETNCLDLRTKLQDL--EVANQTLKDEYDALQIEKLR
YIBP_ECOLI      GEESQRGQRLQAYFGYLNQARQEIAQLKQTREEVAMQRAELEEK---QSEQQTLLYEQRAQQAKLTQALN
YF82_SCHPO      DLQTDRENLKHQFEDQIEKLNSEISNQNSLILQKKDELEKSIQRCSELEEKINSLESAQSIEQEVI----
TNNT2_BOVIN     ERKSGKRQTEREKKKKILAERRKVAIDHLNEDQLREKAKELWQMIYDLEAEKFDLQEKFKQQKYEINVLR
TG278_CAEEL     SLRTEKERLGETFEMKLRRAQSLYETEEALKEELLARQDEFHDRLQELQLQVTALEKKLHNKEKEVQTLT
STX4_RAT        AIEPQKEEADENYN------SVNTRMKKTQHGVLSQQFVELINKCNSMQS---------EYREKNVERIR
STX4_MOUSE      AIEPQKEEADENYN------SVNTRMKKTQHGVLSQQFVELINKCNSMQS---------EYREKNVERIR
SPTA2_HUMAN     DKEATSEELGQDLEHVEVLQK-KFEEFQTDMAAHEERVNEVNQAAKLIQEQLKGLALQRQFGAAEVQRFN
SMC4_XENLA      DKEAQKEKIQEDTKDISEKSNTLLETMKEKNKALKDVEKQLNKITKFIEENREKFTQ-------------
ROCK1_RAT       SLQEEVKHLKHNLERVEGERKEAQDMNHSEKEKNNLEI-DLNYKLKSIQQRLEQEVNEHKVTKARLTDKH
RIMB1_RAT       ELELQLRAAQNE-NARLVEENSRLSGKATEKEQVEWENAELKGQLLGVTQERDSALRKSQGLQSKLESLE
OPTN_HUMAN      EKELVYTNKKLELQVESMLSEIKMEQAKTEDEKSKLTVLQMTHN-KLLQEHNNALKTIEELTRKESEKVD
NFM_RAT         HLEEDIHRLKERFEEEARLTEAAIRAVRKDIEESSMVKVELDKKVQSLQDEVAFLRSNHEEEVADL----
MYOJ_DICDI      KLQAEQKNKDDEI--------RKIQFELNDKQQFTRQTKEFSD----LQSQQSIDRQKSEITIHSLERTN
MYH4_PIG        DLDVERDKKQRNFDK--ILAEWKHKYEETQAE-LEASQKESRSKVKNAYDQLETLKRENKNLQQEISDLT
MYH2_BOVIN      DLDVERDKKQRNFDKILAEWKQKYEETHAELEAAQKEARSLKMKNAYEEDQLETLKRENKNLQQEISDLT
MYH1_HUMAN      KLEAELEGEVESEQKRNVEAVKGLRKHERKVKELTYQTEEDRKNILRLQDLVDKLQRQAEEAEEQFRRIQ
MYH11_RAT       --KAKLKSTVAALEAKIVQLEEQIEQEAREKQAATXXVEQYKEQAEKGNTKVKQLKRQLEEAEEESQRIN
MYH11_HUMAN     QLEEQVEQEAREXXXXXXXXXXQVEDERKMAEQYKEQAEKGNARVKQLKRQLEEAEEESQRINANRRKLQ
MTUS1_PONAB     EAEKYKMQLQEQFDNKLEIEASHSEKVELLKKAYEASLSEIKKEKKSLEDLLSEKQESLEKQISDLKSEN
MCP3_SCHPO      DLKLETEKLQDQINQSLQEALETVKNDEKNLREMNAEMKEARQKLNNKEALISHYDDDFRAKELKISRLS
LEKR1_HUMAN     ELAKERAQHLVEFEEQALLFKEETKLQDIEKEKHQDVIQKYKKEQEELQMKISDLTGATRDLRQEVTTLK
LAML1_XENLA     DIRDQMQQQLNDYE-QLLDVKLALDME-------------------------------------------
KINH_HUMAN      QDLATRVKKSAEIDSDSAAQKQKISFLENNLEQLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALE
KI21B_MOUSE     DTQLERDRVLQNLSTMECYTEEKANKIKADYEKRLREMNRDLQKLQAAQKEHARLLKNQSRYERELKKL-
KI21B_HUMAN     DTQLERDRVLQNLSTMECYTEEKANKIKADYEKRLREMNRDLQKLQAAQKEHARLLKNQSRYERELKKL-
KI15A_XENLA     TLRAEFSNXXXXXXXXXXRRQKLTSQLEEDKENKTKELLQVVDENMHLRKQCSELMTKCEQQVTELHGLE
K1C10_HUMAN     NLTTDNANILLQIDNARLAARLKYENEVALRQSVEADINGLRRVLDELTLTKADLEMQIESLTEELAYLK
ESIP1_RAT       QMRSKYQQKLKR-DEAIRIRKDAEEAELQRMKAIQREKSNKLEKKKQLQEDIRRATLREHHQSKTAELLS
CUX1_HUMAN      KTRTELFDLKTKYDEETTAKADEIEMIMTDLERANQRAEVAQREAETLREQLS--------------SAN
CTTB2_FELCA     GKVIEEAQKLEEVMAKLEEEKTKTSALE---EELSAEKRRSTEMEAQMEKQLSEFDTEREQLRAKLHR--
CNPD_STAS1      --EARLLQKEENLERKSDLLDKKDEI----LEQKESKLEERQQQVDAKESSVQTLINKHEQELERISGL-
CLPB_CHRVO      IWKAEKAAQQGSQSIKEEIDRLKVDMEELKRKGDWQKLAELQYKLPQLEARLKEAESAGDKGEAKPNRLL
CLIP2_MOUSE     ELEGGQAQAIEFLKEQISLAEKKMEMLQRAEAQSRQEAERLREKLLVAENRLQAAESLCSAQHSHVIESS
CK5P2_PANTR     EIQALRLQLERSIE--------------------------------------------------------
CIP2A_HUMAN     NQLVDREHKLANLHQKTKVQEEKIQKEREDKEETIDILRKELSRTEQIRKELSIKASSLEVQKAQLEGRL
CCD57_MOUSE     DLEAVKDARIKGLEKKLYSAQAKKKAEETFREELDRQARE------------------------------
CB039_HUMAN     KTELYNIEKAFEVERQELLASNKKKWEQALQAHNAKELEYLNNRMKKVEDYEKQLNRQRIWDCEE-----
CASP_PONAB      KTRTELFDLKTKYDEETTAKADEIEMIMTDLERANQRAEVAQREAETLREQLS--------------SAN
CASP_HUMAN      KTRTELFDLKTKYDEETTAKADEIEMIMTDLERANQRAEVAQREAETLREQLS--------------SAN
CACO1_MOUSE     ELSEERDQQQGDHVARILTMSDKVLMKEVELDRVRDTVKALTREQEKLLRQLKEFQADKEQSEAELQ---
ATK1_ARATH      SLQQYNSKLQTDLET----VRAALTRAEKEKSSILENLSTLRGHSKSLQDQLS---SSRVLQDDAIKQKD
ATG11_ASPFU     EIKATEQENLQTLQAAF--------MNLSPGGAVPAEIPSIIKAIEVLSEGLSIHVKNAEEKMAEAVAEN
AP1_ARATH       DLQAMSPKELQNLEQQLDTALKHIR---TRKNQLMYESNELQKKEKAIQEQNSMLSKQIKEREK------


                         .         .         +         .         .         .         .:490
query           KALEEALSIQTPPSSPPTAFGSPEGAGALLRKQELVTQNELLKQQVKIFEEDFQRERSDRERMNXXXXXX
TNIP1_HUMAN     KALEEALSIQTPPSSPPTAFGSPEGAGALLRKQELVTQNELLKQQVKIFEEDFQRERSDRERMNXXXXXX
TNIP1_MOUSE     KALEEALSIQXXXXXXXXXFGSPEGVGGHLRKQELVTQNELLKQQVKIFEEDFQRERSDRERMNXXXXXX
TNIP3_HUMAN     KALQDALNIKCSFSEDCLRKSRVEFC-----HEEMRTEMEVLKQQVQIYEEDFKKERSDRERLNQEKEEL
CEP55_RAT       EDKHKTEKIQKLREESSVFKGXXXXXDSLLKHQEEQSRVALLERQMQACTLDFENEKLDRQNMQHQLYVI
CEP55_MOUSE     EDKQKTERIQKLREESSIFKGXXXXXDSLLKHQEEQARVALLEQQMQACTLDFENEKLDRQNMQHQLYVI
TPR_HUMAN       ----------------------------------------------------------------------
HMW2_MYCPN      EFNKQQQSEQ------------------------------------------------------------
CEP55_HUMAN     DDRHKTEKIQKLREENDIARGXXXXXXSLLKQQEEQTRVALLEQQMQACTLDFENEKLDRQHV-------
MPP9_MOUSE      CRLQD-----------------------------------------------------------------
HMMR_RAT        --LNEHGATQEQLSKIRDSYAQLLGHQNLKQKVKLKDENSQLKSEVSKLRSQLAKRKQNELRL-------
IMH1_YEAST      K---------------------------------------------------------------------
CCD46_HUMAN     KELESQEQITYIRQEYETKL---KGLMPASLRQELEDTISSLKSQVNFLQK-------------------
CCD46_MOUSE     KELEAQEQIMYIRQEYETKF---KGLMPASLRQELEDTISSLKSQVNFLQK-------------------
CCD41_HUMAN     DLKQQISSLQIQVTSLAQS------------ENDLLNSNQMLKEMVERLKQECRNFRSQAEKAQ------
CC150_HUMAN     NVLASHSKMQGALEKVQIELGRRDSEIAGLKKERDLNQQRVQKLEAEV----------------------
TNIP2_MOUSE     RQLEEKIS--------DCAEANQELTAMRMSRDTALERVQMLEQQILAYKDDFKSERADRER--------
MOEH_ANOGA      EEVEEAIRKQVAKGSPSLCFASP-----------------------------------------------
CLIP1_HUMAN     EASEEAVSVQRSMQETVNKLHQKEEQFNMLSSDLEKLRENLADMEAKFREKDEREEQKAKEKLENDIAEI
SPTB2_MOUSE     QFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMR-------------
SPTB2_HUMAN     QFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMR-------------
SMC3_RAT        ----------------------------------------------------------------------
SMC3_PONAB      ----------------------------------------------------------------------
SMC3_MOUSE      ----------------------------------------------------------------------
SMC3_HUMAN      ----------------------------------------------------------------------
SMC3_BOVIN      ----------------------------------------------------------------------
SYCP3_MOUSE     KSLQSML---------------------------------------------------------------
RUD3_YEAST      KQLE------------------------------------------------------------------
MYSP_DERFA      NERDEL----------SAAYKEAE----TLRKQEEAKNQRLIAELAQV-RHDYEKRLAQKDE--------
IFE_BRALA       DQLNESLTIVEVDSRAASTFAGPDLTEAL---REIRTQYEELKYKQKFSELAHQRERDNEALM-------
FKB15_HUMAN     KCL-------------------------------------------------------------------
CTRO_MOUSE      KAANSSLFTQRNMKAQEEMISELRQQKFYLETQKLEAQNRKLEEQLKISHQD------------------
CE290_DANRE     RQVEKALHIVALQLSETTAISRLEATNTRLQKQKLRDEQKLDEQQQALWQEGHQRARHLRHTIQ-ALRRQ
GOGA3_MOUSE     QELEES----------------------------------------------------------------
EZRI_RABIT      HRAREA----------------------------------------------------------------
DMD_PIG         FAQEESVMVMTEDSYVPSAYLTTHVSQALSEVEQLLNAPDLC---AKDFEDLFKQEES------------
DMD_HUMAN       FAREETMMVMTEDSYVPSTYLTTHVSQALLEVEQLLNAPDLC---AKDFEDLFKQEES------------
CP250_HUMAN     LDLEEELQAQSSQIHDLESHSTVLARELQERDQEVKSQREQIEELQRQKEHLTQLERRDQELM-------
DIAP1_MOUSE     ----------------------------------------------------------------------
TNIP2_HUMAN     RQLEEKIN--------DCAEVKQELAASRTARDAALERVQMLEQQILAYKDDFMSERADRER--------
KIF15_RAT       KLIEEMLKMKTDLEEVQSALDSKE----------------------------------------------
MYH9_CHICK      EEL-EALKTELEDTLDSTA---AQQELRSKREQEVTVLKKTLEDEAKTHEAQIQEMR-------------
USO1_YEAST      SQLDEAMLLET-----------------------------------------------------------
SPO15_SCHPO     K-IEQDLRACLNSSS-----NELKEKSALIDKQELNNLREQIKEQKKVSE--------------------
M12_STRPY       KALEEANS--------------------------------------------------------------
CROCC_MOUSE     TQL-------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
QN1_RAT         KERRMMLSRQSPR-------GREEMAAKRLKKEIL-----------------------------------
GOGB1_HUMAN     SSSSQTLKVQYQRQASPETSASPDGS------QNLVYETELLRTQLNDSLKEIHQKELRIQQLN------
DMD_CANFA       FAQEESLEISYVPSTYLTEI--THVSQALSEVEELLNAPDLCAQD---FEDLFKQEES------------
CING_SORAR      MELDE-----------------------------------------------------------------
CE164_HUMAN     QQLREIL---------------------------------------------------------------
SGM1_SCHPO      EEIRSS----------------------------------------------------------------
NF70_LOLPE      NIL-------------------------------------------------------------------
NF60_LOLPE      NIL-------------------------------------------------------------------
MYO3_CAEBR      EDLQ------------------------------------------------------------------
MYO2_SCHPO      DASLKYIELQ------------------------------------------------------------
MYH8_MOUSE      KGLRK-----------------------------------------------------------------
GOGA5_RAT       QLTETLIQKQTLLESLST------------EKNSLVFQLERLEQQL------------------------
GOGA5_HUMAN     EAESAREQLQDLHD---------QIAGQKASKQELETELERLKQEFHYIEEDLYRTKN------------
GOGA4_HUMAN     KSQSEYLKI-------------------------------------------------------------
FIL1L_HUMAN     KRLE------------------------------------------------------------------
TPM2_SCHMA      KAADES----------------------------------------------------------------
SYCP3_RAT       KSLQSML---------------------------------------------------------------
SMC4_DICDI      KKHSEAKAV-------------------------------------------------------------
SAS6_DANRE      KSLSEEL---------------------------------------------------------------
MLP1_YEAST      SKLDESFKDFTNQIKNLTEKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEDFKKRISILQNNN------
HMMR_MOUSE      ----------------------------------------------------------------------
CNPD_PELLD      EEAEE-----------------------------------------------------------------
PU92_SCICO      CETSEFLAIATQRQSQLTS---------------------------------------------------
MYH8_HUMAN      KGLRK-----------------------------------------------------------------
HMW2_MYCGA      KSKQNSLVLEQKLKSDLEHLNLSKN---YLDKQELNQKSDKMIEDLKVFERDLKRQKED-----------
GCOM1_XENTR     K---------------------------------------------------------------------
CEP63_CHICK     QRLLYQQQVASLEAQRKALAEQSE-----LIQTQLASRKQILESVELASRSEIQHLTSKLERANDTICAN
CC150_MOUSE     KALED-----------------------------------------------------------------
BPA1_HUMAN      AESENVLEKQTIQQRCEALKIQADGF-----KDQLRSTNEHLHKQTKT-EQDFQRK--------------
ALM1_SCHPO      KFAEELLHVNSLAERLKGELNASKGEKDLRKR----TQERLISENDKLLAE---RER-------------
SYCP3_MESAU     KSLQSML---------------------------------------------------------------
MYH8_CANFA      KGLRK-----------------------------------------------------------------
MYH3_MOUSE      TESVKGLR-KYERRVKELTYQSEEDRKNVLRLQDLVD-----KLQVKVKSYKRQAEEADEQ---------
KIF7_HUMAN      ----------------------------------------------------------------------
KIF15_MOUSE     KLIEEMLKMKTNLEEVQSALHSKEKAEEIERTRTLESRAFQEKEQLRSKLEEMYEER-------------
DMD_MOUSE       FAQIHTLHEET-----------------------------------------------------------
CUX2_HUMAN      LSILKAMKLASSTCSLPQGMAKPEDSLLIAKEAFFPTQKFLLEK--------------------------
CNPD_PROVI      KAREEA----------------------------------------------------------------
APSB_EMENI      SKVQR-LTVQIESSQNEIAFLREEQDGDKIKESELKTYRMSLKDKTKELEGRLAEERYQRE---------
SAS6_CHICK      TTIK------------------------------------------------------------------
NUF1_YEAST      KDIEE-----------------------------------------------------------------
MYO1_CAEEL      SEISQ-----------------------------------------------------------------
MYH7_RAT        RRIKE-LTYQT-----------EEDRKNLLRLQDLVDKLQL-----------------------------
MYH7_PAPHA      RRIKE-LTYQT-----------EEDRKNLLRLQDLVDKLQL-----------------------------
MYH7_MOUSE      RRIKE-LTYQT-----------EEDRKNLLRLQDLVDKLQL-----------------------------
MYH7_MESAU      RRIKE-LTYQT-----------EEDRKNLLRLQDLVDKLQL-----------------------------
MYH7_HUMAN      RRIKE-LTYQT-----------EEDRKNLLRLQDLVDKLQL-----------------------------
MYH7_CANFA      RRIKE-LTYQT-----------EEDRKNLLRLQDLVDKLQL-----------------------------
MYH3_RAT        TESVKGLR-KYERRVKELTYQSEEDRKNVLRLQDLVD-----KLQVKVKSYKRQAEEADEQ---------
MYH3_HUMAN      TESVKGLR-KYERRVKELTYQSEEDRKNVLRLQDLVD-----KLQVKVKSYKRQAEEADEQ---------
MRCKB_HUMAN     ERMAE-----------------------------------------------------------------
MRCKA_HUMAN     RAKKE-----------------------------------------------------------------
MPP9_HUMAN      SRLQD-----------------------------------------------------------------
IMH1_ASHGO      RKMED-----------------------------------------------------------------
IFA1_CAEEL      TDLDQ-----------------------------------------------------------------
GRDN_MOUSE      KSLEE-----------------------------------------------------------------
GOGA3_HUMAN     KAYENAVGI-------------------------------------------------------------
GOGA1_HUMAN     AANQES----------------------------------------------------------------
FKB15_MOUSE     ----------------------------------------------------------------------
CP250_MOUSE     LDLEE-----------------------------------------------------------------
CGNL1_HUMAN     EALVHA----------------------------------------------------------------
BRE1_ASPFU      ----------------------------------------------------------------------
UACA_CANFA      --LLENDSLSKNVSRLETVFVPPE----------------------------------------------
SWP70_CHICK     KQLQEALEVEKQARQDEETVRKLQ---ARLLEEESAKRAELLQQQQTIQMTEAEKQELENQRM-------
SMC2_HUMAN      EAIKSYES-QIEVMAAEVAKNKESVNKA---QEEVTKQKEVITAQDTVIKAKYAEVAKHKEQNN------
NEMO_DROME      KKMQLDIN---------------ELKARDIQKQEVI---KGLQIQNDIYRRDFEMERADREK--------
MRCKA_RAT       RAKKE-----------------------------------------------------------------
BRE1_CRYNE      NALVEAQQI-------------------------------------------------------------
TAXB1_PONAB     KQINK-----------------------------------------------------------------
SMC1_YEAST      KSLEE-----------------------------------------------------------------
MYSS_CYPCA      GSLEQEKKLR---MDLERAKRKLEGDLKLAQESIMDLENEKQQSDEKIKKKDFE----------------
MYO3_CAEEL      EDLQ------------------------------------------------------------------
MYH9_RAT        KKLKDVL---------------------------------------------------------------
MYH9_MOUSE      KKLKDVL---------------------------------------------------------------
MRCKB_MOUSE     ERMSELRSLKQKVSRQ-------------LRDKE--EEMEVAMQKIDSMRQDLRKSEKSRK---------
GFAP_DANRE      ----------------------------------------------------------------------
GFAP_CARAU      ----------------------------------------------------------------------
EFG_ACIAC       DAVIDYL--PSPVDIPPVA-GTDEDEAETTRKAD------------------------------------
EEA1_HUMAN      SELEVAVYVQELQK-------LKSSVNELTQKNQTLTENLLKKEQDYTKLEEKHNEES------------
DAPLE_XENLA     RALEKEIS--------------------------------------------------------------
CE290_HUMAN     MQL-------------------------------------------------------------------
CACO1_BOVIN     LELQEAKDRQEEQSAQAQRLKDAQMKDTLGQVQQRVAELEPLKEQLR-----------------------
ANT1_ONCVO      ALIDE---LRSKLNDAERAMADLQNRDSILEREDWKEKSDALNMELDRLRDELLSVRRDAEKINRYNTDL
YNP9_CAEEL      NDFE------------------------------------------------------------------
VIME_RAT        K---------------------------------------------------------------------
VIME_MOUSE      K---------------------------------------------------------------------
VIME_MESAU      K---------------------------------------------------------------------
VIME_CRIGR      K---------------------------------------------------------------------
VIME_BOVIN      K---------------------------------------------------------------------
SPTCB_DROME     RFLRDLDHFQTWLTKTQTDVASEDTPTSLPEAEKLLNQHQSIREEIDNYTEDYKNMMEYGERL-------
NIN_MOUSE       ASLKEELDHYKVQTSTLVSSLEAELSEVKLQTHVMEQENLLLKDELERLKQDFQQKMS------------
MYSN_DROME      KA--------------------------------------------------------------------
MYSC_CHICK      KDIDDL-----------------EITLAKVEKEKHATENKVLTEEMATLDENISKLTKEKKSLQEAHQQV
MYO2_CAEEL      R---------------------------------------------------------------------
MYH6_RAT        RRIKE-LTYQT-----------EEDKKNLVRLQDLVDKLQL-----------------------------
LIPA1_HUMAN     RQLQERLEL------------AEQKLQQTLRKAETLPEVEALAQRVAALSKAEERHGNIEERLR------
K1C9_HUMAN      KNHKEEMSQLTGQNS-------------------------------------------------------
HOOK3_MOUSE     KMLKLN---QEDSDNEKIALLQSLLDDANLRKNELETENRLVNQEVQSQVEELQKSLQDQ----------
HOOK3_HUMAN     KMLKLN---QEGSDNEKIALLQSLLDDANLRKNELETENRLVNQEVQSQVEELQKSLQDQ----------
HMW2_MYCGE      ----------------------------------------------------------------------
HIP1_HUMAN      EIERKAQANEQRYSKLKEKYSEVQNHADLLRKNAEVTKQVSMARQAQV---DLEREKKELE---------
GRDN_HUMAN      KTVEEL----------RTTVDSVEGNASKILKME--KENQRLSKKVEILENEIVQEK-------------
GPTC8_MOUSE     ELAEQRKQAECAPGSGP-----------------------------------------------------
GPTC8_HUMAN     ELAEQRKQAECAPGSGP-----------------------------------------------------
CP135_HUMAN     HIIQRSCSTSYSAREKSSIFRTPEKGDYNSEIHQITRERDELQRMLERFEEDIQSNTAERDKLSVLYNEA
CNPD_CHLPD      KAREEA----------------------------------------------------------------
CASC4_CHICK     EQLAE-----------------------------------------------------------------
WAP_ARATH       EAL-------------------------------------------------------------------
TAXB1_HUMAN     KQINK-----------------------------------------------------------------
SYCP3_MACFA     KSLQSML---------------------------------------------------------------
ROCK2_MOUSE     KQLDEANALLRTESD----------TAARLRKTQAESSKQI--QQLESNNRDLQ----------------
NDE1_CHICK      TAVQASLSLPSTPS--------------------------------------------------------
MYH8_RAT        AEAVKGLRKHERRVKELT-YQTEEDRKNVLRLQDLVD-----KLQAKVKSYKRQAEEAEEQ---------
MYH7_PIG        RRIKE-LTYQT-----------EEDRKNLLRLQDLVDKLQL-----------------------------
MYH7_BOVIN      RRIKE-LTYQT-----------EEDRKNLLRLQDLVDKLQL-----------------------------
MYH6_HUMAN      RRIKE-LTYQT-----------EEDKKNLLRLQDLVDKLQL-----------------------------
MRCKA_MOUSE     RAKKE-----------------------------------------------------------------
LIPB1_MOUSE     ERL-------------------------------------------------------------------
KINH_DROME      DTVAKELDLQQRIRKNVVNEESEEDGGSLAQKQKISFLENNLDQLTKVHKQ-LVRDNAD-----------
K1C9_RAT        KLLE------------------------------------------------------------------
GRIP_ARATH      QILED-----------------------------------------------------------------
GOGA1_MOUSE     ----------------------------------------------------------------------
FIL1L_MOUSE     KRLEK-----------------------------------------------------------------
EVI5L_HUMAN     KGLQTQLSESRRKQAEAECKSKEEVMAVRLREADSMAAVAEMRQ--RIAELEIQRE--------------
DESP_HUMAN      NTLTQ-----------------------------------------------------------------
CD158_HUMAN     QEL----------STVATEKNKMAGELEVLRSQERRLKEKVTNMEVALDKASLQ----------------
CCHCR_MOUSE     HMLEEELTRKIQPLDP------------------------------------------------------
CCD41_RAT       QMLKD-----------------------------------------------------------------
YOND_BACSU      TMLVDLVSVPTETNTTIREFSS------------------------------------------------
VIME_ONCMY      KLHDEEVA--------------------------------------------------------------
SMC_BACSU       ----------------------------------------------------------------------
SMC2_XENLA      KMRDQEVSLEEALSEAQRADTKVQSALDLKKQNMKAEREKKRKELVKSMEED------------------
SKI_XENLA       ----------------------------------------------------------------------
SBCC_BACSU      E---------------------------------------------------------------------
RB6I2_HUMAN     LRLEEKETMLNKKTKQIQDMAEEKGAGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEK--------
PLST_CARAU      ----------------------------------------------------------------------
OPTN_CHICK      KVVVEELNAKVXXXXXXXXXXXXEMKQLIAKQEEDLETMAVLRAQMEVYCSDFHAERAAREKIH------
MYSP_MYTGA      VRLEEA-----------EAFAQREGKRQIAKLQARILENELEADQRRLREAAASARKFERQ---------
MYSP_CAEEL      HLYEKAV---------------------------------------------------------------
MYH6_MOUSE      RRIKE-LTYQT-----------EEDKKNLMRLQDLVDKLQL-----------------------------
MY18A_MOUSE     KDLKRTKAL-------------------------------------------------------------
MRCKB_RAT       ERMAELRS-------------QKQKVSRQLRDKE--EEMEVAMQKIDSMRQDIRKSEKSRKEL-------
KINH_SYNRA      KSMAQQLA--------------------------------------------------------------
EP15R_MOUSE     DDLNRAKSELNRLQQEETQLEQSIQAGR--------AQLETILRSLKCTQDDINQARS------------
EEA1_MOUSE      SELEVAVYVQEIQKLKGS-------INELTQKNQNLTE-KLQKKDLDYLEEKHNEESASRKTLQASLHQR
CUT_CAEEL       ----------------------------------------------------------------------
CGNL1_MOUSE     RAEEEALTKRQLLEQSLKDLEYELEAKSHLKRSRLIKQ---MEDKVSQLEIELEEERTNADLLS------
CCD41_MOUSE     SEVKE-----------------------------------------------------------------
CCD18_HUMAN     SELE------------------------------------------------------------------
CC151_BOVIN     HELEELHLVN----------------------QEALNARDIAKNQLQYLEETVFRERKKRER--------
CASP_CAEEL      ----------------------------------------------------------------------
ATG11_PICST     EDLSRVMEINTTSDKEIIALNSTISSMRNELNDTVVMKNDLL-SNISAKEVEHSKERNGLE---------
Y1002_CHLCV     RELADALAYQ------------------------------------------------------------
VIME_PANTR      K---------------------------------------------------------------------
VIME_MACFA      K---------------------------------------------------------------------
VIME_HUMAN      K---------------------------------------------------------------------
VIME_CERAE      K---------------------------------------------------------------------
SMC2_MOUSE      EAIK------------------------------------------------------------------
OPTN_MOUSE      KMLLQELSEKLELAEQALALQMDEMKQTLAKQEEDLETMAVLRAQMEVYCSDFHAERAAREKIH------
OPTN_DANRE      ---DDYDELQTRFATAEKALADKEMKMELFQKEKDLETISVFQAQAEIYSSDFYAERAAREKIHEEKERL
NDE1_HUMAN      QANDD-----------------------------------------------------------------
MYO5C_HUMAN     KALEAQNEIHT-----------------------------------------------------------
MYH9_HUMAN      KKLKDVL---------------------------------------------------------------
MYH9_CANFA      KKLKDVL---------------------------------------------------------------
MYH13_HUMAN     EQIAE-----------------------------------------------------------------
EP15R_HUMAN     RAKSELNRLQQEETQLEQSIQAGRVQLETIIKSLKSTQDEINQARSKLSQLHESRQEAHR----------
DZIP1_DANRE     -IQESMQSVQTQPN----ASTSNE------HWQEVVLQQKLHKQEVKKMKEDHDREKS------------
DIAP1_HUMAN     AA--------------------------------------------------------------------
CD158_MOUSE     EALLKAMKSEC-QGQMERQMAAIQGKNESLEKSSLTAQLESTKEMLRKVVEELTAKKMNLE---------
SYCP3_HUMAN     KSLQSML---------------------------------------------------------------
MYS_AEQIR       DQLSE-----------------------------------------------------------------
MYH7_HORSE      ----------------------------------------------------------------------
MYH6_MESAU      RRIKE-LTYQT-----------EEDKKNLVRLQDLVDKLQL-----------------------------
MYH13_CANFA     KRGAEALAHKYERKVKELTYQAEEDRKNILRLQDLV---DKLQAKVKAYK--------------------
MY18A_HUMAN     ALLADA----------------------------------------------------------------
MOES_LYTVA      ----------------------------------------------------------------------
MLP2_YEAST      SCKDSQL---------------------------------------------------------------
MFP1_ARATH      KSLDE-----------------------------------------------------------------
LRCC1_MOUSE     RALEK-----------------------------------------------------------------
KIF7_DANRE      ----------------------------------------------------------------------
GOGA4_MOUSE     QTLEESISIL--HEEYETKFKNQEKRMEKIKKEMQETKKKLLDQEAKLKKE-------------------
FLIP1_HUMAN     K-LEEAFS--------------------------------------------------------------
SGM1_YEAST      KALQEA----------------------------------------------------------------
ROCK2_RAT       KQLDEANALLRTESD----------TAARLRKTQAESSKQI--QQLESNNRDLQ----------------
NDE1_XENTR      RDLRQELAVQQKQEKPKSNMGSPE----------------------------------------------
MYSP_BRUMA      VRIDE-LTVXXXXXXXXXXXXXXXXXXXXNLYEKAVEQKEALARENKKLQDDLHEAKEALADANRKLH--
MYO1_YEAST      EKIDNHKKELATFSKQRDDAVSEHGKITAELKETRIQLTEYKSNYQKIKEENFQRETKEQEQ--------
ITSN1_XENLA     --VEKKPEIQEKPNKP---FHQPPEPGKL-----------------------------------------
GOGA5_MOUSE     SAREQLQDLQDQIAKQRTS------------KQELETELERMKQEFRYMEEDLHRTKN------------
GCC2_MOUSE      KTMQEALSSKIKSLYEENNRLHSEKAQLSRDLEALQAQQDFAKEHVAEFEKKLQLMVEERDDLNKLLENE
GCC2_HUMAN      GENEKLLSQQ------------------------------------------------------------
ETP1_YEAST      SVKEGTILIQQP----------------------------------------------------------
CTK2_XENLA      NTIEEL-----------------QGANAILTKQ-------LLDKEVKL----------------------
CC146_RAT       LAQQRSLS----------------EAEAKLVEQQIAEENKLLKEQETMREVLFNLGRM------------
SPDLY_MACFA     SSEMLALQIE------------------------------------------------------------
RRBP1_MOUSE     ----------------------------------------------------------------------
RMUC_NEIMA      LASEEKLSL-------------------------------------------------------------
OPTN_XENLA      KVLLEKLDV-CEKALAKKQFEIDEMREMDTKHEEDKETIELLRAQVDVYCADFHAERSARENIH------
NUF2_EMENI      ----------------------------------------------------------------------
MYSP_SARSC      IALEQANRAKRQAEQLHEE--------AVARVNELTTINVNLASAKSKLESEFAALQNDYDEVH------
MYO4_CAEEL      ----------------------------------------------------------------------
MOEH_CULQU      EEVEEARRKQT-----------------------------------------------------------
MAD1_YARLI      EGLKDLLN--------------------------------------------------------------
KIF8_DICDI      ----------------------------------------------------------------------
KIF4_XENLA      KGMEGAAS--------------------------------------------------------------
K1C10_MOUSE     KNHEEEM---------------------------------------------------------------
HOOK_AEDAE      ERLERENKVLREGQGGQTAL-SQLLDDANQRNEKLRDQLKAANQRVLLLSQHHNEDISSKSDMDIQLKQA
DCTN1_CHICK     ARLKEALVRMRDLSA------SEKQEHVKLQKQKKNTELESLRQQEKLQEEVKQAEKT------------
CENPE_MOUSE     KSLQEARDLENQEKLRIAHMNLKEHQETIDRLMETMSEKELENVNMKLQEKVQELKTSERQRVKLKADAS
CD72_HUMAN      ----------------------------------------------------------------------
CCD68_HUMAN     QEME------------------------------------------------------------------
CACO1_DANRE     LALNELRSVQ------------------------------------------------------------
ANR26_HUMAN     K---------------------------------------------------------------------
XNIF_XENLA      ASVQEAISVEMDVVSKP-----------------------------------------------------
TRIPB_HUMAN     QIIQQ-----------------------------------------------------------------
TPM_MIMNO       KSLKDA----------------------------------------------------------------
ROCK2_HUMAN     RQLDETNALLRTESD----------TAARLRKTQAESSKQI--QQLESNNRDLQ----------------
PMFBP_MOUSE     KTLDE-----------------------------------------------------------------
ODFP2_CHICK     LRLEE-----------------------------------------------------------------
NU211_SCHPO     ----------------------------------------------------------------------
NMCP_ARATH      DSVEE-----------------------------------------------------------------
NDC80_NEUCR     E---------------------------------------------------------------------
MYSU_RABIT      GSRDE-----------------------------------------------------------------
MYSP_ONCVO      VRIDE-LTVXXXXXXXXXXXXXXXXXKMKNLYEKAVEQKEALARENKKLQDDLHEAKEALADANRKLH--
KIF15_HUMAN     NEQEESI---------------------------------------------------------------
KI20B_MOUSE     ----------------------------------------------------------------------
K1C15_PROAT     ----------------------------------------------------------------------
HOOK_CULQU      KALREGQGGQTALSQLLD--------DANQRNDKLRDQLKSANQRIMLLSQNHSDEISSKSDMDIQLKQA
HOOK2_HUMAN     RAMEERMVMQTEPKQRPAAGAPPE-------LHSLRTQLRERDVRIRHLEMDFEKSRSQREQ--------
FBF1_HUMAN      SALLE-----------------------------------------------------------------
CUX1_MOUSE      QQL-------------------------------------------------------------------
CTGE5_MOUSE     ----------------------------------------------------------------------
CT2NL_PONAB     ----------------------------------------------------------------------
CT2NL_HUMAN     ----------------------------------------------------------------------
CROL2_HUMAN     EALTKAEGRGGLPAGLPVQAERPQ----------------------------------------------
CNTLN_HUMAN     ----------------------------------------------------------------------
CING_CANFA      KQAQE-----------------------------------------------------------------
YD72_SCHPO      ----------------------------------------------------------------------
WIT2_ARATH      VQVQNS----------------------------------------------------------------
TANA_XENLA      SKLFENKSTE------------------------------------------------------------
STX4_BOVIN      RQLK------------------------------------------------------------------
ROCK1_BOVIN     LQLEQ-----------------------------------------------------------------
RAD50_SULSO     K---------------------------------------------------------------------
PLPA_MYCGA      RVKESSLDMESKLENKFESFADKLTEITSKKISEKMTEQQAKKEEIDSLQSSFQKALSE-----------
NIN_HUMAN       ----------------------------------------------------------------------
MYSP_OPIFE      VTITE-----------------------------------------------------------------
MYSP_DIRIM      VRIDE-----------------------------------------------------------------
MYSP_BLOTA      ELTTINVNLASAKSKLETEFSALQNDYDEVHKELRISDERVQKLTIEV----------------------
MTS1A_DANRE     EALKKEL---------------------------------------------------------------
MEU1_SCHPO      KNMEDELRITRLASENNVLISRIDRTKR--HFSELFTQKQMLQLQNENFKDDYEKIKEENKRL-------
MBO1_SCHPO      KKLREFEGILSSNSSLKSEIEERNNQYVTLRENFDSLQNAIMEQQIRKLKDENKKDQSGTDKL-------
KIFC1_MOUSE     AALEEVVCLRQKTEAQVTLLAEQGDRGLEMERRRLHNQLQELKGNIRVF---------------------
HOOK3_XENLA     KMLKIN---QEGSDNEKISLLQSLLDDANMRKNELETENRLVNQRL------------------------
HOOK1_CHICK     EKARNVIKTLDPKLNPASA---------------------------------------------------
GCOM1_HUMAN     SALDRFNAMNSALAS--------DSIGLQKTLVDVTLENSNIKDQIRNLQQTYEASMDKREKQR------
FBF1_MOUSE      GKMEVRLSEQSRLLEQERWRVAAEKTKAESAQRTLEEQRKIMVQQIAMEREELERAKS------------
CYTSA_TAKRU     RRLRE-----------------------------------------------------------------
CCD91_RAT       KAGHEALSI-------------------------------------------------------------
ATG11_NEUCR     QALEDIWECLAPADDVPTELPTGKAADILNTKQGVEGDMSLMKLNVDTLQNNIRTLRSEMD---------
YOMI_BACSU      KALNSAQRAQ------------------------------------------------------------
YG3A_YEAST      EVLDKQTNVKS-----------------------------------------------------------
SPDLY_HUMAN     SSEMLALQIE------------------------------------------------------------
SPC25_CANAL     TAIDQ-----------------------------------------------------------------
ROCK2_BOVIN     RQLDETNALLRTESD----------TAARLRKTQAESSKQI--QQLESNNRDLQ----------------
RMUC_NEIMB      LASEEKLSL-------------------------------------------------------------
NUF2_ASPFU      ----------------------------------------------------------------------
NEMO_RAT        EQVRQ-----------------------------------------------------------------
NDE1_RAT        MAVQ---ATGSAPSTPITHQGSSSG---------------------------------------------
MYSS_RABIT      HELEEA----------------------------------------------------------------
MYSP_BOOMI      AELAQ-----------------------------------------------------------------
MIX1_CAEEL      QKAEQTVA--------------------------------------------------------------
LRC45_MOUSE     ----------------------------------------------------------------------
KINH_RAT        KAVDQEKS--------------------------------------------------------------
KIF4_CHICK      QMKEDAEKFRQWKQ-------QKDKEVIQLKERDRKRQYELLK-----LERDFQKQAS------------
KI20B_HUMAN     RACKD-----------------------------------------------------------------
K1C9_CANFA      ----------------------------------------------------------------------
K1C10_CANFA     KNHEEEM---------------------------------------------------------------
IFEB_ASCSU      HAIEDAQS--------------------------------------------------------------
HMMR_HUMAN      ----------------------------------------------------------------------
GAS8_BOVIN      RRLADPLKAREEMSDMQKKLGSYERDKQILKARLKVTEKELLRWEHEVLEQRFQQERDD-----------
FIP37_ARATH     ----------------------------------------------------------------------
CCD18_MOUSE     GELEDIKQLSKEKEAHGNRLAEELGASQVREEARMQAEIKKLSSEVDSLKEAYQIE--------------
APOA1_COTJA     NLREK-----------------------------------------------------------------
Y451_HELPY      -AQKQAL---------------------------------------------------------------
VIMB_CARAU      KLHDEELA--------------------------------------------------------------
SYCP1_MESAU     KALEEDLQIAT-----------------------------------------------------------
STAT3_RAT       SAME------------------------------------------------------------------
STAT3_PIG       SAME------------------------------------------------------------------
STAT3_MOUSE     SAME------------------------------------------------------------------
STAT3_HUMAN     SAME------------------------------------------------------------------
RUFY2_PONAB     KLSESKLKIE------------------------------------------------------------
RUFY2_HUMAN     KLSESKLKIE------------------------------------------------------------
PIBF1_HUMAN     AFPEDQLSIPEYVSVRFYELVNPEICELQVKKEELSTNKNQLKQLTETYEED------------------
PHLB2_MOUSE     ----------------------------------------------------------------------
PHLB2_HUMAN     REVAE-----------------------------------------------------------------
ODFP2_RAT       DRLEQSES--------------------------------------------------------------
ODF2L_MOUSE     RQLEAAL---------------------------------------------------------------
NDL1A_XENLA     QANDD-----------------------------------------------------------------
MYS3_HYDAT      ----------------------------------------------------------------------
LAMB4_DANRE     NAV---LSIQLPKSPXXXXXXXXXXXXXLANITEFNDDLEYLEKQAKI----------------------
KTN1_CHICK      SELTD-----------------------------------------------------------------
KIF5C_MOUSE     KLFVQDLTTRVKKS---VELDSDDGGGSAAQKQKISFLENNLEQLTKVHKQ-LVRDNAD-----------
KIF4_MOUSE      ----------------------------------------------------------------------
KIF27_MOUSE     ----------------------------------------------------------------------
K1C20_RAT       RQLGNNVNVEV-DAAPGLNLG--EIMNEMRQKYEILAQKNL--QEAK---EQFERQTQTLEK--------
K1C10_BOVIN     ----------------------------------------------------------------------
F184B_HUMAN     KVLREENDLEAPQQDQSCLKECPKGGTDMQTKKEASAETEYMKQQ---YEEDLRKIKHQTE---------
EFG_AZOSB       DAVIEFL--PSPVDIPPVA---------------------------------------------------
DCTN1_DROME     KELE------------------------------------------------------------------
CNPD_ARCB4      ----------------------------------------------------------------------
CLIP1_MOUSE     LKAEQS----------------------------------------------------------------
CENPJ_PANTR     KG--QAASPREPPE--PLNFPDPE----------------------------------------------
CENPF_HUMAN     K---------------------------------------------------------------------
CENPE_HUMAN     QTLEEVKTL-------------------------------------------------------------
CE290_BOVIN     KFHEE-----------------------------------------------------------------
CCPG1_CHICK     RELDEALKKELEQLSSRQTPDSVNDDDTLRENEEIETRGRLVELEKKL---NFEQQRSD-----------
CC147_HUMAN     RIIAEA----------------------------------------------------------------
CACO1_RAT       TELQEAKGRQEEQGAQVQRLKDKVAKDTLGQTQQKVAELEPLKEQLRGVQE-------------------
C3H41_ARATH     ----------------------------------------------------------------------
BRE1_ASHGO      QMASSAELSQRHPTPPSSSNLSADLQVLRSKVEKLSHENKELAQLNEAYLGKFQQLSADREIFN------
ATG16_XENTR     EDNQELVS--------------------------------------------------------------
YQOE_CAEEL      ----------------------------------------------------------------------
Y4A0_ENCCU      --LEKTRGLERRVKSLNEKLRREEMANRQLMSEKDEMYREIHVLQQSKLDEIFDRE--------------
TIG_PROM5       DLLKEKL---------------------------------------------------------------
TAXB1_RAT       KQINK-LSDQSASSN-------------------------------------------------------
SYGP1_HUMAN     PAMAEPL---------------------------------------------------------------
SYCP1_HUMAN     KALEEDLQIAT-----------------------------------------------------------
STAT3_CHICK     SAME------------------------------------------------------------------
SMC6_MOUSE      QKIQ------------------------------------------------------------------
SLMAP_HUMAN     KELIEAQELAR--TSKQKCF----ELQALLEEERKAYRNQVEEKQIQVLQAQLQRLHIDTENLREEKDSE
QN1_HUMAN       KRLQ------------------------------------------------------------------
OPTN_RAT        KVQLQELSEKLELAEQALALQMDEMKQTIAKQEEDLETMAVLRAQMEVYCSDFHAERAAREKIH------
ODFP2_MOUSE     DRLEQSES--------------------------------------------------------------
NEMO_BOVIN      EALEQRHSVQ------------------------------------------------------------
NDEL1_XENTR     QANDD-----------------------------------------------------------------
MYH2_PIG        AEAVKGLRKHERRVKELT-YQTEEDRKNILRLQDLVD-----KLQAKVKSYKRQAEEAEEQ---------
MYH10_RAT       ASRDE-----------------------------------------------------------------
MYH10_MOUSE     ASRDE-----------------------------------------------------------------
KIF1_DICDI      QLSGQVNKLENVTQEKELTIGSL--SSTLNNTNQII---ELINEQSKSYKNVAEME--------------
GRAP1_RAT       HTVEE-----------------------------------------------------------------
FAT1_SCHPO      RSLEEVTPI-------------------------------------------------------------
DIXC1_RAT       QASSEYRASWPPNSTLPHSQSSP-----------------------------------------------
DCTN1_XENLA     ARLKEALVRMRDLS----ASEKQEHIKVQKQMEKKNTELDTLRQQ----KEKLQEEASHMEK--------
CTTB2_RABIT     VATERAVACQTDPVTEST----------------------------------------------------
CLPB_HELPY      EAMQQ-----------------------------------------------------------------
CEP63_PONAB     KALAEQSEI-------------------------------------------------------------
CEP63_MACFA     KALAEQSEI-------------------------------------------------------------
CEP63_HUMAN     KALAEQSEI-------------------------------------------------------------
CENPC_HUMAN     KKSFSTLFLETVKRKSESS--------PIVRHAATAPPHSCPPDDTKLIEDEFIIDESD-QSFASRSWIT
CCD69_XENTR     KRVEESVL-----SQDYRRHIQDHGSPGQFWEQEIQSLHFVIEMKSELIREQDKRLRSHKSTM-------
CACO2_BOVIN     EQLE------------------------------------------------------------------
BFR1_YEAST      KLIKDLVNIE------------------------------------------------------------
AKAP9_HUMAN     EEIEK-----------------------------------------------------------------
AGLZ_MYXXD      ----------------------------------------------------------------------
ZIP1_YEAST      ESLEE-----------------------------------------------------------------
YB145_PLAF7     ----------------------------------------------------------------------
YA046_HUMAN     --MVEIAGLNTDLQQEYTRQREHLERNLATLKKKVVKEGELHRDYVRIMQEN------------------
VIME_CHICK      KLHDEEI---------------------------------------------------------------
UACA_HUMAN      ----------------------------------------------------------------------
TNNT2_RAT       NRIND-----------------------------------------------------------------
T4AF1_HUMAN     KGLDPALGSET-----------------------------------------------------------
SYCP1_MOUSE     KALEEDLQIATKTISQLT----------------------------------------------------
RFIP4_MOUSE     ----------------------------------------------------------------------
RAD50_THEAC     MHLEDLRQKYTDWNNAMAVISNIGDIEALRKQKDEVSK------KLKDAEDRTHEIESEFPDINSYTPSY
RAD50_ARATH     QEYEE-----------------------------------------------------------------
PUMA_PARUN      NQLEEV-----------------NKARIIMTKKIEILETEKHSAELVISETASQREAIERERENKELYKN
PFDA_IGNH4      TVIDD-----------------------------------------------------------------
MYO5A_HUMAN     SSNEEIAEMEDIPSEEPSEKKVPLDMSLFLKLQKRVTE---LEQEKQVMQDELDRK--------------
MYH10_HUMAN     ASRDE-----------------------------------------------------------------
MYH10_BOVIN     ASRDE-----------------------------------------------------------------
MD1L1_MOUSE     MEL-KMLKAQTSSAESSFSFCKEEVDALRLKVEELEGERSRLEQEKQVLEMQMEK---------------
KIF15_STRPU     AALEE---------------GKASGAGL---QSQIAALEDRMHAQAGEYQEQIEQMRAD-----------
KI21A_HUMAN     QDVME-----------------------------------------------------------------
GOGA2_HUMAN     ----------------------------------------------------------------------
EVI5_HUMAN      KNKEEVMAVR------------------------------------------------------------
CING_XENTR      ----------------------------------------------------------------------
CING_XENLA      KRL-------------------------------------------------------------------
CI117_RAT       MALEEQLRRQ------------------------------------------------------------
CC146_HUMAN     RNLAQQKIISEMESK--------------LVEQQLAEENKLLKEQENMKE--------------------
CAR14_HUMAN     ----------------------------------------------------------------------
BPAEA_MOUSE     KELEK----------------SNECAETLKQKDELTRQNKLMMQRIQAESKNIVREK-------------
ZWINT_RAT       SYLQLLCSLQ------------------------------------------------------------
ZWINT_MOUSE     SYLQLLCSLQ------------------------------------------------------------
YM92_CAEEL      ----------------------------------------------------------------------
YL139_YARLI     QDLTIQLSSATVSDVKTLRTDYEHYKSQCYRKDVMISELEARLQREENLEK-FETELKDKEK--------
YA046_MOUSE     K---------------------------------------------------------------------
VIM4_XENLA      QDVDNA----------------------------------------------------------------
SYS_SYNE7       ----------------------------------------------------------------------
SYS_DESHY       ----------------------------------------------------------------------
SYCP2_MOUSE     RGLQ------------------------------------------------------------------
SPC24_HUMAN     KEVDEDTTVTIP----------------------------------------------------------
SHE9_ASHGO      EAHSDAVAVRNQ---------SQRQVNELLQRKHMWSPGD-LESFTRLYKEDADNVRRQEE---------
RIMB1_HUMAN     SKLE------------------------------------------------------------------
RHG17_RAT       KALPEMRAHQDKWAEKP-AFGTP-----------------------------------------------
RHG17_MOUSE     KALPEMRAHQDKWAEKP-AFGTP-----------------------------------------------
P54_ENTFC       SNYIDAVL---------NADSLADAVGRIQAMSTIVKANQDLVQQQK-----------------------
ODFP2_HUMAN     QFLKSS----------------------------------------------------------------
NFM_PIG         ----------------------------------------------------------------------
NFM_HUMAN       ----------------------------------------------------------------------
NDE1_DROME      RILNESI---------------------------------------------------------------
MYH2_HUMAN      AEAVKGLRKHERRVKELT-YQTEEDRKNILRLQDLVD-----KLQAKVKSYKRQAEEAEEQ---------
MYH2_HORSE      KRSAEAIKRKHERRVKELTYQTEEDRKNILRLQDLVD-----KLQAKVKSYKRQAEEAEEQ---------
MTUS1_MOUSE     NEKQESLEKQ------------------------------------------------------------
MEDB_GIALA      EALERA----------------DAGEAALRDKRRL--EDEIKGLQLRLTENDFTKERS------------
LCA5L_PAPAN     RAFSRQLAIET-----------------------------------------------------------
KLPA_EMENI      TAASNSVTLESTISA-------------------------------------------------------
K1C10_RAT       KNHEEEM---------------------------------------------------------------
HOOK_BRAFL      ----------------------------------------------------------------------
GAS8_RAT        EEMSEM----------QKRLGNHERDKQILKARLKVTEKELLKWEHEILEQRFIKVQQEREEL-------
EZRA_BACLD      ERLQEAEQLVT-----------------------------------------------------------
EFG_YERPY       DAVIEYLPAPTDVES-------------------------------------------------------
EFG_YERPS       DAVIEYLPAPTDVES-------------------------------------------------------
EFG_YERPP       DAVIEYLPAPTDVES-------------------------------------------------------
EFG_YERPN       DAVIEYLPAPTDVES-------------------------------------------------------
EFG_YERPG       DAVIEYLPAPTDVES-------------------------------------------------------
EFG_YERPE       DAVIEYLPAPTDVES-------------------------------------------------------
EFG_YERPB       DAVIEYLPAPTDVES-------------------------------------------------------
EFG_YERPA       DAVIEYLPAPTDVES-------------------------------------------------------
EFG_YERP3       DAVIEYLPAPTDVES-------------------------------------------------------
DEFI6_XENLA     ----------------------------------------------------------------------
CWLO_BACSU      KEQEAAAAL-------------------------------------------------------------
CP135_DANRE     KVLKDRLAL----ADSKTAGHAREVSQLRGKVSQLQTEMDVLKRQ--LTTERFERERAVQE---------
CK5P2_HUMAN     ----------------------------------------------------------------------
CCD93_XENTR     ----ENMESKADPS-------------VLQKLRDLVAQNESLKAQEQQFRSKCREEMS------------
ATPF_DESDG      KLLKERL---------------------------------------------------------------
YDEM_CAEEL      EQRVDFLNAE------------------------------------------------------------
YBAC_SCHPO      KRLSRVSDLEHEVKEKTLLIGK--------LQHEAVVLNEHLTKALCMLKDGNNAEKIDKQ---------
Y4862_ARATH     EMLEES----------------------------------------------------------------
Y147_TNAVC      NMLRQYSRRSINNSNPSLNDTRKLHMQLQLQIETLNNQLDTVKSERKIVLEEVIR---------------
VIM1_XENLA      QDVDNA----------------------------------------------------------------
UACA_BOVIN      NDLKKTMSHQYVP---------------------------------------------------------
TMF1_MOUSE      SVVE------------------------------------------------------------------
TAXB1_BOVIN     KQINK-LSDQSANSN-------------------------------------------------------
ROCK1_RABIT     QSIEEAKSVAMCXXXXXXXXXXXXXXXXXNRVVQIEKQCSMLDVDLKQSQQKLEHLTENKERM-------
RBCC1_MOUSE     KDKE------------------------------------------------------------------
NFM_MOUSE       ----------------------------------------------------------------------
NFM_BOVIN       ----------------------------------------------------------------------
NDE1B_XENLA     TSVQASIAIPLAPLTP------------------------------------------------------
NDC80_ASHGO     KVIEYVVSFK------------------------------------------------------------
MYSP_ANISI      SRID------------------------------------------------------------------
MYSA_DROME      K---------------------------------------------------------------------
MYH2_CANFA      AEAVKGLRKHERRVKELT-YQTEEDRKNILRLQDLVD-----KLQAKVKSYKRQAEEAEEQ---------
MYH11_MOUSE     RELDEA----------------------------------------------------------------
MIP1_ARATH      KAKEEALAMEEEQRSKEAAEGH--------NKRKL----ETLRLKIEL---DFQRHKDDHQRL-------
MAD1_DEBHA      ----------------------------------------------------------------------
K2C7_RAT        ----------------------------------------------------------------------
K2C7_MOUSE      ----------------------------------------------------------------------
K1C20_MOUSE     RQLGNNVNVEV-DAAPGLNLG--EIMNEMRQRYEVLAQKNL--QEAK---EQFERQSQTLQQ--------
HOOK_DROMO      KALREGQGGQT-----------------------------------------------------------
HAUS3_MOUSE     ----------------------------------------------------------------------
GG8L1_HUMAN     SVLSDVMATQKKKANQ---LSSPSKAGTEWKLEQSMREEALLKVQLTQLKESFQQLQLER----------
FBF1_CHICK      LLLDEA----------------------------------------------------------------
EDE1_YEAST      KTVEE-----------------------------------------------------------------
CTRO_HUMAN      ----------------------------------------------------------------------
CNPD_PELPD      ----------------------------------------------------------------------
CNPD_NITSB      KAEEES----------------------------------------------------------------
CNPD_CHLTE      KAREEA----------------------------------------------------------------
CING_MOUSE      AELDE-----------------------------------------------------------------
CI117_MOUSE     LALEEQLHRQ------------------------------------------------------------
CI117_HUMAN     HEFQETKDQLTTEN---IILGGKLAAEFRLQKEEVTDKFTLLEEQVRKQENEFR----------------
CASP_MOUSE      HSLQLASQIQKAP--------DVEQAIEVLTRSSLEVELAAKEREIAQLVEDVQRLQASLTKLR---ENS
CAO1B_XENLA     KMLMEEITDLNPPTLP------------------------------------------------------
BRE1_DEBHA      KVLNEALESERHETGDNSKISE-------LSKDELIQRINMLNSEIKEIEQAFQETREN-----------
BICD2_MOUSE     SQLEDAIRLK------------------------------------------------------------
BICD2_HUMAN     SQLEDAIRLK------------------------------------------------------------
AV71_ACAVI      YQLED-----------------------------------------------------------------
APOA1_CHICK     NLREK-----------------------------------------------------------------
ANR24_MOUSE     E---------------------------------------------------------------------
A16L1_MOUSE     KTTEENQELVT-----------------------------------------------------------
YIBP_ECOLI      E---------------------------------------------------------------------
YF82_SCHPO      SSLKDDKTVETKNDVPEVSRPSTDTIG-------------------------------------------
TNNT2_BOVIN     NRIND-----------------------------------------------------------------
TG278_CAEEL     KELDQVKTETNDKIRRLTEVTSQQQEEELRRKARLLTVVEAAKEKLESVISDLQVE--------------
STX4_RAT        RQLK------------------------------------------------------------------
STX4_MOUSE      RQLK------------------------------------------------------------------
SPTA2_HUMAN     RDVDETISW---IKEKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLS
SMC4_XENLA      ----------------------------------------------------------------------
ROCK1_RAT       QSIEEAKSV-------------------------------------------------------------
RIMB1_RAT       QVLE------------------------------------------------------------------
OPTN_HUMAN      RAVXXXXXXXXXXXXXXXXXXXXEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERAAREKIH------
NFM_RAT         ----------------------------------------------------------------------
MYOJ_DICDI      ETLK------------------------------------------------------------------
MYH4_PIG        EQIAE-----------------------------------------------------------------
MYH2_BOVIN      EQIAE-----------------------------------------------------------------
MYH1_HUMAN      HELEEA----------------------------------------------------------------
MYH11_RAT       ----------------------------------------------------------------------
MYH11_HUMAN     RELDEA----------------------------------------------------------------
MTUS1_PONAB     DALNEKL---------------------------------------------------------------
MCP3_SCHPO      ESLRE-----------------------------------------------------------------
LEKR1_HUMAN     EKLHKS----------------------------------------------------------------
LAML1_XENLA     ----------------------------------------------------------------------
KINH_HUMAN      SALKEA----------------------------------------------------------------
KI21B_MOUSE     ----------------------------------------------------------------------
KI21B_HUMAN     ----------------------------------------------------------------------
KI15A_XENLA     HSL-------------------------------------------------------------------
K1C10_HUMAN     KNHEEEMKDLRNVSTGDVNVEMNAAPGVDLTQNNMRSQYEQLAEQNRKDAEAWFNEKS--KELTTEIDNN
ESIP1_RAT       RLDTDRTNRSACNIAPPAAQSSRWKLPVLLR---------------------------------------
CUX1_HUMAN      HSLQLASQIQKAP--------DVEQAIEVLTRSSLEVELAAKEREIAQLVEDVQRLQASLTKLR---ENS
CTTB2_FELCA     ----------------------------------------------------------------------
CNPD_STAS1      ----------------------------------------------------------------------
CLPB_CHRVO      RTQVGAEEIAEVVS---RATGIPVSKMLTGEREKLLKMEDVLHQRV------------------------
CLIP2_MOUSE     DLSEETIRMKE----------TVEGLQDKLNKRDLTSQMDMLRAQVSALE--------------------
CK5P2_PANTR     ----------------------------------------------------------------------
CIP2A_HUMAN     EEKESLVKLQ------------------------------------------------------------
CCD57_MOUSE     ----------------------------------------------------------------------
CB039_HUMAN     ----------------------------------------------------------------------
CASP_PONAB      HSLQLASQIQKAP--------DVEQAIEVLTRSSLEVELAAKEREIAQLVEDVQRLQASLTKLR---ENS
CASP_HUMAN      HSLQLASQIQKAP--------DVEQAIEVLTRSSLEVELAAKEREIAQLVEDVQRLQASLTKLR---ENS
CACO1_MOUSE     ----------------------------------------------------------------------
ATK1_ARATH      SLLSEVTNLR------------------------------------------------------------
ATG11_ASPFU     KALEERMNLETEVQDAKQSAEQRESELAQVRGELAQEKEKLAAVQSELHDE-------------------
AP1_ARATH       ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           XXXXXXXXAQVTLSNAQLKAFKDEEKAREALRQQKRKAKASGERYHVEPHPEHLCGXXXXXXXXXXXXVP
TNIP1_HUMAN     XXXXXXXXAQVTLSNAQLKAFKDEEKAREALRQQKRKAKASGERYHVEPHPEHLCGXXXXXXXXXXXXVP
TNIP1_MOUSE     XXXXXXXXAQVTLTNXXXXXXXXXXXXXXXXXXXXXXXXXSGERYHMEPHPEHVCGXXXXXXXXXXXXXX
TNIP3_HUMAN     QQINETSQSQLNRLNSQIKA--------------------------------------------------
CEP55_RAT       LKELRKAKSQITQSLKQLHGFTFTEQPFPLQGEPENRVKATSPK--------------------------
CEP55_MOUSE     LKELRKAKSQITQSLKQLHGFTITEQPFPLQREPESRVKATSPK--------------------------
TPR_HUMAN       ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
CEP55_HUMAN     ----------------------------------------------------------------------
MPP9_MOUSE      ----------------------------------------------------------------------
HMMR_RAT        ----------------------------------------------------------------------
IMH1_YEAST      ----------------------------------------------------------------------
CCD46_HUMAN     ----------------------------------------------------------------------
CCD46_MOUSE     ----------------------------------------------------------------------
CCD41_HUMAN     ------LEAEKTLEEKQIQWLEEKHKLHERITDREEKYNQAKEK--------------------------
CC150_HUMAN     ----------------------------------------------------------------------
TNIP2_MOUSE     ----------------------------------------------------------------------
MOEH_ANOGA      ----------------------------------------------------------------------
CLIP1_HUMAN     MKMSGDNSSQLTKMNDELR-LKERDVEELQLKLTKANENAS-----------------------------
SPTB2_MOUSE     ----------------------------------------------------------------------
SPTB2_HUMAN     ----------------------------------------------------------------------
SMC3_RAT        ----------------------------------------------------------------------
SMC3_PONAB      ----------------------------------------------------------------------
SMC3_MOUSE      ----------------------------------------------------------------------
SMC3_HUMAN      ----------------------------------------------------------------------
SMC3_BOVIN      ----------------------------------------------------------------------
SYCP3_MOUSE     ----------------------------------------------------------------------
RUD3_YEAST      ----------------------------------------------------------------------
MYSP_DERFA      EIEALRKQYQIEIEQLNMRLAEAEAKLKTEIARLKKKYQA------------------------------
IFE_BRALA       ----------------------------------------------------------------------
FKB15_HUMAN     ----------------------------------------------------------------------
CTRO_MOUSE      ----------------------------------------------------------------------
CE290_DANRE     FSGALPLAQQEKFSNTMLHLQEDRARVRE-----------------------------------------
GOGA3_MOUSE     ----------------------------------------------------------------------
EZRI_RABIT      ----------------------------------------------------------------------
DMD_PIG         ----------------------------------------------------------------------
DMD_HUMAN       ----------------------------------------------------------------------
CP250_HUMAN     ----------------------------------------------------------------------
DIAP1_MOUSE     ----------------------------------------------------------------------
TNIP2_HUMAN     ----------------------------------------------------------------------
KIF15_RAT       ----------------------------------------------------------------------
MYH9_CHICK      ----------------------------------------------------------------------
USO1_YEAST      ----------------------------------------------------------------------
SPO15_SCHPO     ----------------------------------------------------------------------
M12_STRPY       ----------------------------------------------------------------------
CROCC_MOUSE     ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
QN1_RAT         ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
DMD_CANFA       ----------------------------------------------------------------------
CING_SORAR      ----------------------------------------------------------------------
CE164_HUMAN     ----------------------------------------------------------------------
SGM1_SCHPO      ----------------------------------------------------------------------
NF70_LOLPE      ----------------------------------------------------------------------
NF60_LOLPE      ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYO2_SCHPO      ----------------------------------------------------------------------
MYH8_MOUSE      ----------------------------------------------------------------------
GOGA5_RAT       ----------------------------------------------------------------------
GOGA5_HUMAN     ----------------------------------------------------------------------
GOGA4_HUMAN     ----------------------------------------------------------------------
FIL1L_HUMAN     ----------------------------------------------------------------------
TPM2_SCHMA      ----------------------------------------------------------------------
SYCP3_RAT       ----------------------------------------------------------------------
SMC4_DICDI      ----------------------------------------------------------------------
SAS6_DANRE      ----------------------------------------------------------------------
MLP1_YEAST      ----------------------------------------------------------------------
HMMR_MOUSE      ----------------------------------------------------------------------
CNPD_PELLD      ----------------------------------------------------------------------
PU92_SCICO      ----------------------------------------------------------------------
MYH8_HUMAN      ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
GCOM1_XENTR     ----------------------------------------------------------------------
CEP63_CHICK     ELEVERLNMRVDLTENNRMILEDQQRVAEELRQSKK----------------------------------
CC150_MOUSE     ----------------------------------------------------------------------
BPA1_HUMAN      ----------------------------------------------------------------------
ALM1_SCHPO      ----------------------------------------------------------------------
SYCP3_MESAU     ----------------------------------------------------------------------
MYH8_CANFA      ----------------------------------------------------------------------
MYH3_MOUSE      ----------------------------------------------------------------------
KIF7_HUMAN      ----------------------------------------------------------------------
KIF15_MOUSE     ----------------------------------------------------------------------
DMD_MOUSE       ----------------------------------------------------------------------
CUX2_HUMAN      ----------------------------------------------------------------------
CNPD_PROVI      ----------------------------------------------------------------------
APSB_EMENI      ----------------------------------------------------------------------
SAS6_CHICK      ----------------------------------------------------------------------
NUF1_YEAST      ----------------------------------------------------------------------
MYO1_CAEEL      ----------------------------------------------------------------------
MYH7_RAT        ----------------------------------------------------------------------
MYH7_PAPHA      ----------------------------------------------------------------------
MYH7_MOUSE      ----------------------------------------------------------------------
MYH7_MESAU      ----------------------------------------------------------------------
MYH7_HUMAN      ----------------------------------------------------------------------
MYH7_CANFA      ----------------------------------------------------------------------
MYH3_RAT        ----------------------------------------------------------------------
MYH3_HUMAN      ----------------------------------------------------------------------
MRCKB_HUMAN     ----------------------------------------------------------------------
MRCKA_HUMAN     ----------------------------------------------------------------------
MPP9_HUMAN      ----------------------------------------------------------------------
IMH1_ASHGO      ----------------------------------------------------------------------
IFA1_CAEEL      ----------------------------------------------------------------------
GRDN_MOUSE      ----------------------------------------------------------------------
GOGA3_HUMAN     ----------------------------------------------------------------------
GOGA1_HUMAN     ----------------------------------------------------------------------
FKB15_MOUSE     ----------------------------------------------------------------------
CP250_MOUSE     ----------------------------------------------------------------------
CGNL1_HUMAN     ----------------------------------------------------------------------
BRE1_ASPFU      ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
SWP70_CHICK     ----------------------------------------------------------------------
SMC2_HUMAN      ----------------------------------------------------------------------
NEMO_DROME      ----------------------------------------------------------------------
MRCKA_RAT       ----------------------------------------------------------------------
BRE1_CRYNE      ----------------------------------------------------------------------
TAXB1_PONAB     ----------------------------------------------------------------------
SMC1_YEAST      ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
MYH9_RAT        ----------------------------------------------------------------------
MYH9_MOUSE      ----------------------------------------------------------------------
MRCKB_MOUSE     ----------------------------------------------------------------------
GFAP_DANRE      ----------------------------------------------------------------------
GFAP_CARAU      ----------------------------------------------------------------------
EFG_ACIAC       ----------------------------------------------------------------------
EEA1_HUMAN      ----------------------------------------------------------------------
DAPLE_XENLA     ----------------------------------------------------------------------
CE290_HUMAN     ----------------------------------------------------------------------
CACO1_BOVIN     ----------------------------------------------------------------------
ANT1_ONCVO      QTAARNEIKLLTPTNSQLNAAEDKNSLNKVITDQQNKIRLTGEVHHLE----------------------
YNP9_CAEEL      ----------------------------------------------------------------------
VIME_RAT        ----------------------------------------------------------------------
VIME_MOUSE      ----------------------------------------------------------------------
VIME_MESAU      ----------------------------------------------------------------------
VIME_CRIGR      ----------------------------------------------------------------------
VIME_BOVIN      ----------------------------------------------------------------------
SPTCB_DROME     ----------------------------------------------------------------------
NIN_MOUSE       ----------------------------------------------------------------------
MYSN_DROME      ----------------------------------------------------------------------
MYSC_CHICK      LDDLQAEEDKVTLSKAKVKLEQQVDDLEGSLEQEKK----------------------------------
MYO2_CAEEL      ----------------------------------------------------------------------
MYH6_RAT        ----------------------------------------------------------------------
LIPA1_HUMAN     -----QMEAQLEEKNQELQRARQREKMNE-----------------------------------------
K1C9_HUMAN      ----------------------------------------------------------------------
HOOK3_MOUSE     ----------------------------------------------------------------------
HOOK3_HUMAN     ----------------------------------------------------------------------
HMW2_MYCGE      ----------------------------------------------------------------------
HIP1_HUMAN      ----------------------------------------------------------------------
GRDN_HUMAN      ----------------------------------------------------------------------
GPTC8_MOUSE     ----------------------------------------------------------------------
GPTC8_HUMAN     ----------------------------------------------------------------------
CP135_HUMAN     QEELSALRKESTQTTAPHNIVSLMEKEKELALSDLRRIMAEKE---------------------------
CNPD_CHLPD      ----------------------------------------------------------------------
CASC4_CHICK     ----------------------------------------------------------------------
WAP_ARATH       ----------------------------------------------------------------------
TAXB1_HUMAN     ----------------------------------------------------------------------
SYCP3_MACFA     ----------------------------------------------------------------------
ROCK2_MOUSE     ----------------------------------------------------------------------
NDE1_CHICK      ----------------------------------------------------------------------
MYH8_RAT        ----------------------------------------------------------------------
MYH7_PIG        ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
MYH6_HUMAN      ----------------------------------------------------------------------
MRCKA_MOUSE     ----------------------------------------------------------------------
LIPB1_MOUSE     ----------------------------------------------------------------------
KINH_DROME      ------LRCELPKLEKRLRCTMERVKALEALKEAKEGAMRDRKRYQYE----------------------
K1C9_RAT        ----------------------------------------------------------------------
GRIP_ARATH      ----------------------------------------------------------------------
GOGA1_MOUSE     ----------------------------------------------------------------------
FIL1L_MOUSE     ----------------------------------------------------------------------
EVI5L_HUMAN     ----------------------------------------------------------------------
DESP_HUMAN      ----------------------------------------------------------------------
CD158_HUMAN     ----------------------------------------------------------------------
CCHCR_MOUSE     ----------------------------------------------------------------------
CCD41_RAT       ----------------------------------------------------------------------
YOND_BACSU      ----------------------------------------------------------------------
VIME_ONCMY      ----------------------------------------------------------------------
SMC_BACSU       ----------------------------------------------------------------------
SMC2_XENLA      ----------------------------------------------------------------------
SKI_XENLA       ----------------------------------------------------------------------
SBCC_BACSU      ----------------------------------------------------------------------
RB6I2_HUMAN     ----------------------------------------------------------------------
PLST_CARAU      ----------------------------------------------------------------------
OPTN_CHICK      ----------------------------------------------------------------------
MYSP_MYTGA      ----------------------------------------------------------------------
MYSP_CAEEL      ----------------------------------------------------------------------
MYH6_MOUSE      ----------------------------------------------------------------------
MY18A_MOUSE     ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
KINH_SYNRA      ----------------------------------------------------------------------
EP15R_MOUSE     ----------------------------------------------------------------------
EEA1_MOUSE      DLDCQQLQARLTASESSLQRAQGEEKAEAALREELREVEST-----------------------------
CUT_CAEEL       ----------------------------------------------------------------------
CGNL1_MOUSE     --------ERITWSREQMEQMRSELLQEKAAKQDLECDKISLER--------------------------
CCD41_MOUSE     ----------------------------------------------------------------------
CCD18_HUMAN     ----------------------------------------------------------------------
CC151_BOVIN     ----------------------------------------------------------------------
CASP_CAEEL      ----------------------------------------------------------------------
ATG11_PICST     ----------------------------------------------------------------------
Y1002_CHLCV     ----------------------------------------------------------------------
VIME_PANTR      ----------------------------------------------------------------------
VIME_MACFA      ----------------------------------------------------------------------
VIME_HUMAN      ----------------------------------------------------------------------
VIME_CERAE      ----------------------------------------------------------------------
SMC2_MOUSE      ----------------------------------------------------------------------
OPTN_MOUSE      ----------------------------------------------------------------------
OPTN_DANRE      ATQLEYVKKQ----NSQLQE-EMESLGRHSMSEMQRRHVPRGANPQGPTAPNNLPG--------------
NDE1_HUMAN      ----------------------------------------------------------------------
MYO5C_HUMAN     ----------------------------------------------------------------------
MYH9_HUMAN      ----------------------------------------------------------------------
MYH9_CANFA      ----------------------------------------------------------------------
MYH13_HUMAN     ----------------------------------------------------------------------
EP15R_HUMAN     ----------------------------------------------------------------------
DZIP1_DANRE     ----------------------------------------------------------------------
DIAP1_HUMAN     ----------------------------------------------------------------------
CD158_MOUSE     ----------------------------------------------------------------------
SYCP3_HUMAN     ----------------------------------------------------------------------
MYS_AEQIR       ----------------------------------------------------------------------
MYH7_HORSE      ----------------------------------------------------------------------
MYH6_MESAU      ----------------------------------------------------------------------
MYH13_CANFA     ----------------------------------------------------------------------
MY18A_HUMAN     ----------------------------------------------------------------------
MOES_LYTVA      ----------------------------------------------------------------------
MLP2_YEAST      ----------------------------------------------------------------------
MFP1_ARATH      ----------------------------------------------------------------------
LRCC1_MOUSE     ----------------------------------------------------------------------
KIF7_DANRE      ----------------------------------------------------------------------
GOGA4_MOUSE     ----------------------------------------------------------------------
FLIP1_HUMAN     ----------------------------------------------------------------------
SGM1_YEAST      ----------------------------------------------------------------------
ROCK2_RAT       ----------------------------------------------------------------------
NDE1_XENTR      ----------------------------------------------------------------------
MYSP_BRUMA      ---------ELDLENARLTALKESEAARRDAENRAQRALAELQQLRI-----------------------
MYO1_YEAST      ----------------------------------------------------------------------
ITSN1_XENLA     ----------------------------------------------------------------------
GOGA5_MOUSE     ----------------------------------------------------------------------
GCC2_MOUSE      QVQKSFVKTQLYEYLKQLRASILEENEEE-----------------------------------------
GCC2_HUMAN      ----------------------------------------------------------------------
ETP1_YEAST      ----------------------------------------------------------------------
CTK2_XENLA      ----------------------------------------------------------------------
CC146_RAT       ---------------TQIKMEEKEQKAKDFLKSQRR----------------------------------
SPDLY_MACFA     ----------------------------------------------------------------------
RRBP1_MOUSE     ----------------------------------------------------------------------
RMUC_NEIMA      ----------------------------------------------------------------------
OPTN_XENLA      ----------------------------------------------------------------------
NUF2_EMENI      ----------------------------------------------------------------------
MYSP_SARSC      ----------------------------------------------------------------------
MYO4_CAEEL      ----------------------------------------------------------------------
MOEH_CULQU      ----------------------------------------------------------------------
MAD1_YARLI      ----------------------------------------------------------------------
KIF8_DICDI      ----------------------------------------------------------------------
KIF4_XENLA      ----------------------------------------------------------------------
K1C10_MOUSE     ----------------------------------------------------------------------
HOOK_AEDAE      LELNEQRSSQIDEAQSQMTQLHTKANLEAALAAKDQELLAADSRY-------------------------
DCTN1_CHICK     ----------------------------------------------------------------------
CENPE_MOUSE     EAKKELKEQGLTLSKIEMENLNLAQKIHENLEEMKSVRK-------------------------------
CD72_HUMAN      ----------------------------------------------------------------------
CCD68_HUMAN     ----------------------------------------------------------------------
CACO1_DANRE     ----------------------------------------------------------------------
ANR26_HUMAN     ----------------------------------------------------------------------
XNIF_XENLA      ----------------------------------------------------------------------
TRIPB_HUMAN     ----------------------------------------------------------------------
TPM_MIMNO       ----------------------------------------------------------------------
ROCK2_HUMAN     ----------------------------------------------------------------------
PMFBP_MOUSE     ----------------------------------------------------------------------
ODFP2_CHICK     ----------------------------------------------------------------------
NU211_SCHPO     ----------------------------------------------------------------------
NMCP_ARATH      ----------------------------------------------------------------------
NDC80_NEUCR     ----------------------------------------------------------------------
MYSU_RABIT      ----------------------------------------------------------------------
MYSP_ONCVO      ---------ELDLENARLTALKESEAARRDAENRAQRALAELQQLRI-----------------------
KIF15_HUMAN     ----------------------------------------------------------------------
KI20B_MOUSE     ----------------------------------------------------------------------
K1C15_PROAT     ----------------------------------------------------------------------
HOOK_CULQU      LELNEQRSSQIDEAQSQMGQLQAKANLESALVAKEQDLLAADTRY-------------------------
HOOK2_HUMAN     ----------------------------------------------------------------------
FBF1_HUMAN      ----------------------------------------------------------------------
CUX1_MOUSE      ----------------------------------------------------------------------
CTGE5_MOUSE     ----------------------------------------------------------------------
CT2NL_PONAB     ----------------------------------------------------------------------
CT2NL_HUMAN     ----------------------------------------------------------------------
CROL2_HUMAN     ----------------------------------------------------------------------
CNTLN_HUMAN     ----------------------------------------------------------------------
CING_CANFA      ----------------------------------------------------------------------
YD72_SCHPO      ----------------------------------------------------------------------
WIT2_ARATH      ----------------------------------------------------------------------
TANA_XENLA      ----------------------------------------------------------------------
STX4_BOVIN      ----------------------------------------------------------------------
ROCK1_BOVIN     ----------------------------------------------------------------------
RAD50_SULSO     ----------------------------------------------------------------------
PLPA_MYCGA      ----------------------------------------------------------------------
NIN_HUMAN       ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYSP_DIRIM      ----------------------------------------------------------------------
MYSP_BLOTA      ----------------------------------------------------------------------
MTS1A_DANRE     ----------------------------------------------------------------------
MEU1_SCHPO      ----------------------------------------------------------------------
MBO1_SCHPO      ----------------------------------------------------------------------
KIFC1_MOUSE     ----------------------------------------------------------------------
HOOK3_XENLA     ----------------------------------------------------------------------
HOOK1_CHICK     ----------------------------------------------------------------------
GCOM1_HUMAN     ----QLEVAQVENQLLKMKVESSQEANAEVMREMTKKLYSQYEEKLQEEQRKH-----------------
FBF1_MOUSE      ----------------------------------------------------------------------
CYTSA_TAKRU     ----------------------------------------------------------------------
CCD91_RAT       ----------------------------------------------------------------------
ATG11_NEUCR     ----------------------------------------------------------------------
YOMI_BACSU      ----------------------------------------------------------------------
YG3A_YEAST      ----------------------------------------------------------------------
SPDLY_HUMAN     ----------------------------------------------------------------------
SPC25_CANAL     ----------------------------------------------------------------------
ROCK2_BOVIN     ----------------------------------------------------------------------
RMUC_NEIMB      ----------------------------------------------------------------------
NUF2_ASPFU      ----------------------------------------------------------------------
NEMO_RAT        ----------------------------------------------------------------------
NDE1_RAT        ----------------------------------------------------------------------
MYSS_RABIT      ----------------------------------------------------------------------
MYSP_BOOMI      ----------------------------------------------------------------------
MIX1_CAEEL      ----------------------------------------------------------------------
LRC45_MOUSE     ----------------------------------------------------------------------
KINH_RAT        ----------------------------------------------------------------------
KIF4_CHICK      ----------------------------------------------------------------------
KI20B_HUMAN     ----------------------------------------------------------------------
K1C9_CANFA      ----------------------------------------------------------------------
K1C10_CANFA     ----------------------------------------------------------------------
IFEB_ASCSU      ----------------------------------------------------------------------
HMMR_HUMAN      ----------------------------------------------------------------------
GAS8_BOVIN      ----------------------------------------------------------------------
FIP37_ARATH     ----------------------------------------------------------------------
CCD18_MOUSE     ----------------------------------------------------------------------
APOA1_COTJA     ----------------------------------------------------------------------
Y451_HELPY      ----------------------------------------------------------------------
VIMB_CARAU      ----------------------------------------------------------------------
SYCP1_MESAU     ----------------------------------------------------------------------
STAT3_RAT       ----------------------------------------------------------------------
STAT3_PIG       ----------------------------------------------------------------------
STAT3_MOUSE     ----------------------------------------------------------------------
STAT3_HUMAN     ----------------------------------------------------------------------
RUFY2_PONAB     ----------------------------------------------------------------------
RUFY2_HUMAN     ----------------------------------------------------------------------
PIBF1_HUMAN     ----------------------------------------------------------------------
PHLB2_MOUSE     ----------------------------------------------------------------------
PHLB2_HUMAN     ----------------------------------------------------------------------
ODFP2_RAT       ----------------------------------------------------------------------
ODF2L_MOUSE     ----------------------------------------------------------------------
NDL1A_XENLA     ----------------------------------------------------------------------
MYS3_HYDAT      ----------------------------------------------------------------------
LAMB4_DANRE     ----------------------------------------------------------------------
KTN1_CHICK      ----------------------------------------------------------------------
KIF5C_MOUSE     ------LRCELPKLEKRLRATAERVKALEALKEAKENAMRDRKRYQQE----------------------
KIF4_MOUSE      ----------------------------------------------------------------------
KIF27_MOUSE     ----------------------------------------------------------------------
K1C20_RAT       ----------------------------------------------------------------------
K1C10_BOVIN     ----------------------------------------------------------------------
F184B_HUMAN     ----------------------------------------------------------------------
EFG_AZOSB       ----------------------------------------------------------------------
DCTN1_DROME     ----------------------------------------------------------------------
CNPD_ARCB4      ----------------------------------------------------------------------
CLIP1_MOUSE     ----------------------------------------------------------------------
CENPJ_PANTR     ----------------------------------------------------------------------
CENPF_HUMAN     ----------------------------------------------------------------------
CENPE_HUMAN     ----------------------------------------------------------------------
CE290_BOVIN     ----------------------------------------------------------------------
CCPG1_CHICK     ----------------------------------------------------------------------
CC147_HUMAN     ----------------------------------------------------------------------
CACO1_RAT       ----------------------------------------------------------------------
C3H41_ARATH     ----------------------------------------------------------------------
BRE1_ASHGO      ----------------------------------------------------------------------
ATG16_XENTR     ----------------------------------------------------------------------
YQOE_CAEEL      ----------------------------------------------------------------------
Y4A0_ENCCU      ----------------------------------------------------------------------
TIG_PROM5       ----------------------------------------------------------------------
TAXB1_RAT       ----------------------------------------------------------------------
SYGP1_HUMAN     ----------------------------------------------------------------------
SYCP1_HUMAN     ----------------------------------------------------------------------
STAT3_CHICK     ----------------------------------------------------------------------
SMC6_MOUSE      ----------------------------------------------------------------------
SLMAP_HUMAN     ITSTRDELLSLLLHQAAAKVASERDTDIASLQEELKKVRAELERW-------------------------
QN1_HUMAN       ----------------------------------------------------------------------
OPTN_RAT        ----------------------------------------------------------------------
ODFP2_MOUSE     ----------------------------------------------------------------------
NEMO_BOVIN      ----------------------------------------------------------------------
NDEL1_XENTR     ----------------------------------------------------------------------
MYH2_PIG        ----------------------------------------------------------------------
MYH10_RAT       ----------------------------------------------------------------------
MYH10_MOUSE     ----------------------------------------------------------------------
KIF1_DICDI      ----------------------------------------------------------------------
GRAP1_RAT       ----------------------------------------------------------------------
FAT1_SCHPO      ----------------------------------------------------------------------
DIXC1_RAT       ----------------------------------------------------------------------
DCTN1_XENLA     ----------------------------------------------------------------------
CTTB2_RABIT     ----------------------------------------------------------------------
CLPB_HELPY      ----------------------------------------------------------------------
CEP63_PONAB     ----------------------------------------------------------------------
CEP63_MACFA     ----------------------------------------------------------------------
CEP63_HUMAN     ----------------------------------------------------------------------
CENPC_HUMAN     IPRKAGSLKQRTISPAESTALFQGRKSREKHHNILPKTLANDKHSH-KPHP-------------------
CCD69_XENTR     ----------------------------------------------------------------------
CACO2_BOVIN     ----------------------------------------------------------------------
BFR1_YEAST      ----------------------------------------------------------------------
AKAP9_HUMAN     ----------------------------------------------------------------------
AGLZ_MYXXD      ----------------------------------------------------------------------
ZIP1_YEAST      ----------------------------------------------------------------------
YB145_PLAF7     ----------------------------------------------------------------------
YA046_HUMAN     ----------------------------------------------------------------------
VIME_CHICK      ----------------------------------------------------------------------
UACA_HUMAN      ----------------------------------------------------------------------
TNNT2_RAT       ----------------------------------------------------------------------
T4AF1_HUMAN     ----------------------------------------------------------------------
SYCP1_MOUSE     ----------------------------------------------------------------------
RFIP4_MOUSE     ----------------------------------------------------------------------
RAD50_THEAC     IGKIED---EVRLLEPQIKLAEDLKRQRETLREKVKDLRS------------------------------
RAD50_ARATH     ----------------------------------------------------------------------
PUMA_PARUN      CAQLQQQIAQLEMDNGE-----------------------------------------------------
PFDA_IGNH4      ----------------------------------------------------------------------
MYO5A_HUMAN     ----------------------------------------------------------------------
MYH10_HUMAN     ----------------------------------------------------------------------
MYH10_BOVIN     ----------------------------------------------------------------------
MD1L1_MOUSE     ----------------------------------------------------------------------
KIF15_STRPU     ----------------------------------------------------------------------
KI21A_HUMAN     ----------------------------------------------------------------------
GOGA2_HUMAN     ----------------------------------------------------------------------
EVI5_HUMAN      ----------------------------------------------------------------------
CING_XENTR      ----------------------------------------------------------------------
CING_XENLA      ----------------------------------------------------------------------
CI117_RAT       ----------------------------------------------------------------------
CC146_HUMAN     ----------------------------------------------------------------------
CAR14_HUMAN     ----------------------------------------------------------------------
BPAEA_MOUSE     ----------------------------------------------------------------------
ZWINT_RAT       ----------------------------------------------------------------------
ZWINT_MOUSE     ----------------------------------------------------------------------
YM92_CAEEL      ----------------------------------------------------------------------
YL139_YARLI     ----------------------------------------------------------------------
YA046_MOUSE     ----------------------------------------------------------------------
VIM4_XENLA      ----------------------------------------------------------------------
SYS_SYNE7       ----------------------------------------------------------------------
SYS_DESHY       ----------------------------------------------------------------------
SYCP2_MOUSE     ----------------------------------------------------------------------
SPC24_HUMAN     ----------------------------------------------------------------------
SHE9_ASHGO      ----------------------------------------------------------------------
RIMB1_HUMAN     ----------------------------------------------------------------------
RHG17_RAT       ----------------------------------------------------------------------
RHG17_MOUSE     ----------------------------------------------------------------------
P54_ENTFC       ----------------------------------------------------------------------
ODFP2_HUMAN     ----------------------------------------------------------------------
NFM_PIG         ----------------------------------------------------------------------
NFM_HUMAN       ----------------------------------------------------------------------
NDE1_DROME      ----------------------------------------------------------------------
MYH2_HUMAN      ----------------------------------------------------------------------
MYH2_HORSE      ----------------------------------------------------------------------
MTUS1_MOUSE     ----------------------------------------------------------------------
MEDB_GIALA      ----------------------------------------------------------------------
LCA5L_PAPAN     ----------------------------------------------------------------------
KLPA_EMENI      ----------------------------------------------------------------------
K1C10_RAT       ----------------------------------------------------------------------
HOOK_BRAFL      ----------------------------------------------------------------------
GAS8_RAT        ----------------------------------------------------------------------
EZRA_BACLD      ----------------------------------------------------------------------
EFG_YERPY       ----------------------------------------------------------------------
EFG_YERPS       ----------------------------------------------------------------------
EFG_YERPP       ----------------------------------------------------------------------
EFG_YERPN       ----------------------------------------------------------------------
EFG_YERPG       ----------------------------------------------------------------------
EFG_YERPE       ----------------------------------------------------------------------
EFG_YERPB       ----------------------------------------------------------------------
EFG_YERPA       ----------------------------------------------------------------------
EFG_YERP3       ----------------------------------------------------------------------
DEFI6_XENLA     ----------------------------------------------------------------------
CWLO_BACSU      ----------------------------------------------------------------------
CP135_DANRE     ----------------------------------------------------------------------
CK5P2_HUMAN     ----------------------------------------------------------------------
CCD93_XENTR     ----------------------------------------------------------------------
ATPF_DESDG      ----------------------------------------------------------------------
YDEM_CAEEL      ----------------------------------------------------------------------
YBAC_SCHPO      ----------------------------------------------------------------------
Y4862_ARATH     ----------------------------------------------------------------------
Y147_TNAVC      ----------------------------------------------------------------------
VIM1_XENLA      ----------------------------------------------------------------------
UACA_BOVIN      ----------------------------------------------------------------------
TMF1_MOUSE      ----------------------------------------------------------------------
TAXB1_BOVIN     ----------------------------------------------------------------------
ROCK1_RABIT     ----------------------------------------------------------------------
RBCC1_MOUSE     ----------------------------------------------------------------------
NFM_MOUSE       ----------------------------------------------------------------------
NFM_BOVIN       ----------------------------------------------------------------------
NDE1B_XENLA     ----------------------------------------------------------------------
NDC80_ASHGO     ----------------------------------------------------------------------
MYSP_ANISI      ----------------------------------------------------------------------
MYSA_DROME      ----------------------------------------------------------------------
MYH2_CANFA      ----------------------------------------------------------------------
MYH11_MOUSE     ----------------------------------------------------------------------
MIP1_ARATH      ----------------------------------------------------------------------
MAD1_DEBHA      ----------------------------------------------------------------------
K2C7_RAT        ----------------------------------------------------------------------
K2C7_MOUSE      ----------------------------------------------------------------------
K1C20_MOUSE     ---------QVTVNTEELKGFE------------------------------------------------
HOOK_DROMO      ----------------------------------------------------------------------
HAUS3_MOUSE     ----------------------------------------------------------------------
GG8L1_HUMAN     ----------------------------------------------------------------------
FBF1_CHICK      ----------------------------------------------------------------------
EDE1_YEAST      ----------------------------------------------------------------------
CTRO_HUMAN      ----------------------------------------------------------------------
CNPD_PELPD      ----------------------------------------------------------------------
CNPD_NITSB      ----------------------------------------------------------------------
CNPD_CHLTE      ----------------------------------------------------------------------
CING_MOUSE      ----------------------------------------------------------------------
CI117_MOUSE     ----------------------------------------------------------------------
CI117_HUMAN     ----------------------------------------------------------------------
CASP_MOUSE      ASQISQLEQQLNAKNSTLKQLEEKLKGQADYEEVKKE---------------------------------
CAO1B_XENLA     ----------------------------------------------------------------------
BRE1_DEBHA      ----------------------------------------------------------------------
BICD2_MOUSE     ----------------------------------------------------------------------
BICD2_HUMAN     ----------------------------------------------------------------------
AV71_ACAVI      ----------------------------------------------------------------------
APOA1_CHICK     ----------------------------------------------------------------------
ANR24_MOUSE     ----------------------------------------------------------------------
A16L1_MOUSE     ----------------------------------------------------------------------
YIBP_ECOLI      ----------------------------------------------------------------------
YF82_SCHPO      ----------------------------------------------------------------------
TNNT2_BOVIN     ----------------------------------------------------------------------
TG278_CAEEL     ----------------------------------------------------------------------
STX4_RAT        ----------------------------------------------------------------------
STX4_MOUSE      ----------------------------------------------------------------------
SPTA2_HUMAN     ATQIQVKREELITNWEQIRTLAAERHAR------------------------------------------
SMC4_XENLA      ----------------------------------------------------------------------
ROCK1_RAT       ----------------------------------------------------------------------
RIMB1_RAT       ----------------------------------------------------------------------
OPTN_HUMAN      ----------------------------------------------------------------------
NFM_RAT         ----------------------------------------------------------------------
MYOJ_DICDI      ----------------------------------------------------------------------
MYH4_PIG        ----------------------------------------------------------------------
MYH2_BOVIN      ----------------------------------------------------------------------
MYH1_HUMAN      ----------------------------------------------------------------------
MYH11_RAT       ----------------------------------------------------------------------
MYH11_HUMAN     ----------------------------------------------------------------------
MTUS1_PONAB     ----------------------------------------------------------------------
MCP3_SCHPO      ----------------------------------------------------------------------
LEKR1_HUMAN     ----------------------------------------------------------------------
LAML1_XENLA     ----------------------------------------------------------------------
KINH_HUMAN      ----------------------------------------------------------------------
KI21B_MOUSE     ----------------------------------------------------------------------
KI21B_HUMAN     ----------------------------------------------------------------------
KI15A_XENLA     ----------------------------------------------------------------------
K1C10_HUMAN     IEQISSYKSEITELRRNVQALEI