[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for huge0:KIAA0348

[Show Plain Result]


## Summary of Sequence Search
    1::1443
   54::1496      0.0 100% 1496 aa  SYNJ2_HUMAN RecName: Full=Synaptojanin-2;       
   54::1434      0.0  81% 1434 aa  SYNJ2_MOUSE RecName: Full=Synaptojanin-2;       
   54::1496      0.0  85% 1496 aa  SYNJ2_RAT RecName: Full=Synaptojanin-2;         EC=3.1.3.36;AltName:
   53::1024      0.0  55% 1573 aa  SYNJ1_HUMAN RecName: Full=Synaptojanin-1;       
   53::1024      0.0  55% 1574 aa  SYNJ1_MOUSE RecName: Full=Synaptojanin-1;       
   53::1060      0.0  52% 1324 aa  SYNJ1_BOVIN RecName: Full=Synaptojanin-1;       
   53::1024      0.0  55% 1574 aa  SYNJ1_RAT RecName: Full=Synaptojanin-1;         EC=3.1.3.36;AltName:
   60::865     e-115  38% 1076 aa  SYJ1_SCHPO RecName: Full=Inositol-1,4,5-trisphosphate 5-phosphatase
  167::889     e-109  39% 1183 aa  INP52_YEAST RecName: Full=Inositol-1,4,5-trisphosphate
   59::878     e-105  38% 1107 aa  INP53_YEAST RecName: Full=Inositol-1,4,5-trisphosphate
  107::828     1e-71  33%  946 aa  INP51_YEAST RecName: Full=Inositol-1,4,5-trisphosphate
  268::862     8e-68  32%  889 aa  SYJ2_SCHPO RecName: Full=Inositol-1,4,5-trisphosphate 5-phosphatase
  227::549     8e-60  40%  901 aa  OCRL_HUMAN RecName: Full=Inositol polyphosphate 5-phosphatase
  309::677     8e-55  37%  993 aa  I5P2_HUMAN RecName: Full=Type II inositol-1,4,5-trisphosphate
   57::498     1e-45  34%  586 aa  SAC1_XENLA RecName: Full=Phosphatidylinositide phosphatase SAC1;   
  446::723     1e-44  36% 1003 aa  PI5PA_MOUSE RecName: Full=Phosphatidylinositol 4,5-bisphosphate
  451::721     6e-44  36% 1001 aa  PI5PA_RAT RecName: Full=Phosphatidylinositol 4,5-bisphosphate
   77::161     1e-43  42%  617 aa  IP5P3_ARATH RecName: Full=Type I inositol-1,4,5-trisphosphate
  171::566     1e-43  35% 1120 aa  SAC2_DANRE RecName: Full=Phosphatidylinositide phosphatase SAC2;   
   49::488     3e-43  32%  581 aa  SAC1_DICDI RecName: Full=Phosphatidylinositide phosphatase SAC1;   
  458::726     3e-43  36% 1006 aa  PI5PA_HUMAN RecName: Full=Phosphatidylinositol 4,5-bisphosphate
   58::517     2e-42  33%  587 aa  SAC1_RAT RecName: Full=Phosphatidylinositide phosphatase SAC1;     
   58::520     2e-42  32%  587 aa  SAC1_BOVIN RecName: Full=Phosphatidylinositide phosphatase SAC1;   
   58::499     3e-42  32%  587 aa  SAC1_MOUSE RecName: Full=Phosphatidylinositide phosphatase SAC1;   
   53::495     1e-41  33%  611 aa  YF51_SCHPO RecName: Full=Uncharacterized protein C3C7.01c;
  333::568     2e-41  41%  590 aa  IP5P1_ARATH RecName: Full=Type I inositol-1,4,5-trisphosphate
   58::499     3e-41  32%  587 aa  SAC1_PONAB RecName: Full=Phosphatidylinositide phosphatase SAC1;   
   58::499     4e-41  32%  587 aa  SAC1_HUMAN RecName: Full=Phosphatidylinositide phosphatase SAC1;   
  171::565     1e-40  36% 1132 aa  SAC2_MOUSE RecName: Full=Phosphatidylinositide phosphatase SAC2;   
  171::565     1e-40  36% 1132 aa  SAC2_HUMAN RecName: Full=Phosphatidylinositide phosphatase SAC2;   
   58::507     2e-40  33%  586 aa  SAC1A_DANRE RecName: Full=Phosphatidylinositide phosphatase SAC1-A;
   63::499     3e-39  36%  592 aa  SAC1_DROME RecName: Full=Phosphatidylinositide phosphatase SAC1;   
  532::901     3e-38  35% 1101 aa  IP5P4_ARATH RecName: Full=Type II inositol-1,4,5-trisphosphate
  776::1174    2e-37  34% 1191 aa  YE8A_SCHPO RecName: Full=Probable inositol polyphosphate
  407::898     2e-37  31% 1257 aa  SHIP2_MOUSE RecName: Full=Phosphatidylinositol-3,4,5-trisphosphate
   58::498     3e-37  30%  586 aa  SAC1B_DANRE RecName: Full=Phosphatidylinositide phosphatase SAC1-B;
  300::599     3e-37  36%  647 aa  INP5E_MOUSE RecName: Full=72 kDa inositol polyphosphate
  390::881     4e-37  29% 1266 aa  SHP2A_DANRE RecName: Full=Phosphatidylinositol-3,4,5-trisphosphate
  407::898     4e-37  31% 1257 aa  SHIP2_RAT RecName: Full=Phosphatidylinositol-3,4,5-trisphosphate
  323::712     4e-37  33% 1189 aa  SHIP1_HUMAN RecName: Full=Phosphatidylinositol-3,4,5-trisphosphate
  300::599     4e-37  37%  647 aa  INP5E_RAT RecName: Full=72 kDa inositol polyphosphate
  406::897     2e-36  30% 1258 aa  SHIP2_HUMAN RecName: Full=Phosphatidylinositol-3,4,5-trisphosphate
  386::678     5e-36  35% 1226 aa  SHP2B_DANRE RecName: Full=Phosphatidylinositol-3,4,5-trisphosphate
   51::489     6e-36  32%  598 aa  YG23_SCHPO RecName: Full=Uncharacterized protein C19F5.03;       
  381::622     2e-35  38%  646 aa  IP5P2_ARATH RecName: Full=Type I inositol-1,4,5-trisphosphate
  326::715     5e-35  33% 1191 aa  SHIP1_MOUSE RecName: Full=Phosphatidylinositol-3,4,5-trisphosphate
  317::706     2e-34  34% 1019 aa  SHIP1_XENLA RecName: Full=Phosphatidylinositol-3,4,5-trisphosphate
   50::504     2e-34  33%  623 aa  SAC1_YEAST RecName: Full=Phosphoinositide phosphatase SAC1;        
  558::929     3e-34  32% 1136 aa  IP5PD_ARATH RecName: Full=Type I inositol-1,4,5-trisphosphate
  297::596     6e-34  37%  644 aa  INP5E_PANTR RecName: Full=72 kDa inositol polyphosphate
  559::940     8e-34  33% 1305 aa  IP5PC_ARATH RecName: Full=Type I inositol-1,4,5-trisphosphate
  297::596     8e-34  37%  644 aa  INP5E_HUMAN RecName: Full=72 kDa inositol polyphosphate
  567::938     2e-33  31% 1144 aa  IP5PE_ARATH RecName: Full=Type II inositol-1,4,5-trisphosphate
  103::341     2e-31  32%  468 aa  INP5K_MOUSE RecName: Full=Inositol polyphosphate 5-phosphatase K;  
  325::714     4e-31  31% 1190 aa  SHIP1_RAT RecName: Full=Phosphatidylinositol-3,4,5-trisphosphate
   47::323     4e-30  32%  448 aa  INP5K_HUMAN RecName: Full=Inositol polyphosphate 5-phosphatase K;  
   67::325     5e-28  37%  334 aa  IP5PB_ARATH RecName: Full=Type I inositol-1,4,5-trisphosphate
   99::576     3e-23  30%  879 aa  FIG4_YEAST RecName: Full=Polyphosphoinositide phosphatase;       
   81::572     8e-23  30%  828 aa  YLE3_SCHPO RecName: Full=Uncharacterized protein C1093.03;       
   57::301     2e-19  31%  398 aa  YLJ7_CAEEL RecName: Full=Uncharacterized protein C50C3.7;       
   88::595     9e-14  39%  907 aa  FIG4_MOUSE RecName: Full=Polyphosphoinositide phosphatase;       
   88::595     4e-13  37%  907 aa  FIG4_HUMAN RecName: Full=Polyphosphoinositide phosphatase;       
   46::285     1e-12  27%  384 aa  INP54_YEAST RecName: Full=Inositol-1,4,5-trisphosphate
  202::283     4e-04  35%  611 aa  GLMS_PSEPK RecName: Full=Glucosamine--fructose-6-phosphate
    1::1443

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           YGKLTDAYGCLGELRLKSGGTSLSFLVLVTGCTSVGRIPDAEIYKITATDFYPLQEEAKEEERLIALKKI
SYNJ2_HUMAN     YGKLTDAYGCLGELRLKSGGTSLSFLVLVTGCTSVGRIPDAEIYKITATDFYPLQEEAKEEERLIALKKI
SYNJ2_MOUSE     YSKLTDAYGCLGELRLQSGGVPLSFLVLVTGCMSVGRIPDAEIYKITATELYPLQEEAKEEDRLPTLKKI
SYNJ2_RAT       YGKPTDAYGCLGELSLKSGGVPLSFLVLVTGCTSVGRIPDAEIYKITGTEFYPLQEEAKEEDRLPALKKI
SYNJ1_HUMAN     YSKVLDAYGLLGVLRLNLGDTMLHYLVLVTGCMSVGKIQESEVFRVTSTEFISLRIDSSDEDRISEVRKV
SYNJ1_MOUSE     YAKVLDAYGLLGVLRLNLGDTMLHYLVLVTGCMSVGKIQESEVFRVTSTEFISLRVDASDEDRISEVRKV
SYNJ1_BOVIN     YSKVLDAYGLLGVLRLNLGDIMLHYLVLVTGCMSVGKIQESEVFRVTSTEFISLRVDSSDEDRISEVRKV
SYNJ1_RAT       YAKVLDAYGLLGVLRLNLGDTMLHYLVLVTGCMSVGKIQESEVFRVTSTEFISLRVDASDEDRISEVRKV
SYJ1_SCHPO      -------YGTLGLIELEGS----NFLCVISGASEVARVRDKEVFRIMEVCFYSVNDHIRQEEPFSSLRKL
INP52_YEAST     ------------------------------------------------------------------LRKL
INP53_YEAST     -----EIFGVIGLIEVNG----LLFVGAITGKSKVAQCPGETVNKIFAVDFYPVLPETASTEYQDALKKL
INP51_YEAST     --------------------------------------PSESIYKVLDVDFYSLENDVQNYDKLIPLKKL
SYJ2_SCHPO      ----------------------------------------------------------------------
OCRL_HUMAN      ----------------------------------------------------------------------
I5P2_HUMAN      ----------------------------------------------------------------------
SAC1_XENLA      -------YGILGTIRLVAG----MYLIVITRRKKVGDLLNHSIWKATDFDIISYKKQLQDNKAFLGLSHV
PI5PA_MOUSE     ----------------------------------------------------------------------
PI5PA_RAT       ----------------------------------------------------------------------
IP5P3_ARATH     ----------------------------------------------------------------------
SAC2_DANRE      ----------------------------------------------------------------------
SAC1_DICDI      --RIENVKGIIGCIQLVSG----HYLMIFKEHNHVATVTGKKIYQMKDVELIPIPDQDAEEQHLSMIRWL
PI5PA_HUMAN     ----------------------------------------------------------------------
SAC1_RAT        -------YGIMGTIHLVAG----NYLVVITKKMKVGEFFNHVIWKATDFDVLSYKKQLQDNKTFLALNHV
SAC1_BOVIN      -------FGILGTIHLVAG----NYLIVITKKKKIGEFFNHVIWKATDFDVLSYKKQLQDNKTFLAMMNV
SAC1_MOUSE      -------FGILGTIHLVAG----NYLVVITKKMKVGRATDFDVLSYKKTMLHLTDIQLQDNKTFLALNHV
YF51_SCHPO      -----------GFIRLKI----YKYVVLVTSCDLHAAILGNNIYRARKFAIFPITRNIKDEEELSLLNKH
IP5P1_ARATH     ----------------------------------------------------------------------
SAC1_PONAB      -------FGILGTIHLVAG----NYLIVITKKIKVGEFFSHVIWKATDFDVLSYKKQLQDNKTFLALNHV
SAC1_HUMAN      -------FGILGTIHLVAG----NYLIVITKKIKVGEFFSHVVWKATDFDVLSYKKQLQDNKTFLALNHV
SAC2_MOUSE      ----------------------------------------------------------------------
SAC2_HUMAN      ----------------------------------------------------------------------
SAC1A_DANRE     --------GIMGTIRLVAG----VYLIVITKKKKVGDLLGHAVWKASDFDIISLTDNQMQDNKLSMLNSV
SAC1_DROME      --------GVLGTIHL----LSCDYLLVATHRLFVGVLNGAVVWRLAGYDYIPNSFQRKENENYLRLRQT
IP5P4_ARATH     ----------------------------------------------------------------------
YE8A_SCHPO      ----------------------------------------------------------------------
SHIP2_MOUSE     ----------------------------------------------------------------------
SAC1B_DANRE     --------GVMGTVRLVAG----MYLIVITRKRKVGDLFGHTVWKAVEFDVISYKKTIDNKTFLTMINNV
INP5E_MOUSE     ----------------------------------------------------------------------
SHP2A_DANRE     ----------------------------------------------------------------------
SHIP2_RAT       ----------------------------------------------------------------------
SHIP1_HUMAN     ----------------------------------------------------------------------
INP5E_RAT       ----------------------------------------------------------------------
SHIP2_HUMAN     ----------------------------------------------------------------------
SHP2B_DANRE     ----------------------------------------------------------------------
YG23_SCHPO      -----------GSIKLKKD----KYLILATEKSSAAQILGHKIYRVHKFEVIPLADDQDELDLYNLLQNH
IP5P2_ARATH     ----------------------------------------------------------------------
SHIP1_MOUSE     ----------------------------------------------------------------------
SHIP1_XENLA     ----------------------------------------------------------------------
SAC1_YEAST      -GEVVKIASLMGFIKLKLN----RYAIIANTVEETGRFNGHVFYRIVSTKFNS-RIDSEEAEYIKLLELH
IP5PD_ARATH     ----------------------------------------------------------------------
INP5E_PANTR     ----------------------------------------------------------------------
IP5PC_ARATH     ----------------------------------------------------------------------
INP5E_HUMAN     ----------------------------------------------------------------------
IP5PE_ARATH     ----------------------------------------------------------------------
INP5K_MOUSE     ----------------------------------------------------------------------
SHIP1_RAT       ----------------------------------------------------------------------
INP5K_HUMAN     ----------------------------------------------------------------------
IP5PB_ARATH     ----------------------------------------------------------------------
FIG4_YEAST      --KKITGYGLLGFIKF----TCWYYLIMVTKYSQVAXXXXXXXXXXXXTNNYKKPEKSSDEARLLNIFKD
YLE3_SCHPO      ---VTKAYAILGLFRFTAG----YYLYLCTERKVVAVIGGHNVYHVDKTQFIELNPSRRHNTSVERIEKV
YLJ7_CAEEL      ----------------------------------------------------------------------
FIG4_MOUSE      --RAVSAFGVVGFVRFLEG----YYIVLITKRRKMADIGGHAIYKIEDTSMIYIPNDSDEARYLRIFQNV
FIG4_HUMAN      --RAVSAFGVVGFVRFLEG----YYIVLITKRRKMADIGGHAIYKVEDTNMIYIPNDSDEARYLRIFQNV
INP54_YEAST     ----------------------------------------------------------------------
GLMS_PSEPK      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LSSGVFYFSWPNDGSRFDLTVRTQKQGDDSSEWGNSFFWNQLLHVPLRQHQVSCCDWLLKIICGVVTIRT
SYNJ2_HUMAN     LSSGVFYFSWPNDGSRFDLTVRTQKQGDDSSEWGNSFFWNQLLHVPLRQHQVSCCDWLLKIICGVVTIRT
SYNJ2_MOUSE     LSSGVFYFAWPNDGACFDLTIRAQKQGDDGSEWGTSFFWNQLLHVPLRQHQVNCHNWLLKVICGVVTIRT
SYNJ2_RAT       LSSGVFYFAWPNDGACFDLTIRAQKQGDDCSEWGTSFFWNQLLHVPLRQHQVNCHDWLLKVICGVVTIRT
SYNJ1_HUMAN     LNSGNFYFAWSASGISLDLSLNAHRSMQEQTT-DNRFFWNQSLHLHLKHYGVNCDDWLLRLMCGGVEIRT
SYNJ1_MOUSE     LNSGNFYFAWSASGVSLDLSLNAHRSMQEHTT-DNRFFWNQSLHLHLKHYGVNCDDWLLRLMCGGVEIRT
SYNJ1_BOVIN     LNSGNFYFAWSASGVSLDLSLNAHRSLQEHTT-DNRFSWNQSLHLHLKHYGVNCADWLLRLMCGGVEIRT
SYNJ1_RAT       LNSGNFYFAWSASGVSLDLSLNAHRSMQEHTT-DNRFFWNQSLHLHLKHYGVNCDDWLLRLMCGGVEIRT
SYJ1_SCHPO      LTNGSFYFSLD-----FDITTRLQLRTSQTDSMHTQFMWNEFMLIKFRSHEKSALDGCRFFTCAI----R
INP52_YEAST     LSNGSFYYS-----TDFDLTCTLQKRGFTEDDFDREFMWNSFLMDEIITYRLDQRGFLTTVIRGFAETIF
INP53_YEAST     LSNGSFYYS-----SDFDLTSTLQHRGYSTDTYEEEYMWNSFLHLDTNLKQILDDEFLTTVIRGFAETFV
INP51_YEAST     FSDGTFYYSRDFDISNIGLSHNLEYTVDNQDL---SFIWNANLASEVEKQLFANAGFLTFVIRGYCKTAL
SYJ2_SCHPO      ----------------------------------------------------------------------
OCRL_HUMAN      ----------------------------------------------------------------------
I5P2_HUMAN      ----------------------------------------------------------------------
SAC1_XENLA      LSVDGFYFS-----VSYDLTHTLQRLANTSPEFDQRFVWNNLLREFSAQPEIQ--KFAIPVVHGFIAIHS
PI5PA_MOUSE     ----------------------------------------------------------------------
PI5PA_RAT       ----------------------------------------------------------------------
IP5P3_ARATH     ----------------------------------------------------------------------
SAC2_DANRE      MDSDSFYYSLT-----YDLTNTVQRQGEDQPLWDDRFFWNKHMIKDLVDLQAPQVDWVIPIIQGFVQVEE
SAC1_DICDI      LSSENFYFSYDYD---FTLTLQRQYXXXXGERCDSRFFWNEK-YVTILSKEHGLGDWILPITMGFVESKT
PI5PA_HUMAN     ----------------------------------------------------------------------
SAC1_RAT        LSTDGFYFS-----TTYDLTHTLQRLSNTSPEFDQRFVWNHLLRELSAQPEVH--RFALPVLHGFITMHS
SAC1_BOVIN      LSMDGFYFS-----TTYDLTHTLQRLSNTSPEFDQRFVWNHLLRELSAQPEVH--RFALPVLHGFITMHS
SAC1_MOUSE      LSMDGFYFS-----TTYDLTHTLQRLSNTSPEFDQRFVWNHLLRELSAQPEVH--RFALPVLHGFITMHS
YF51_SCHPO      LSKGQILFS-----PTLDLTCSLQRSFELTSKYNYRFFWNKYAFIELTNKDLGFQEWIQPMIQGNIAITN
IP5P1_ARATH     ----------------------------------------------------------------------
SAC1_PONAB      LNVDGFYFS-----TTYDLTHTLQRLSNTSPEFDQRFVWNHLLRELSAQPEVH--RFALPVLHGFITMHS
SAC1_HUMAN      LNVDGFYFS-----TTYDLTHTLQRLSNTSPEFDQRFVWNHLLRELSAQPEVH--RFALPVLHGFITMHS
SAC2_MOUSE      MDSESFYYSLT-----YDLTNSVQRQSDGRPLWDDRFFWNKYMIQALTEIGTPDVDWIIPIIQGFVQIEE
SAC2_HUMAN      MDSESFYYSLT-----YDLTNSVQRQSDGRPLWDDRFFWNKYMIQDLTEIGTPDVDWIIPMIQGFVQIEE
SAC1A_DANRE     LNTDGFYFA-----TDYDLTHTLQRLSNTSPEFDQRFVWNHLLREFMAQPELH--RFVFPVIHGFIAMRS
SAC1_DROME      LDTKFFYFSY-----RYDLTNSLQRQREVAQSRPERFVWNGYV---LRQFN---CDKMLPLVLGFVSINQ
IP5P4_ARATH     ----------------------------------------------------------------------
YE8A_SCHPO      ----------------------------------------------------------------------
SHIP2_MOUSE     ----------------------------------------------------------------------
SAC1B_DANRE     LNTDGFYFC-----TDYDLTHTQQRLSNTSPDFDQRFMWNNLLREIIAQPELH--KFAFPVIHGFIVMKP
INP5E_MOUSE     ----------------------------------------------------------------------
SHP2A_DANRE     ----------------------------------------------------------------------
SHIP2_RAT       ----------------------------------------------------------------------
SHIP1_HUMAN     ----------------------------------------------------------------------
INP5E_RAT       ----------------------------------------------------------------------
SHIP2_HUMAN     ----------------------------------------------------------------------
SHP2B_DANRE     ----------------------------------------------------------------------
YG23_SCHPO      LKTGPFYFSYT-----WDLTNSLQRSCTDEGKASKRFFWNEFASIDLIGAHSEVSLFITPMIYGFITSAS
IP5P2_ARATH     ----------------------------------------------------------------------
SHIP1_MOUSE     ----------------------------------------------------------------------
SHIP1_XENLA     ----------------------------------------------------------------------
SAC1_YEAST      LKNSTFYFSYT-----YDLTQRNEKVGPAAS-WKTAFFWNHYLTEDLRNHQDPRIDSFIQVIYGYAKTVD
IP5PD_ARATH     ----------------------------------------------------------------------
INP5E_PANTR     ----------------------------------------------------------------------
IP5PC_ARATH     ----------------------------------------------------------------------
INP5E_HUMAN     ----------------------------------------------------------------------
IP5PE_ARATH     ----------------------------------------------------------------------
INP5K_MOUSE     ----------------------------------------------------------------------
SHIP1_RAT       ----------------------------------------------------------------------
INP5K_HUMAN     ----------------------------------------------------------------------
IP5PB_ARATH     ----------------------------------------------------------------------
FIG4_YEAST      LDTKTFYFSYTYDITNTLQTLREKLKAVDRTDYNEMFVWNNNLLSPIFACIDTVFDWFQCIIHGFIDQVN
YLE3_SCHPO      DLARTFYFSYSYDLSQ---TIQPQHQVRDMFVWN----WNMLR--PILDSVGIDSPWCIPLIHGFVDQAK
YLJ7_CAEEL      ----------------------------------------------------------------------
FIG4_MOUSE      DLSSNFYFSYSYDLSQYNLTVETSKQGGSSSEPYMKYVWNELLDIIKNTHR----DWLLYIIHGFCGQSK
FIG4_HUMAN      DLSSNFYFSYSYDLSQYNLTVMTQNRQESCSEPYMKYVWNELLDIKSTVHR----DWLLYIIHGFCGQSK
INP54_YEAST     ----------------------------------------------------------------------
GLMS_PSEPK      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VYASHKQAKACLVSRVSCERTGTRFHTRGVNDDGHVSNFVETEQMIYMDDGVSSFVQIRGSVPLFWEQPG
SYNJ2_HUMAN     VYASHKQAKACLVSRVSCERTGTRFHTRGVNDDGHVSNFVETEQMIYMDDGVSSFVQIRGSVPLFWEQPG
SYNJ2_MOUSE     VYASHKQAKACLISRISCERAGARFLTRGVNDDGHVSNFVETEQTIYMDDGVSSFVQIRGSVPLFWEQPG
SYNJ2_RAT       VYASHKQAKACLISRISCERAGARFLTRGVNDDGHVSNFVETEQAIYMDDGVSSFVQIRGSVPLFWEQPG
SYNJ1_HUMAN     IYAAHKQAKACLISRLSCERAGTRFNVRGTNDDGHVANFVETEQVVYLDDSVSSFIQIRGSVPLFWEQPG
SYNJ1_MOUSE     IYAAHKQAKACLISRLSCERAGTRFNVRGTNDDGHVANFVETEQVIYLDDCVSSFIQIRGSVPLFWEQPG
SYNJ1_BOVIN     IYAAHKQAKACLISRLSCERAGTRFNVRGTNDDGHVANFVETEQVVYLDDSVSSFIQIRGSVPLFWEQPG
SYNJ1_RAT       IYAAHKQAKACLISRLSCERAGTRFNVRGTNDDGHVANFVETEQVIYLDDCVSSFIQIRGSVPLFWEQPG
SYJ1_SCHPO      GFASTEQFKLGIQTXXXXXXAGTRFLSRGVDDDGNVANFVETETILDSSKYCVSYCQVRGSIPIFWEQEG
INP52_YEAST     SYINRLKVGLTIISRQSWKRAGTRFNARGIDDDGHVANFVETEMIMYSSQYCYAFTQIRGSLPIFWEQDT
INP53_YEAST     SYVKKLKVALTIISKQSWKRAGTRFNARGVDDEANVANFVETEFIMYSSQYCYAFTQIRGSIPVFWEQ-G
INP51_YEAST     IEDGPNXXXXXXXXXXXXXXKQDTLELEGISEDGRVSLFVETEIVVTTEKFIFSYTQVNGSIPLFWESVE
SYJ2_SCHPO      ----------------------------GIDDSSYCSMFVETEFIVEIAQTVFSFVQVRGTVPCFWEEQF
OCRL_HUMAN      ----------------------------------------------------------------------
I5P2_HUMAN      ----------------------------------------------------------------------
SAC1_XENLA      CSINGKYFDWILISRRSCFRAGVRYYVRGIDSEGHAANFVETEQIVHYNGNKASFVQTRGSIPFYWSQPN
PI5PA_MOUSE     ----------------------------------------------------------------------
PI5PA_RAT       ----------------------------------------------------------------------
IP5P3_ARATH     ----------------------------------------------------------------------
SAC2_DANRE      LVVNYNESSVALISRRSRHRAGMRYKRRGVDTDGHVANYVETEQLIHVHSHTLSFVQTRGSVPVFWSQAG
SAC1_DICDI      LGGT---CQFTLISRRNLNRSGTRYNVRGIDKKGNVANNVETEQIIEIKENTTSFVQVRGSIPLLWSQFP
PI5PA_HUMAN     ----------------------------------------------------------------------
SAC1_RAT        CSINGKYFDWILISRRSCFRAGVRYYVRGIDSEGHAANFVETEQIVHYSGNRASFVQTRGSIPVFWSQPN
SAC1_BOVIN      CSINGKYFDWILISRRSCFRAGVRYYVRGIDSEGHAANFVETEQIVHYNGSRASFVQTRGSIPLYWSQPN
SAC1_MOUSE      CSINGKYFDWILISRRSCFRAGVRYYVRGIDSEGHAANFVETEQIVHYSGNRASFVQTRGSIPIFWSQPN
YF51_SCHPO      SFLKTYNLRLCVITRHSPDYAGTRYFTRGVNAQGSAANFNEIEQIIMIESPITSFTQIRGSIPMFW----
IP5P1_ARATH     ----------------------------------------------------------------------
SAC1_PONAB      CSINGKYFDWILISRRSCFRAGVRYYVRGIDSEGHAANFVETEQIVHYNGSKASFVQTRGSIPVFWSQPN
SAC1_HUMAN      CSINGKYFDWILISRRSCFRAGVRYYVRGIDSEGHAANFVETEQIVHYNGSKASFVQTRGSIPVFWSQPN
SAC2_MOUSE      LVVNYNESSVALISRRSRHRAGMRYKRRGVDKNGNVANYVETEQLIHVHHHTLSFIQTRGSVPVFWSQVG
SAC2_HUMAN      LVVNYTESSVALISRRSRHRAGMRYKRRGVDKNGNVANYVETEQLIHVHNHTLSFVQTRGSVPVFWSQVG
SAC1A_DANRE     CCINGKIFDWNLISRRSCFRAGVRYYVRGIDSEGHAANFVETEQIIQYNGAKASFIQTRGSIPFYWSQPN
SAC1_DROME      VQINGQTFFWSIITRRSVQRAGTRLFCRGSDEQGHVANFVETEQIVEFNGQLTGFVQTRGSMPFHWHQPV
IP5P4_ARATH     ----------------------------------------------------------------------
YE8A_SCHPO      ----------------------------------------------------------------------
SHIP2_MOUSE     ----------------------------------------------------------------------
SAC1B_DANRE     CCINGKVFEWIIISRRSCFRAGVRYYVRGIDSEGHAANFVETEQIVQFNNARASFVQTRGSIPFFWSQPN
INP5E_MOUSE     ----------------------------------------------------------------------
SHP2A_DANRE     ----------------------------------------------------------------------
SHIP2_RAT       ----------------------------------------------------------------------
SHIP1_HUMAN     ----------------------------------------------------------------------
INP5E_RAT       ----------------------------------------------------------------------
SHIP2_HUMAN     ----------------------------------------------------------------------
SHP2B_DANRE     ----------------------------------------------------------------------
YG23_SCHPO      TIVKGRTITLALISRRSKQRAGTRYFTRGLDENGNPANFNETEQITIVSDEKSSHVQTRGSVPAFWAEVN
IP5P2_ARATH     ----------------------------------------------------------------------
SHIP1_MOUSE     ----------------------------------------------------------------------
SHIP1_XENLA     ----------------------------------------------------------------------
SAC1_YEAST      AVLNATPIVLGLITRRSIFRAGTRYFRRGVDKDGNVGNFNETEQILLAENHVFSFLQTRGSVPIYWAEPN
IP5PD_ARATH     ----------------------------------------------------------------------
INP5E_PANTR     ----------------------------------------------------------------------
IP5PC_ARATH     ----------------------------------------------------------------------
INP5E_HUMAN     ----------------------------------------------------------------------
IP5PE_ARATH     ----------------------------------------------------------------------
INP5K_MOUSE     ----------------------------------------------------------------------
SHIP1_RAT       ----------------------------------------------------------------------
INP5K_HUMAN     ----------------------------------------------------------------------
IP5PB_ARATH     ----------------------------------------------------------------------
FIG4_YEAST      VSVLGKSIYITLIARRSHHFAGARFLKRGVNNKGHVANEVETEQIVFDSDRYTSFVQHRGSIPLYWTQDA
YLE3_SCHPO      LSVYGKPIIVTLIARRSRHFAGARFLRRGIRDDGYVANEVETEQIVF-DGSASSFVQHRGSIPLRWSQ--
YLJ7_CAEEL      ----------------------------------------------------------------------
FIG4_MOUSE      LLIYGRPVYVTLIARRSSRFAGTRFLKRGANCEGDVANEVETEQMSFTAGSYSSYVQVRGSVPLFWSQ--
FIG4_HUMAN      LLIYGRPVYVTLIARRSSKFAGTRFLKRGANCEGDVANEVETEQMSFTAGSYSSYVQVRGSVPLYWSQ--
INP54_YEAST     ----------------------------------------------------------------------
GLMS_PSEPK      -----------------------------------------TDRFMYLEEG--DIAEIRRDQVSIWDQQG


                         .         .         .         +         .         .         .:280
query           LQVGSHHLRLHRGLEANAPAFDRHMVLLKEQYGQQVVVNLLGSRGGEEVLNRAFKKLLWASCHAGDTPMI
SYNJ2_HUMAN     LQVGSHHLRLHRGLEANAPAFDRHMVLLKEQYGQQVVVNLLGSRGGEEVLNRAFKKLLWASCHAGDTPMI
SYNJ2_MOUSE     LQVGSHHLRLHRGLEANAPAFERHMVLLKEQYGKQVVVNLLGSRGGEEVLNRAFKKLLWASCHAGDTPMI
SYNJ2_RAT       LQVGSHHLRLHRGLEANAPAFERHMVLLKEQYGQQVVVNLLGSRGGEEVLNRAFKKLLWASCHAGDTPMI
SYNJ1_HUMAN     LQVGSHRVRMSRGFEANAPAFDRHFRTLKNLYGKQIIVNLLGSKEGEHMLSKAFQSHLKASEHAADIQMV
SYNJ1_MOUSE     LQVGSHRVRMSRGFEANAPAFDRHFRTLKDLYGKQIVVNLLGSKEGEHMLSKAFQSHLKASEHASDIHMV
SYNJ1_BOVIN     LQVGSHRVRMSRGFEANAPAFDRHFRTLKNLYGKQIIVNLLGSKEGEHMLSKAFQSHLKASEHAADIQMV
SYNJ1_RAT       LQVGSHRVRMSRGFEANAPAFDRHFRTLKDLYGKQIVVNLLGSKEGEHMLSKAFQSHLKASEHASDIHMV
SYJ1_SCHPO      VQMFGQKIDITRSLEATRAAFEKHFTSLIEEYGPVHIINLLGTGSGERSLSERLRQHIQLSPEKDLIHLT
INP52_YEAST     SLI-SPKIQITRSVEATQPTFDEHFIRLFKKYGPVHIINLLSTKSSEIQLSRRYKEQLKNSEKGRDVFLT
INP53_YEAST     TSLINPRVQITRSFEATQPVFDKHIMKSVEKYGPVHVVNLLSTKSSEIELSKRYKEHLTHSKKLNDIFLT
INP51_YEAST     SQLGKKIKVTKDSIEAQG-AFDRHFDNLTSKYGVVSIVNIIKPKSSQEKLALTYKDC----AESKGIKIT
SYJ2_SCHPO      SSWYGPSISFLRSSQASQSLFNFHFSKLYKAYGDIYVIDLLQTKGFEASLYEAYKHHLMLL----PFPAV
OCRL_HUMAN      ----------------------------------------------------------------------
I5P2_HUMAN      ----------------------------------------------------------------------
SAC1_XENLA      LKY-KPKPQISKAVN-HMDGFQRHFDSQVISYGKQVVLNLVNQKGSEKPLEQEFSQMV-SGLGNGMVRYI
PI5PA_MOUSE     ----------------------------------------------------------------------
PI5PA_RAT       ----------------------------------------------------------------------
IP5P3_ARATH     ----------------------------------------------------------------------
SAC2_DANRE      YRYNPRP-RIEKGERETMPYFASHFEKEVETYKKLVIINLVDQNGREKIIGDAYLKQVLLYNNPNLT-YV
SAC1_DICDI      TLKYKPSVKFYGDEKENSQALEQHFKQLHQLYGSTTVVNLIDRKGAELKLGEAYEERVKS---LKDVHYV
PI5PA_HUMAN     ----------------------------------------------------------------------
SAC1_RAT        LKY-KPDPQINK-VANHMDGFQRHFDSQVIIYGKQVIINLVNHKGSEKPLEQTFAKMV-SSLGSGMIRYI
SAC1_BOVIN      LKY--KPLPLINKVANHMDGFQRHFDSQIIIYGKQVIINLVNQKGSEKPLEQAFATMV-SSLGNGMIRYI
SAC1_MOUSE      LKYKPHPSKVANHMDGFQRHFDSQVII----YGKQVIINLVNHKGSEKPLEQTFANMV-SSLGSGMIRYI
YF51_SCHPO      AEVNDLHYRSLQPLDYSETVFGKHFQELANDYGDNVVVNLLDQKGREAPLRSGFEKL----CKRNKNPPL
IP5P1_ARATH     ----------------------------------------------------------------------
SAC1_PONAB      LKY--KPLPQISKVANHMDGFQRHFDSQVIIYGKQVIINLINQKGSEKPLEQTFATMV-SSLGSGMMRYI
SAC1_HUMAN      LKY--KPLPQISKVANHMDGFQRHFDSQVIIYGKQVIINLINQKGSEKPLEQTFATMV-SSLGSGMMRYI
SAC2_MOUSE      YRYNPRP-RLDKSEKETVDCFCAHFEEQLKIYKKQVIVNLVDQAGREKIIGDAYLKQVLLFNNPKLT-YV
SAC2_HUMAN      YRYNPRP-RLDRSEKETVAYFCAHFEEQLNIYKKQVIINLVDQAGREKIIGDAYLKLLFNNSH---LTYV
SAC1A_DANRE     LKY-KPKPQISKSIN-HLDGFQRHFDSQIIIYGKQVILNLVNQKGSEKPLEQAFAKMV-GSLGNGMIKYI
SAC1_DROME      LVPGKDHL----------AACGLHFKEQIRLYGNNVAVNLVDHKGAEGELEATYARLV----REMGNPQV
IP5P4_ARATH     ----------------------------------------------------------------------
YE8A_SCHPO      ----------------------------------------------------------------------
SHIP2_MOUSE     ----------------------------------------------------------------------
SAC1B_DANRE     LKYKPKPL-ISKDTN-HMDGLRRHFESQVLIYGKQVILNLVNQKGSELPLEQAFAKMV-SSMENGFIKYI
INP5E_MOUSE     ----------------------------------------------------------------------
SHP2A_DANRE     ----------------------------------------------------------------------
SHIP2_RAT       ----------------------------------------------------------------------
SHIP1_HUMAN     ----------------------------------------------------------------------
INP5E_RAT       ----------------------------------------------------------------------
SHIP2_HUMAN     ----------------------------------------------------------------------
SHP2B_DANRE     ----------------------------------------------------------------------
YG23_SCHPO      -NLRYKPLMVXXXXXXXXXXXKKHFDEQISIYGDQVVVNLVNCKGHELPIKQLYENVI----RRLDNPHI
IP5P2_ARATH     ----------------------------------------------------------------------
SHIP1_MOUSE     ----------------------------------------------------------------------
SHIP1_XENLA     ----------------------------------------------------------------------
SAC1_YEAST      LVLGEN------SLDATKKHFDQQ----KELYGDNYLVNLVNQKGHELPVKEGYESVV----HALNDPKI
IP5PD_ARATH     ----------------------------------------------------------------------
INP5E_PANTR     ----------------------------------------------------------------------
IP5PC_ARATH     ----------------------------------------------------------------------
INP5E_HUMAN     ----------------------------------------------------------------------
IP5PE_ARATH     ----------------------------------------------------------------------
INP5K_MOUSE     ----------------------------------------------------------------------
SHIP1_RAT       ----------------------------------------------------------------------
INP5K_HUMAN     ----------------------------------------------------------------------
IP5PB_ARATH     ----------------------------------------------------------------------
FIG4_YEAST      SNLTTKPIRINVVDPFFSPA-ALHFDNLFQRYGGGTILNLIKTK---EKTPRE-TKLLWEFEQCIDPTLK
YLE3_SCHPO      -EFSNITPKPPIGIDFHDPFYASHFDRLFGHYGPCIVLNLVKSSKRESLLLDEFESAIYLNQFLKDSQKI
YLJ7_CAEEL      ----------------------------------------------------------------------
FIG4_MOUSE      ----------------------------------------------------------------------
FIG4_HUMAN      ----------------------------------------------------------------------
INP54_YEAST     ----------------------------------------------------------------------
GLMS_PSEPK      NKVQRETVQYHEGAEAADKGAYRHF-MLKEIHEQPSVVTLEGRLGKDNVLVQAF----------------


                         .         *         .         .         .         .         +:350
query           NFDFHQFAXXXXXXXXXXXXRPQLKLHWEDFDVFTKGENVSPRFQKGTLRMNCLDCLDRTNTVQSFIALE
SYNJ2_HUMAN     NFDFHQFAXXXXXXXXXXXXRPQLKLHWEDFDVFTKGENVSPRFQKGTLRMNCLDCLDRTNTVQSFIALE
SYNJ2_MOUSE     NFDFHQFAKGRKLEKLENLLRPQLQLHWEDFGVFAKGENVSPRFQKGTLRMNCLDCLDRTNTVQCFIALE
SYNJ2_RAT       NFDFHQFAKGRKLEKLENLLRPQLKLHWDDFGVFAKGENVSPRFQKGTLRMNCLDCLDRTNTVQCFIALE
SYNJ1_HUMAN     NFDYHQMVKGGKAEKLHSVLKPQVQ-KFLDYGFFYFNGSEVQRCQSGTVRTNCLDCLDRTNSVQAFLGLE
SYNJ1_MOUSE     SFDYHQMVKGGKAEKLHSILKPQVQ-KFLDYGFFYFDGSEVQRCQSGTVRTNCLDCLDRTNSVQAFLGLE
SYNJ1_BOVIN     NFDYHQMVKGGKAEKLHSVLKPQVQ-KFLDYGIFHFDGSEVQRCQSGTVRTNCLDCLDRTNSVQAFLGLE
SYNJ1_RAT       SFDYHQMVKGGKAEKLHSVLKPQVQ-KFLDYGFFYFDGSAVQRCQSGTVRTNCLDCLDRTNSVQAFLGLE
SYJ1_SCHPO      EFDYHS---QIRSFEDANKIRPMIYSDAETFGFFENNEGQSIVVQDGVFRTNCLDCLDRTNVIQNLVSRV
INP52_YEAST     SFDFHQDGFAAASRIIPKIRNTILDAGYFSYDV-KEGRLISE--QDGVFRTNCLDCLDRTNLIQQTISLA
INP53_YEAST     EFDFHQEGFSGVRKXXXXXXXXXXXXXXXXXDVREK-KNISE--QHGIFRTNCLDCLDRTNLAQQIISLA
INP51_YEAST     NIEYSSSVLTKSPHKLLYL----LKQDIYEFGAFAYDISRGIYFAKGVLRISAFDSIEKPNTVERLVSKE
SYJ2_SCHPO      VKKFH-FTPDPARPDIDPRLETDLADDLKEMGYTQKSNDMLESFQKGVFRINDLDCLGRTNVIQYQISRL
OCRL_HUMAN      ----------------------------------------------------------------------
I5P2_HUMAN      ----------------------------------------------------------------------
SAC1_XENLA      AFDFHKECSRMRWDRLQILVE-QVAETQDEFGYFTEGKVVSQ--QDGIFRSNCMDCLDRTNVVQSLLARR
PI5PA_MOUSE     ----------------------------------------------------------------------
PI5PA_RAT       ----------------------------------------------------------------------
IP5P3_ARATH     ----------------------------------------------------------------------
SAC2_DANRE      SFDFHEFENVQTLTDAIYDIITDMRWAWVDAGVICQ--------QEGIFRVNCMDCLDRTNVVQAAIARV
SAC1_DICDI      WFDFHSIC-KGMRYDKLSILMDQLKDDLKQYGFFFVEDGKIVQKQQGVFRTNCIDNLDRTNVVQSLITRH
PI5PA_HUMAN     ----------------------------------------------------------------------
SAC1_RAT        AFDFHKECKNMRWDRLSILLDQVAEMQDEYFLVDSAGKVVTN--QEGVFRSNCMDCLDRTNVIXXXXXXX
SAC1_BOVIN      AFDFHKECKNMRWDRLSILLDQVAEMQDELSYFLVDPAGVVLSTQEGVFRSNCMDCLDRTNVIXXXXXXX
SAC1_MOUSE      AFDFHKECKNMRWDRLSILLDQVAEMQDEYFLVDSAGKVVTN--QDGVFRSNCMDCLDRTNVIXXXXXXX
YF51_SCHPO      SYVYYDYHKQGSRNLPLFLAEIQSLL--IEGKYYAEHGSKTTAMQTNFVRTNCMDCLDRTNVIQTSIAQF
IP5P1_ARATH     ----------------------------------------------------------------------
SAC1_PONAB      AFDFHKECKNMRWDRLSILLDQVAEMQDEYFLVDSAGQVVAN--QEGVFRSNCMDCLDRTNVIXXXXXXX
SAC1_HUMAN      AFDFHKECKNMRWDRLSILLDQVAEMQDEYFLVDSAGQVVAN--QEGVFRSNCMDCLDRTNVIXXXXXXX
SAC2_MOUSE      SFDFHEFENVQTLTDAIHDIIIDMKWCWVDAGVICK--------QEGIFRVNCMDCLDRTNVVQAAIARV
SAC2_HUMAN      SFDFHEFENVQTLTDAIYDIILDMKWCWDEAGVICK--------QEGIFRVNCMDCLDRTNVVQAAIARV
SAC1A_DANRE     AFDFHKECSRMRWHRLQILVDTVAELQ-DEFGYFLVDSDGSVQMQQGTFRSNCMDCLDRTNVVXXXXXMA
SAC1_DROME      SFDFHSECRKMRWDRLNILI--DRLAHEQDYHVFDDGKLVST--QTGVFRTNCIDCLDRTNVVQSMLARR
IP5P4_ARATH     ----------------------------------------------------------------------
YE8A_SCHPO      ----------------------------------------------------------------------
SHIP2_MOUSE     ----------------------------------------------------------------------
SAC1B_DANRE     AFDFHKECSKMRWHRLQILVDSDMQEEFGYFMVSSDGKVLSE--QSGTFRSNCMDCLDRTNVIXXXXXXX
INP5E_MOUSE     ----------------------------------------------------------------------
SHP2A_DANRE     ----------------------------------------------------------------------
SHIP2_RAT       ----------------------------------------------------------------------
SHIP1_HUMAN     ----------------------------------------------------------------------
INP5E_RAT       ----------------------------------------------------------------------
SHIP2_HUMAN     ----------------------------------------------------------------------
SHP2B_DANRE     ----------------------------------------------------------------------
YG23_SCHPO      HFDFHECSHMRWDRVSLLLNEIQPELEEQGYTTLTQKYRVLSR-QNGVVRSNCMDCLDRTNVVQSCIGRW
IP5P2_ARATH     ----------------------------------------------------------------------
SHIP1_MOUSE     ----------------------------------------------------------------------
SHIP1_XENLA     ----------------------------------------------------------------------
SAC1_YEAST      HFDFHHECRKMQWHRVKLLIDHLEKLGLSNEDFFHKGNTVEVNEQHSVVRTNCMDCLDRTNVVQSVLAQW
IP5PD_ARATH     ----------------------------------------------------------------------
INP5E_PANTR     ----------------------------------------------------------------------
IP5PC_ARATH     ----------------------------------------------------------------------
INP5E_HUMAN     ----------------------------------------------------------------------
IP5PE_ARATH     ----------------------------------------------------------------------
INP5K_MOUSE     ----------------------------------------------------------------------
SHIP1_RAT       ----------------------------------------------------------------------
INP5K_HUMAN     ----------------------------------------------------------------------
IP5PB_ARATH     ----------------------------------------------------------------------
FIG4_YEAST      KLDYTSWDMSRASKQDGQGVIEFLEKYAVNTGIFHNGPDASTKIQEGICRSNCIDCLDRTNAAQFVIGKR
YLE3_SCHPO      QYIAWDMSAASKKKVPVTKTLEQMASDVKKTGFFCTADRFFPTFQTGVVRTNCVDCLDRTNAAQFVIGKC
YLJ7_CAEEL      ----------------------------------------------------------------------
FIG4_MOUSE      ------------------------------------GGHVIPRLQTGILRTNCVDCLDRTNTAQFMVGKC
FIG4_HUMAN      ------------------------------------------RLQTGILRTNCVDCLDRTNTAQFMVGKC
INP54_YEAST     ----------------------------------------------------------------------
GLMS_PSEPK      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VLHLQLKTLGLSSKPIVDRFVESFKAMWSLNGHSLSKVFTGSRALEGKAKVGKLKDGARSMSRTIQSNFF
SYNJ2_HUMAN     VLHLQLKTLGLSSKPIVDRFVESFKAMWSLNGHSLSKVFTGSRALEGKAKVGKLKDGARSMSRTIQSNFF
SYNJ2_MOUSE     VLHLQLESLGLNSKPIIDRFVESFKAMWSLNGHSLSKVFTGSRALEGKAKVGKLKDGARSMSRTIQSNFF
SYNJ2_RAT       VLHLQLESLGLNSKPITDRFVESFKAMWSLNGHGLSKVFTGSRALEGKAKVGKLKDGARSMSRTIQSNFF
SYNJ1_HUMAN     MLAKQLEALGLAEKPLVTRFQEVFRSMWSVNGDSISKIYAGTGALEGKAK---LKDGARSVTRTIQNNFF
SYNJ1_MOUSE     MLAKQLEALGLAEKPLVTRFQEVFRSMWSVNGDSISKIYAGTGALEGKAK---LKDGARSVTRTIQNNFF
SYNJ1_BOVIN     MLTKQLEALGLAEKPLVTRFQEVFRSMWSVNGDSISKIYAGTGALEGKAK---LKDGARSVSRTIQNNFF
SYNJ1_RAT       MLAKQLEALGLAEKPLVTRFQEVFRSMWSVNGDSISKIYAGTGALEGKAK---LKDGARSVTRTIQNNFF
SYJ1_SCHPO      FLE---QVMIYTRQNAGYDFWQVHSTIWANNGDALARIYTGTGALKGKLSIGALNDLSKSVGRMYINNFQ
INP52_YEAST     VFKLFLEDFRLSSFIDDNEFVQKVNALWADNGDQISQIYTGTNALKSKGKMGALSDATKSVSRMYINNFV
INP53_YEAST     AFRTFLEDFRLXXXXXXXXXXXKHNTLWADHGDQISQIYTGTNALKSKGKMGALSDATKSVSRIYINNFM
INP51_YEAST     VLELTTNEIDVFE--LTSPFLDAHDKLWSENYYWLDRTYTKHTKNSGKTKVYSKLFGSR-----------
SYJ2_SCHPO      VLKDIFFNLQIG---VTFNILEYLRHLWSNNGDAIAKLITGVGSIGSSATAGSLSDISKSFGRMYVGRYP
OCRL_HUMAN      ----------------------------------------------------------------------
I5P2_HUMAN      ----------------------------------------------------------------------
SAC1_XENLA      SLQYQLQRLGVVGQRIEEQFEKIYKNAWADNANACAKQYAGTGALKKRTQWGLLMDGWNSLIRYYKNNFS
PI5PA_MOUSE     ----------------------------------------------------------------------
PI5PA_RAT       ----------------------------------------------------------------------
IP5P3_ARATH     ----------------------------------------------------------------------
SAC2_DANRE      IMEQQLKKLGVPEQPLPLKCYRIYQVMWANNGDTISRQYAGTAALKGRKLAGVMKDGVNSANRYYLNRFR
SAC1_DICDI      SLENQMASVLNKQIPSTDQFEYVFKNIWADHGDAISTQYSGTGALKGKRNFGVLRDGENSVKRYYLNNFK
PI5PA_HUMAN     ----------------------------------------------------------------------
SAC1_RAT        XXXXXXXXXGVQKLEEQDEFEKIYKNAWADNANACAKQYAGTGALKKRTQLGLVMDGFNSLLRYYKNNFS
SAC1_BOVIN      XXXXXXXXXGVQKLEEQDEFEKIYKNAWADNANACAKQYAGTGALKKRTQLGLIMDGWNSLIRYYKNNFS
SAC1_MOUSE      XXXXXXXXXGVQKLEEQDEFEKTYKNAWADNANACAKQYAGTGALKKRTQLGLLMDGFNSLLRYYKNNFS
YF51_SCHPO      ILNMQLHDIGVXXXXXYDSFLQDFRLIWANTGDYISDLYTGTPALKGRTIFGAFKDLLNCFRRYILNNFF
IP5P1_ARATH     ----------------------------------------------------------------------
SAC1_PONAB      XXXXXXXXXGVQKLEEQDEFEKIYKNAWADNANACAKQYAGTGALKKRTHLGLIMDGWNSMIRYYKNNFS
SAC1_HUMAN      XXXXXXXXXGVQKLEEQDEFEKIYKNAWADNANACAKQYAGTGALKKRTHLGLIMDGWNSMIRYYKNNFS
SAC2_MOUSE      VMEQQLKKLGVPEQPLPVKCNRTYQIMWANNGDSISRQYAGTAALKGRKLAGVMKDGVNSANRYYLSRFK
SAC2_HUMAN      VMEQQLKKLGVPEQPLPVKCNRIYQIMWANNGDSISRQYAGTAALKGRKLAGVMKDGVNSANRYYLNRFK
SAC1A_DANRE     VLH-----VGQRIEEQAD-FEKIYKNAWADNANACAKQYAGTGALKKRTQWGLLMDGWNSMIRYYKNNFS
SAC1_DROME      SLTAVLQKLGVKVEHASDIFESIFKGVWADNADLVSLQYSGTCALKKRTKSGAMQDGKNSLMRYYLNNFA
IP5P4_ARATH     ----------------------------------------------------------------------
YE8A_SCHPO      ----------------------------------------------------------------------
SHIP2_MOUSE     ----------------------------------------------------------------------
SAC1B_DANRE     XXXXXXXXMGVVGQKIEEQFEKIYKNAWADNANACAKQYAGTGALKKRTHWGLVMDGWNSMIRYYKNNFS
INP5E_MOUSE     ----------------------------------------------------------------------
SHP2A_DANRE     ----------------------------------------------------------------------
SHIP2_RAT       ----------------------------------------------------------------------
SHIP1_HUMAN     ----------------------------------------------GKLIIKKSKDGSEDKFYS-HKKIL
INP5E_RAT       ----------------------------------------------------------------------
SHIP2_HUMAN     ----------------------------------------------------------------------
SHP2B_DANRE     ----------------------------------------------------------------------
YG23_SCHPO      VLTNQLRKCGIATHPLVIPLDNIFCNIWSDNADYISLSYSGTGALKTRTRKGAFNDFVNSAKRYILNNFY
IP5P2_ARATH     ----------------------------------------------------------------------
SHIP1_MOUSE     ----------------------------------------------GKLIVKKSKDGSEDKFYS-HKKIL
SHIP1_XENLA     ----------------------------------------------GKLIIKKSKDGSKKILQLIKSQKF
SAC1_YEAST      VLQKEFESADVSTWEDNAPLLTSYQNLWADNADAVSVAYSGTGALKKRTRLGAFNDFLNSASRYYQNNWT
IP5PD_ARATH     ----------------------------------------------------------------------
INP5E_PANTR     ----------------------------------------------------------------------
IP5PC_ARATH     ----------------------------------------------------------------------
INP5E_HUMAN     ----------------------------------------------------------------------
IP5PE_ARATH     ----------------------------------------------------------------------
INP5K_MOUSE     ----------------------------------------------------------------------
SHIP1_RAT       ----------------------------------------------GKLIIKKSRDGSEDKFYS-HKKIL
INP5K_HUMAN     ----------------------------------------------------------------------
IP5PB_ARATH     ----------------------------------------------------------------------
FIG4_YEAST      ALGCQLKSLGIIDNSYLEDIVNILTELFHDLGDTIALQYGGSNTMETYRKINQWSSHSRDMIESIKNSFV
YLE3_SCHPO      VLAAQLRALGVLDSPQLDDAVRLLAEMYHGHGDAIALQYGGSNTLDTYRKNNQWSSTSRSVKRFYSNSFV
YLJ7_CAEEL      ----------------------------------------------------------------------
FIG4_MOUSE      ALAYQLYSLGLIDKPNLQDAVRLFEELYEDHGDTLSLQYGGSQLVHRVKTYRKIKDIMQTLSRYYSNAFS
FIG4_HUMAN      ALAYQLYSLGLIDKPNLQDAVRLFEELYEDHGDTLSLQYGGSQLVHRVKTYRKIKDIMQTLSRYYSNAFS
INP54_YEAST     ----------------------------------------------------------------------
GLMS_PSEPK      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           DGVKQEAIKLLLVGDVYGEEVADKGGMLLDSTALLVTPRILKAMTERQSEFTNFKRIRIAMGTWNVNGGK
SYNJ2_HUMAN     DGVKQEAIKLLLVGDVYGEEVADKGGMLLDSTALLVTPRILKAMTERQSEFTNFKRIRIAMGTWNVNGGK
SYNJ2_MOUSE     DGVKQEAIKLLLVGDVYNEESTDKGRMLLDNTALLATPRILKAMTERQSEFTNFKRIQIAVGTWNVNGGK
SYNJ2_RAT       DGVKQEAIKLLLVGDVYNEESTDKGRMLLDNTALLATPRILKAMTERQSEFTNFKRIQIAMGTWNVNGGK
SYNJ1_HUMAN     DSSKQEAIDVLLLGNTLNSDLADKARALLTTGSLRVSEKVLKSMCENFYKYSKPKKIRVCVGTWNVNGGK
SYNJ1_MOUSE     DSSKQEAIDVLLLGNTLNSDLADKARALLTTGSLRVSEKVLKNMCENFYKYSKPKKIRVCVGTWNVNGGK
SYNJ1_BOVIN     DSSKQEAIDVLLLGNTLNSDLADKARALLTTGSLRVSEKVLKSMCENFYKYSKPKKIRVCVGTWNVNGGK
SYNJ1_RAT       DSSKQEAIDVLLLGNTLNSDLADKARALLTTGSLRVSEKVLKNMCENFYKYSKPKKIRVCVGTWNVNGGK
SYJ1_SCHPO      DKGRQETIDLLL-------------GRLIDQHPVILYDPIHEELRKRENEFSEHKNVKIFVASYNLNGCS
INP52_YEAST     DKGKQQNIDTLL-GKLPHQQVVE----LYDPICEYVNERLL----ESEEKFTTHSNINLFVGTFNVNGNS
INP53_YEAST     DKEKQQNIDTLL-----GRLPYQKAVQLYDPVNEYVSTK-LQSMSDK---FTSTSNINLLIGSFNVNGAT
INP51_YEAST     -------VRLYDPLHIY----------------------ISQYLKQLRSKYTFEKDISIFAGTFNISGK-
SYJ2_SCHPO      DVESQNAILLLL-------------GCFPNQSPVLISESVSSVLRQRRSEYRVERDFSIFSSTFNANG--
OCRL_HUMAN      -------------------------------------------LAKREKEYVNIQTFRFFVGTWNVNGQS
I5P2_HUMAN      --------------------VSDKAHILSMQKFGLRDTIVKSHLLQKEEDYTYIQNFRFFAGTYNVNG--
SAC1_XENLA      DGFRQDSIDLFL----------------------------------------------------------
PI5PA_MOUSE     ----------------------------------------------------------------------
PI5PA_RAT       ----------------------------------------------------------------------
IP5P3_ARATH     -----------------------------------------RRMNYENPRIIDVQNYSIFVATWNV-AGR
SAC2_DANRE      DAYRQAVIDLMM----------------------------------------------------------
SAC1_DICDI      DGFRQDS---------------------------------------------------------------
PI5PA_HUMAN     ----------------------------------------------------------------------
SAC1_RAT        DGFRQDSIDLFL-----GNYSVDE----LDSHSPLSVPR-------------------------------
SAC1_BOVIN      DGFRQDSIDLFL-----GNYSVDE----LESHSPLSVPRDLK----------------------------
SAC1_MOUSE      DGFRQDSIDLFL----------------------------------------------------------
YF51_SCHPO      DGMLQDSYDL------------------------------------------------------------
IP5P1_ARATH     ----------------------------------------------------------------------
SAC1_PONAB      DGFRQDSIDLFL----------------------------------------------------------
SAC1_HUMAN      DGFRQDSIDLFL----------------------------------------------------------
SAC2_MOUSE      DAYRQAVIDLM-----------------------------------------------------------
SAC2_HUMAN      DAYRQAVIDLM-----------------------------------------------------------
SAC1A_DANRE     DGFRQDSIDLFLGN--YAVEEAD-----------------------------------------------
SAC1_DROME      DGQRQDSIDLFL----------------------------------------------------------
IP5P4_ARATH     --------------------------------------------------YSRIENLKILAGTWNVGEGR
YE8A_SCHPO      -------------------------------------------MRSRFPEYSNFTDVSILICSWNAGASK
SHIP2_MOUSE     --------------------------------------QLLQLMKNRHSKQDEPDMISVFIGTWNMG---
SAC1B_DANRE     DGFRQDSIDLFL----------------------------------------------------------
INP5E_MOUSE     ------------------------------------------------------RNMALFVATWNMQGQK
SHP2A_DANRE     --------------------------------------QLLQLMKNKHSNQDEPDMISIFIGTWNMG---
SHIP2_RAT       --------------------------------------QLLQLMKNKHSKQDEPDMISVFIGTWNMG---
SHIP1_HUMAN     QLIKSQKFKLVILVETEKEKILRKEYVFADSKKREGFCQLLQQMKNKHSEQPEPDMITIFIGTWNMG---
INP5E_RAT       ------------------------------------------------------RNMALFVATWNMQGQK
SHIP2_HUMAN     --------------------------------------QLLQLMKNKHSKQDEPDMISVFIGTWNMG---
SHP2B_DANRE     --------------------------------------RLLQLMKTTHSQKSELDVISVFVGTWNMGGTP
YG23_SCHPO      DGARQDAYDLVL----------------------------------------------------------
IP5P2_ARATH     ----------------------------------------------------------------------
SHIP1_MOUSE     QLIKSQKFKLVILVETEKEKILRKEYVFADSKKREGFCQLLQQMKNKHSEQPEPDMITIFIGTWNMG---
SHIP1_XENLA     PH------KLVIVLETEKEKTQRKEYVFADSKKREGFCQLLQQMKNKHSGQSEPDMLSIFIGTWNMGDAP
SAC1_YEAST      DGPRQDSYDLFLGG--------------------------------------------------------
IP5PD_ARATH     -------------------------------------------LSQKETLYARQDNVRILIGTWNVGQGR
INP5E_PANTR     ------------------------------------------------------RNVALFVATWNMQGQK
IP5PC_ARATH     ---------------------------------------IRSELAEKERTYAQTDSVRILTGSWNVGQGK
INP5E_HUMAN     ------------------------------------------------------RNVALFVATWNMQGQK
IP5PE_ARATH     -------------------------------------------LSQKEMAYARQDSVKILIGTWNVGEGR
INP5K_MOUSE     ----------------------------------------------------------------------
SHIP1_RAT       QLIKSQKFKLVILVETEKEKILRKEYVFSDSKKREGFCQLLQQMKNKHSEQSEPDMITIFIGTWNMG---
INP5K_HUMAN     ----------------------------------------------------------------------
IP5PB_ARATH     ----------------------------------------------------------------------
FIG4_YEAST      DAQRQDAINLFL----------------------------------------------------------
YLE3_SCHPO      DFQRQEAISLFL------------GNFTVHGKIVVFGEKRLQALTEK---FKNGQLVRRDYRYW------
YLJ7_CAEEL      ----------------------------------------------------------------------
FIG4_MOUSE      DADRQDSINLFL----------------------------------------------------------
FIG4_HUMAN      DADRQDSINLFL----------------------------------------------------------
INP54_YEAST     ----------------------------------------------------------------------
GLMS_PSEPK      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           QFRSNVLRTAELTDWLLDSPQLSGATDSQDDSSPADIFAVGFEEMVELSAGNIVNASTTNKKMWGEQLQK
SYNJ2_HUMAN     QFRSNVLRTAELTDWLLDSPQLSGATDSQDDSSPADIFAVGFEEMVELSAGNIVNASTTNKKMWGEQLQK
SYNJ2_MOUSE     QFRSNLLGTAELTDWLLDAPQLSGAVDSQDDGSPADVFAIGFEEMVELSAGNIVNASTTNRKMWGEQLQK
SYNJ2_RAT       QFRSNLLGTTELTDWLLDAPQLSGAVDSQDDGGPADIFAVGFEEMVELSAGNIVNASTTNRKMWGEQLQK
SYNJ1_HUMAN     QFRSIAFKNQTLTDWLLDAPKLAGIQEFQDKSKPTDIFAIGFEEMVELNAGNIVSASTTNQKLWAVELQK
SYNJ1_MOUSE     QFRSIAFKNQTLTDWLLDAPKLAGIQEFQDKSKPTDIFAIGFEEMVELNAGNIVNASTTNQKLWAVELQK
SYNJ1_BOVIN     QFRSIAFKNQTLTDWLLDAPKLAGIQEFQDKSKPMDIFPIGFEEMVELNAGNIVNASTTNQKLWAAELQK
SYNJ1_RAT       QFRSIAFKNQTLTDWLLDAPKLAGIQEFQDKSKPTDIFAIGFEEMVELNAGNIVNASTTNQKLWAVELQK
SYJ1_SCHPO      A-------TTKLENWLFP-----------ENTPLADIYVVGFQEIVQLTPQQVISADPAKRREWESCVKR
INP52_YEAST     -------RRADLSKWLFPI----------GDKFKPDVVVLGLQEVIELTAGSILNADYTKSSFWETMVTD
INP53_YEAST     -------KKVDLSKWLFPI----------GEKFKPDIVVLGLQEVIELSAGSILNADYSKSSFWENLVGD
INP51_YEAST     ------IPKDDIKDWIFPKSM------SKEDEM-ADLYVIGLEEVVELTPGHMLATDPYVRQFWEKKILT
SYJ2_SCHPO      ----KVPSTDEFKRLLLPFGERTSAYD---------LYVVAVQEIITLNMSHLVSSSNQKLRIWEEKILM
OCRL_HUMAN      P-------DSGLEPWL------------NCDPNPPDIYCIGFQEL-DLSTEAFFYFESVKEQEWSMAVER
I5P2_HUMAN      QSPKECLRL-----WLSNGIQAP------------DVYCVGFQEL-DLSKEAFFFHDTPKEEEWFKAVSE
SAC1_XENLA      ----------------------------------------------------------------------
PI5PA_MOUSE     ---------------------------SGHDNDGADMIAIGLQEVNSMINKRLKDALFTDQ--WSELFMD
PI5PA_RAT       ----------------------------------ADMIAIGLQEVNSMINKRLKDALFTDQ--WSELFMD
IP5P3_ARATH     SPPSDL----NLDEWL-------------HSSAPADIYVLGFQEIVPLNAGNVLGAEDNGAQKWLSLIRK
SAC2_DANRE      ----------------------------------------------------------------------
SAC1_DICDI      ----------------------------------------------------------------------
PI5PA_HUMAN     ------------------------------------MIAIGLQEVNSMLNKRLKDALFTDQ--WSELFMD
SAC1_RAT        ----------------------------------------------------------------------
SAC1_BOVIN      ----------------------------------------------------------------------
SAC1_MOUSE      ----------------------------------------------------------------------
YF51_SCHPO      ----------------------------------------------------------------------
IP5P1_ARATH     ----------------------------------------------------------------------
SAC1_PONAB      ----------------------------------------------------------------------
SAC1_HUMAN      ----------------------------------------------------------------------
SAC2_MOUSE      ----------------------------------------------------------------------
SAC2_HUMAN      ----------------------------------------------------------------------
SAC1A_DANRE     ----------------------------------------------------------------------
SAC1_DROME      ----------------------------------------------------------------------
IP5P4_ARATH     A------STDSLVSWL-------GCA-----ATGVEIVVVGLQE-VEMGAGVLAMSAAKETQWWLDMIGK
YE8A_SCHPO      P-----------SDLDSDTIGASMIPMMIRDNGYPDIVVFGFQELVDLENKRLTXXXXXQYRLWREKLES
SHIP2_MOUSE     ----SVPPPKNVTSWFT-SKGLGKALDEVTVTIPHDIYVFGTQE------------NSVGDREWLDLLRG
SAC1B_DANRE     ----------------------------------------------------------------------
INP5E_MOUSE     EL------PASLDEFLLPT----------EADYTQDLYVIGIQE------------GCSDRREWETRLQE
SHP2A_DANRE     ----SVPAPKPLGSWIL-SRGLGKTLDEMAVTIPHDIYVFGTQE------------NSVCDKEWVETLRC
SHIP2_RAT       ----SVPPPKNVTSWFT-SKGLGKALDEVTVTIPHDIYVFGTQE------------NSVGDREWLDLLRG
SHIP1_HUMAN     ----NAPPPKKITSWFLSKGQGKTRDDSAD-YIPHDIYVIGTQE------------DPLSEKEWLEILKH
INP5E_RAT       EL------PASLDEFLLPT----------EADYTQDLYVIGVQE------------GCSDRREWETRLQE
SHIP2_HUMAN     ----SVPPPKNVTSWFT-SKGLGKTLDEVTVTIPHDIYVFGTQE------------NSVGDREWLDLLRG
SHP2B_DANRE     P-------PGSLQSWVTCSG-LGLTPDESISSLPHDIYAVGTQD------------NPQGEREWAEHIRA
YG23_SCHPO      ----------------------------------------------------------------------
IP5P2_ARATH     ---------------------------------------------------------------------R
SHIP1_MOUSE     ----NAPPPKKITSWFLSKGQGKTRDDSAD-YIPHDIYVIGTQE------------DPLGEKEWLELLRH
SHIP1_XENLA     PPKN-------ITPWF----QCKGQGKTRDDTADYDIYVIGTQE------------DPLSEKEWTDTLIH
SAC1_YEAST      ----------------------------------------------------------------------
IP5PD_ARATH     ASHD------ALMSWL-------GSV-----TSDVGIVAVGLQE-VEMGAGFLAMSAAKETQWWIDAIGK
INP5E_PANTR     ELPPS------LDEFLLPA----------EADYAQDLYVIGVQE------------GCSDRREWETRLQE
IP5PC_ARATH     ASHD------ALMSWL-------GSV-----ASDVGILVVGLQE-VEMGAGFLANEGSTIGQYWIDTIGK
INP5E_HUMAN     ELPPS------LDEFLLPA----------EADYAQDLYVIGVQE------------GCSDRREWETRLQE
IP5PE_ARATH     ASRG------ALVSWLGSAV------------SDVGIVAIGLQE-VDMGAGFLAMSTAKETQWWLDAIGN
INP5K_MOUSE     ----------------------------------------------------------------------
SHIP1_RAT       ----NAPPPKKITSWFLSKGQGKTRDDSAD-YIPHDIYVIGTQE------------DPLGEKEWLEILRH
INP5K_HUMAN     ------------------------------------IYVIGLQELNSGIISLLSDAAFNDS--WSSFLMD
IP5PB_ARATH     ---------------------------------------VSYEDLVELVGKEVVGLQEAPKANVDQLLQT
FIG4_YEAST      ----------------------------------------------------------------------
YLE3_SCHPO      ----------------------------------------------------------------------
YLJ7_CAEEL      ---------------------------------------------------------------WATTIAS
FIG4_MOUSE      ----------------------------------------------------------------------
FIG4_HUMAN      ----------------------------------------------------------------------
INP54_YEAST     -----------------------------------DLYVLGFQEVVPIWQGSLIDRITTTAVNCLNEKVS
GLMS_PSEPK      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           AISRSHRYILLTSAQLVGVCLYIFVRPYHVPFIRDVAIDTVKTGMGGKAGNKGAVGIRFQFHSTSFCFIC
SYNJ2_HUMAN     AISRSHRYILLTSAQLVGVCLYIFVRPYHVPFIRDVAIDTVKTGMGGKAGNKGAVGIRFQFHSTSFCFIC
SYNJ2_MOUSE     AISRSHRYILLTSAQLVGVCLYIFVRPYHVPFIRDVAIDTVKTGMGGKAGNKGAVGIRFQLHSTSFCFVC
SYNJ2_RAT       AISRSHRYILLTSAQLVGVCLYIFVRPYHVPFIRDVAIDTVKTGMGGKAGNKGAVGIRFQFHSTSFCFIC
SYNJ1_HUMAN     TISRDNKYVLLASEQLVGVCLFVFIRPQHAPFIRDVAVDTVKTGMGGATGNKGAVAIRMLFHTTSLCFVC
SYNJ1_MOUSE     TISRDNKYVLLASEQLVGVCLFVFIRPQHAPFIRDVAVDTVKTGMGGATGNKGAVAIRMLFHTTSLCFVC
SYNJ1_BOVIN     TISRDNKYVLLASEQLVGVCLFVFIRPQHAPFIRDVAVDTVKTGMGGATGNKGAVAIRMLFHTTSLCFVC
SYNJ1_RAT       TISRDNKYVLLASEQLVGVCLFVFIRPQHAPFIRDVAVDTVKTGMGGATGNKGAVAIRMLFHTTSLCFVC
SYJ1_SCHPO      LLNSGPGYVQLRSGQLVGTALMIFCKESCLPSIKNVEGTVKKTGLGGVSGNKGAVAIRFDYEDTGLCFIT
INP52_YEAST     CLNQEEKYLLLRVEQMSSLLILFFARSDRAYNIKEVGGSTKKTGFGGITGNKGAVAIRFDYGATSFCFVN
INP53_YEAST     CLNQDDKYLLLRVEQMTSLLILFFVKADKAKYVKQVEGATKKTGFRGMAGNKGAVSIRFEYGATSFCFVN
INP51_YEAST     LLNRKKKYIRLWSTQLGGILLLLFMNETEYSKVKHIEGDVKKTGFGGMASNKGAVAVSFKYSATRFCVLV
SYJ2_SCHPO      ILNSNNKYMLISSIQMAGVFLGVFIRKDDHLXXXXXXXXXXXXXXXXXSANKGAVAIEMNVCDSDFCFVS
OCRL_HUMAN      GLHSKAKYKKVQLVRLVGMMLLIFARKDQCRYIRDIATETVGTGIMGKMGNKGGVAVRFVFHNTTFCIVN
I5P2_HUMAN      GLHPDAKYAKVKLIRLVGIMLLLYVKQEHAAYISEVEAETVGTGIMGRMGNKGGVAIRFQFHNTSICVVN
SAC1_XENLA      ----------------------------------------------------------------------
PI5PA_MOUSE     ALG-PFNFVLVSTVRMQGVILLLFAKYYHLPFLRDVQTDCTRTGLGGYWGNKGGVSVRLAAFGHMLCFLN
PI5PA_RAT       ALG-PFNFVLVSTVRMQGVILLLFAKYYHLPFLRDVQTDCTRTGLGGYWGNKGGVSVRLAAFGHMLCFLN
IP5P3_ARATH     TLN-SSQYCLVASKQMVGVFLTIWVKSELREHVKNMKVSCVGRGLMGYLGNKGSISISMLLHQTSFCFVC
SAC2_DANRE      ----------------------------------------------------------------------
SAC1_DICDI      ----------------------------------------------------------------------
PI5PA_HUMAN     ALG-PFNFVLVSSVRMQGVILLLFAKYYHLPFLRDVQTDCTRTGLGGYWGNKGGVSVRLAAFGHMLCFLN
SAC1_RAT        ----------------------------------------------------------------------
SAC1_BOVIN      ----------------------------------------------------------------------
SAC1_MOUSE      ----------------------------------------------------------------------
YF51_SCHPO      ----------------------------------------------------------------------
IP5P1_ARATH     ---RKPSYVRIVSKQMVGVFLTIWVRRNLRKHISNLCVSTVGVGIMGYIGNKGSVSVSMSIYQTPFCFLC
SAC1_PONAB      ----------------------------------------------------------------------
SAC1_HUMAN      ----------------------------------------------------------------------
SAC2_MOUSE      ----------------------------------------------------------------------
SAC2_HUMAN      ----------------------------------------------------------------------
SAC1A_DANRE     ----------------------------------------------------------------------
SAC1_DROME      ----------------------------------------------------------------------
IP5P4_ARATH     TLDEGSSFVRVGSRQLAGLLICVWVRHDLKPHVGDVDAAAVPCGFGRAIGNKGAVGVRLRMYDRVLCFVN
YE8A_SCHPO      EVSSNDDYQVLVCENLVGLFSCVFVKNKLQSKIRMLQSTTVKTGLGGLHGNKGAIVVRFLVDDTSYCIVN
SHIP2_MOUSE     GLKEDYRPIAMQS--LWNIKVAVLVKPEHENRISHVSTSSVKTGIANTLGNKGAVGVSFMFNGTSFGFVN
SAC1B_DANRE     ----------------------------------------------------------------------
INP5E_MOUSE     TLGP--QYVLLSSAAHGVLYMSLFIRRDLIWFCSEVEYSTVTTRIVSQIKTKGALGVSFTFFGTSFLFIT
SHP2A_DANRE     SLKEDMEYKPIAVQTLWNIKIVVLVKAEHENRISHVGMSSVKTGIANTLGNKGAVGVSFMFNGTSFGFVN
SHIP2_RAT       GLKEDYRPIAMQS--LWNIKVAVLVKPEHENRISHVSTSSVKTGIANTLGNKGAVGVSFMFNGTSFGFVN
SHIP1_HUMAN     SLQEITSVTFKTVATLWNIRIVVLAKPEHENRISHICTDNVKTGIANTLGNKGAVGVSFMFNGTSLGFVN
INP5E_RAT       TLGP--QYVLLSSAAHGVLYMSLFIRRDLIWFCSEVEYSTVTTRIVSQIKTKGALGVSFTFFGTSFLFIT
SHIP2_HUMAN     GLKEDYRPIAMQS--LWNIKVAVLVKPEHENRISHVSTSSVKTGIANTLGNKGAVGVSFMFNGTSFGFVN
SHP2B_DANRE     TLRTSTNYKQVAVQSLWNIRLAVFVKPEHEARISQVNTASVKTGLGNTLGNKGAVGVSLLFNGTSMGFVN
YG23_SCHPO      ----------------------------------------------------------------------
IP5P2_ARATH     KVKDSQKYVRIVSKQMVGIYVSVWIRRRLRRHVNNLKVSPVGVGLMGYMGNKGSVSISMTLYQSRMCFVC
SHIP1_MOUSE     SLQEVTSMTFKTVATLWNIRIVVLAKPEHENRISHICTDNVKTGIANTLGNKGAVGVSFMFNGTSLGFVN
SHIP1_XENLA     SLRESVEYKVITTQTLWNIRIVVLAKPEHAHRISHVCTNSVKTGIANTLGNKGAVGASFMFNGTSFGFIN
SAC1_YEAST      ----------------------------------------------------------------------
IP5PD_ARATH     ALDEKNTFERMGSRQLAGLLISLWARKDIRTHVGDLDVAAVPCGFGRAIGNKGGVGLRIRVYDRIMCFVN
INP5E_PANTR     TLGP--HYVLLSSAAHGVLYMSLFIRRDLIWFCSEVECSTVTTRIVSQIKTKGALGISFTFFGTSFLFIT
IP5PC_ARATH     TLDEKAVFERMGSRQLAGLLISLWVRKNLRTHVGDIDVAAVPCGFGRAIGNKGGVGLRIRVFDRIMCFIN
INP5E_HUMAN     TLGP--HYVLLSSAAHGVLYMSLFIRRDLIWFCSEVECSTVTTRIVSQIKTKGALGISFTFFGTSFLFIT
IP5PE_ARATH     ALDERNTFERMGSRQLAGLLISLWVRKSIRTHVGDLDVAAVPCGFGRAIGNKGGVGLRIRVYDRIMCFVN
INP5K_MOUSE     -------FVKISQVRMQGLLLLVFAKYQHLPYIQIISTKSTPTGLYGYWGNKGGVNVCLKLYGYYVSIIN
SHIP1_RAT       SLQEVTSMTFKTVATLWNIRIVVLAKPEHENRISHICTDNVKTGIANTLGNKGAVGVSFMFNGTSLGFVN
INP5K_HUMAN     VLSPLS-FIKVSHVRMQGILLLVFAKYQHLPYIQILSTKSTPTGLFGYWGNKGGVNICLKLYGYYVSIIN
IP5PB_ARATH     ASSPTHE--LLGKAKLQSVQLYLFGPKNSHTLVKELKAESVXXXXXXXXXXXXAVAIRINYDDIKMVFIS
FIG4_YEAST      ----------------------------------------------------------------------
YLE3_SCHPO      ----------------------------------------------------------------------
YLJ7_CAEEL      WMNTNGRMVLLAKTFQATNQVLIFGRKQLIGQIKRIDYRFQRNTMGGLTGHKGSIGVRLQLASPSIVFVD
FIG4_MOUSE      ----------------------------------------------------------------------
FIG4_HUMAN      ----------------------------------------------------------------------
INP54_YEAST     ATQGDEQYSCLGVNSLGAITIIVLYNNNALKVKDDILKRNGKCGWFG-THLKGGTLISFQMTRNGFSYIC
GLMS_PSEPK      ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           SHLTAGQSQVKERNEDYKEITQKLCFPMGRNVFSHDYVFWCGDFNYRIDLTYEEVFYFVKRQDWKKLLEF
SYNJ2_HUMAN     SHLTAGQSQVKERNEDYKEITQKLCFPMGRNVFSHDYVFWCGDFNYRIDLTYEEVFYFVKRQDWKKLLEF
SYNJ2_MOUSE     SHLTAGQSQVKERNEDYREITHKLSFPSGRNIFSHDYVFWCGDFNYRIDLTYEEVFYFVKRQDWKKLMEF
SYNJ2_RAT       SHLTAGQSQVKERNEDYREITHKLSFPSGRNIFSHDYVFWCGDFNYRIDLTYEEVFYFVKRQDWKKLMEF
SYNJ1_HUMAN     SHFAAGQSQVKERNEDFIEIARKLSFPMGRMLFSHDYVFWCGDFNYRIDLPNEEVKELIRQQNWDSLIAG
SYNJ1_MOUSE     SHFAAGQSQVKERNEDFVEIARKLSFPMGRMLFSHDYVFWCGDFNYRIDLPNEEVKELIRQQNWDSLIAG
SYNJ1_BOVIN     SHFAAGQSQVKERNDDFLEIARKLSFPMGRLLFSHDYVFWCGDFNYRIDLPNEEVKELIRQQNWDSLIAG
SYNJ1_RAT       SHFAAGQSQVKERNEDFVEIARKLSFPMGRMLFSHDYVFWCGDFNYRIDLPNEEVKELIRQQNWDSLIAG
SYJ1_SCHPO      SHLAAGYTNYDERDHDYRTIASGLRFRRGRSIFNHDYVVWFGDFNYRISLTYEEVVPCIAQGKLSYLFEY
INP52_YEAST     THLSAGASNIDEXXXXXXXXXXXXTFPRSKTIPHHDSLFWLGDLNYRITLTNDEVRRELRAQKIDRLLQY
INP53_YEAST     SHLAAGATNVEERRSDYESIVRGITFTRTKMIPHHDSIFWLGDMNYRINLPNEDVRRELLNQEIDKLLHF
INP51_YEAST     SHLAAGLENVEQRHNDYKTIAKSIRFSKGLRIKDHDAIIWMGDFNYRILMSNEDVRRKIVSKEYASLFEK
SYJ2_SCHPO      SHFAPKVNNISERNMEYTSISDNLVFPSGMKIYDHTNILWMGDFNYRIDSDNEEVRKLVELDDLDKLASY
OCRL_HUMAN      SHLAAHVEDFERRNQDYKDICARMSFVVPNNIMKHEVVIWLGDLNYRLCMDANEVKSLINKKDLQRLLKF
I5P2_HUMAN      SHLAAHIEEYERRNQDYKDICSRMQFPL--TISNHDVILWLGDLNYRIELDVEKVKKLIEEKDFQMLYAY
SAC1_XENLA      ----------------------------------------------------------------------
PI5PA_MOUSE     CHLPAHMDKAEQRKDNFQTILQQFQGPGAHGILDHDLVFWFGDLNFRIE-SYDLHFFAIDSNQLHQLWEK
PI5PA_RAT       CHLPAHMDKAEQRKDNFQTILQQFQGPGAHGILDHDLVFWFGDLNFRIE-SYDLHFFAIDSNQLHQLWEK
IP5P3_ARATH     THLTSGQKEGDERNSDVMEILKKTRFPRVKNILQHDRVIWLGDLNYRIALSYRSAKALVEMQNWRALLEN
SAC2_DANRE      ----------------------------------------------------------------------
SAC1_DICDI      ----------------------------------------------------------------------
PI5PA_HUMAN     CHLPAHMDKAEQRKDNFQTILQQFQGPGAQGILDHDLVFWFGDLNFRIE-SYDLHFFAIDSDQLHQLWEK
SAC1_RAT        ----------------------------------------------------------------------
SAC1_BOVIN      ----------------------------------------------------------------------
SAC1_MOUSE      ----------------------------------------------------------------------
YF51_SCHPO      ----------------------------------------------------------------------
IP5P1_ARATH     THLSSGEKDTEKRNDDVREIHRRTQFELPRSICNHERIIWLGDLNYRINLSYEKTHELIARKEWQRLVEY
SAC1_PONAB      ----------------------------------------------------------------------
SAC1_HUMAN      ----------------------------------------------------------------------
SAC2_MOUSE      ----------------------------------------------------------------------
SAC2_HUMAN      ----------------------------------------------------------------------
SAC1A_DANRE     ----------------------------------------------------------------------
SAC1_DROME      ----------------------------------------------------------------------
IP5P4_ARATH     CHFAAHLEAVNRRNADFDHVYRTMTFPRGGNALGADMVIFLGDFNYRLDITYDETRDFISQRCFDWLREK
YE8A_SCHPO      CHLAAGQSNKAARNNDLATILDNALFPEGSLIMDHEVCVLHGDLNYRINTLRPKALDLIKKNDIKTLLQS
SHIP2_MOUSE     CHLTSGNEKTTRRNQNYLDILRLLSLG-DRQLSAFDHLFWFGDLNYRLDMDIQEILNYISRREFEPLLRV
SAC1B_DANRE     ----------------------------------------------------------------------
INP5E_MOUSE     SHFTSGDGKVAERLLDYSRTIQALALPRGDVTTRFDEVFWFGDFNFRLSGGRVAVEAFLKQKDVLALLQH
SHP2A_DANRE     CHLTSGNEKIHRRNQNYLDILRQLSLG-DKQLNSFDHLFWFGDLNYRLDMDIQEILNYINRKEFDPLLKV
SHIP2_RAT       CHLTSGNEKTTRRNQNYLDILRLLSLG-DRQLSAFDHLFWFGDLNYRLDMDIQEILNYISRREFEPLLRV
SHIP1_HUMAN     SHLTSGSEKKLRRNQNYMNILRFLA--LGDKKLSFTHLFWFGDLNYRVDLEAETIIQKIKQQQYADLLSH
INP5E_RAT       SHFTSGDGKVAERLLDYNRTIQALALPRGDVTTRFDEVFWFGDFNFRLSGGRVAVEAFLKQDDVLALLQH
SHIP2_HUMAN     CHLTSGNEKTARRNQNYLDILRLLSLGDRQNAFDFTHLFWFGDLNYRLDMDIQEILNYISRKEFEPLLRV
SHP2B_DANRE     CHLTSGSDKALRRNHNFQDILRLL--SLGEKQLSFNHLFWCGDLNYRLDLDALDILKHVSKREFEELMCA
YG23_SCHPO      ----------------------------------------------------------------------
IP5P2_ARATH     SHLTSGHKDGAERNADVYEIIRRTRFAQPRTIPCHDQVFWFGDLNYRLNMSDGEVRKLVSQKRWDELKNS
SHIP1_MOUSE     SHLTSGSEKKLRRNQNYMNILRFLA--LGDKKLSFTHLFWLGDLNYRVELEAEAXXXXXXXXXYSDLLAH
SHIP1_XENLA     SHLTSGSEKKLRRNQNYFNILRFLVLKLSPFNFTHNHLFWLGDLNYRLQLEAENXXXXXXXXXXXELLPH
SAC1_YEAST      ----------------------------------------------------------------------
IP5PD_ARATH     CHLAAHLEAVNRRNADFNHIFRLMVFSRGQNLSNADMVAFFGDFNYRLGITYDEARDFISQRSFDWLRER
INP5E_PANTR     SHFTSGDGKVAERLLDYTRTVQALALP--RNVTRFDEVFWFGDFNFRLSTVVDALLCQGLVVDVPALLQH
IP5PC_ARATH     CHLAAHLEAVNRRNADFDHIYKTMSFTRSSNAHSHDMVVFFGDFNYRLGISYDEARDFVSQRSFDWLREK
INP5E_HUMAN     SHFTSGDGKVAERLLDYTRTVQALVLP--RNVTRFDEVFWFGDFNFRLSTVVDALLCQGLVVDVPALLQH
IP5PE_ARATH     CHLAAHLEAVTRRNADFNHIYRSMVFSKGQSVYSADLVAFFGDFNYRLGITYDEARDFISHRSFDWLREK
INP5K_MOUSE     CHLPPHMYNNDQRLEHFDRILESLTFEGYDNILDHDLILWFGDMNFRIDFGLLFVQESITRKYYKELWEK
SHIP1_RAT       SHLTSGSEKKLRRNQNYMNILRFLA--LGDKKLSFTHLFWLGDLNYRVELEAEAXXXXXXXXXYSDLLAH
INP5K_HUMAN     CHLPPHISNNYQRLEHFDRILEQNC--EGRNILDHDLIIWFGDMNFRIDFGLHFVRESIKNRCYGGLWEK
IP5PB_ARATH     CHLSAHAKKVDQRNTELRHIANSL---LPRDKRKRDLTVWLGDLNYRIDVSNHPVRSLIQNHLQSVLVSK
FIG4_YEAST      ----------------------------------------------------------------------
YLE3_SCHPO      ----------------------------------------------------------------------
YLJ7_CAEEL      SHFIHGPENYGKRVEQYH--TNRNCFPEDKSVRA---AFWFGDFNFRVEEDVNTVIRKIKNGTHLELLDT
FIG4_MOUSE      ----------------------------------------------------------------------
FIG4_HUMAN      ----------------------------------------------------------------------
INP54_YEAST     AHLNAGVNNRNQRIDDYKRIMSEVC---DSEVAKSDHFFFLGDLNFRVTSTYDPTTNYSSXXXXXXXXXX
GLMS_PSEPK      ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           DQLQLQKSSGKIFKDFHEGAINFGPTYKYDVGSAAYDTSDKCRTPAWTDRVLWWRKKHPFDKTAGELNLL
SYNJ2_HUMAN     DQLQLQKSSGKIFKDFHEGAINFGPTYKYDVGSAAYDTSDKCRTPAWTDRVLWWRKKHPFDKTAGELNLL
SYNJ2_MOUSE     DQLQLQKSSGKIFKDFHEGAVNFGPTYKYDVGSAAYDTSDKCRTPAWTDRVLWWRKKHPYDKTAGELNLL
SYNJ2_RAT       DQLQLQKSSGKIFKDFHEGTINFGPTYKYDVGSAAYDTSDKCRTPAWTDRVLWWRKKHPYDKTAGELNLL
SYNJ1_HUMAN     DQLINQKNAGQVFRGFLEGKVTFAPTYKYDLFSDDYDTSEKCRTPAWTDRVLWRRRKWPFDRSAEDLDLL
SYNJ1_MOUSE     DQLINQKNAGQIFRGFLEGKVTFAPTYKYDLFSEDYDTSEKCRTPAWTDRVLWRRRKWPFDRSAEDLDLL
SYNJ1_BOVIN     DQLINQKNAGQIFRGFLEGKVTFAPTYKYDLFSDDYDTSEKCRTPAWTDRVLWRRRKWPFDRSAEDLDLL
SYNJ1_RAT       DQLINQKNAGQIFRGFLEGKVTFAPTYKYDLFSEDYDTSEKCRTPAWTDRVLWRRRKWPFDRSAEDLDLL
SYJ1_SCHPO      DQLNKQMLTGKVFPFFSELPITFPPTYKFDIGTDIYDTSDKHRVPAWTDRILY----------RGEL---
INP52_YEAST     DQLTQEINEGVVFQGFKEPTLQFRPTYKYDYGTDNYDTSEKARTPSWTDRIIYGENLHPL----------
INP53_YEAST     DQLTLGINSGSVFEGFKEPTLKFRPTYKYDPGTGTYDSSEKERTPSWTDRIIY----------KGE-NLL
INP51_YEAST     DQLNQQMIAGESFPYFHEMAIDFPPTYKFDPGTKNYDTSEKMRIPAWTDRIL----------SRGE--VL
SYJ2_SCHPO      DQLCTEMKKGTVFHGLVEPQLTFLPTYKFDNGTNDYDTSDKQRVPSWTDRILATKS---FTRNC------
OCRL_HUMAN      DQLNIQRTQKKAFVDFNEGEIKFIPTYKYDSKTDRWDSSGKCRVPAWCDRILW-----------------
I5P2_HUMAN      DQLKIQVAAKTVFEGFTEGELTFQPTYKYDTGSDDWDTSEKCRAPAWCDRILWKGK-----------NIT
SAC1_XENLA      ----------------------------------------------------------------------
PI5PA_MOUSE     DQLNMAKNTWPILKGFQEGPLNFAPTFKFDVGTNKYDTSAKKRKPAWTDRILW------------KVKAX
PI5PA_RAT       DQLNMAKNTWPILKGFQEGPLNFAPTFKFDVGTNKYDTSAKKRKPAWTDRILW------------KVKAX
IP5P3_ARATH     DQLRIEQKRGHVFKGWNEGKIYFPPTYKYSRNSDRYSGDDKRRTPAWCDRILW------FGEGLHQLS--
SAC2_DANRE      ----------------------------------------------------------------------
SAC1_DICDI      ----------------------------------------------------------------------
PI5PA_HUMAN     DQLNMAKNTWPILKGFQEGPLNFAPTFKFDVGTNKYDTSAKKRKPAWTDRILW------------KVKAX
SAC1_RAT        ----------------------------------------------------------------------
SAC1_BOVIN      ----------------------------------------------------------------------
SAC1_MOUSE      ----------------------------------------------------------------------
YF51_SCHPO      ----------------------------------------------------------------------
IP5P1_ARATH     DQLSREMTKGNLFEGWSEGTLDFAPTYKYEIDSENYDPESGKRRPAWCDRIIWNGKGM------------
SAC1_PONAB      ----------------------------------------------------------------------
SAC1_HUMAN      ----------------------------------------------------------------------
SAC2_MOUSE      ----------------------------------------------------------------------
SAC2_HUMAN      ----------------------------------------------------------------------
SAC1A_DANRE     ----------------------------------------------------------------------
SAC1_DROME      ----------------------------------------------------------------------
IP5P4_ARATH     DQLHTEMEAGNVFQGMREAIIRFPPTYKFEAGLAGYDSGEKKRIPAWCDRILYRNKKH-----------L
YE8A_SCHPO      DQLERKRNAGFRLRTFTEPEITFAPTYKYDVHSEQYDSSEKKRVPAWCDRICY----------RGSPDYI
SHIP2_MOUSE     DQLNLEREKHKVFLRFSEEEISFPPTYRYERGSKQKPTGVRTNVPSWCDRILW--KSYP------ETHII
SAC1B_DANRE     ----------------------------------------------------------------------
INP5E_MOUSE     DQLTREMKKGSIFRGFEEAEIHFLPSYKFDIGKDTYDSTSKQRTPSYTDRVLY-----------------
SHP2A_DANRE     DQLNLEREKNKIFLRFAEEEISYPPTYRYERGSKQKATGMRTNVPSWCDRILW--KSYP------ETHIV
SHIP2_RAT       DQLNLEREKHKVFLRFSEEEISFPPTYRYERGSKQKPTGVRTNVPSWCDRILW--KSYP------ETHII
SHIP1_HUMAN     DQLLTERREQKVFLHFEEEEITFAPTYRFERDKYAYTTGMKYNLPSWCDRVLW--KSYPLVHVVCQ----
INP5E_RAT       DQLTREMKKGSIFKGFEEAEIHFLPSYKFDIGKDTYDSTSKQRTPSYTDRVLY-----------------
SHIP2_HUMAN     DQLNLEREKHKVFLRFSEEEISFPPTYRYERGSKQKPTGVRTNVPSWCDRILW--KSYP------ETHII
SHP2B_DANRE     DQLTRERHKRKAFFNFKEEKIMFPPTYRYERGSQKYKSSGQVNGPSWCDRVLW--KSYP-----------
YG23_SCHPO      ----------------------------------------------------------------------
IP5P2_ARATH     DQLIRELRRGHVFDGWREGPIKFPPTYKYEFDSDRYREPEKKRAPAWCDRILWLGK--------------
SHIP1_MOUSE     DQLLLERKDQKVFLHFEEEEITFAPTYRFERDKYAYTTGMKYNLPSWCDRVLW--KSYPLVHVVCQ----
SHIP1_XENLA     DQLNLERRESLIFFQFHEEEITFPPTYRYERGSKQKATGIKYNLPSWCDRILW--KSYP------QMHIL
SAC1_YEAST      ----------------------------------------------------------------------
IP5PD_ARATH     DQLRAEMKVGKVFQGMREALITFPPTYKFESGLGGYDSGEKKRIPAWCDRVIYRTQSSPFSESNLQCPVV
INP5E_PANTR     DQLIREMRKGSIFKGFQEPDIHFLPSYKFDIGKDTYDSTSKQRTPSYTDRVL-YRSRHKGD---------
IP5PC_ARATH     DQLRAEMKAGRVFQGMREAIITFPPTYKFEPGLGGYDSGEKKRIPAWCDRVIF-----RDTRTSPE----
INP5E_HUMAN     DQLIREMRKGSIFKGFQEPDIHFLPSYKFDIGKDTYDSTSKQRTPSYTDRVL-YRSRHKGD---------
IP5PE_ARATH     DQLRQEMNEGKVFQGMREALITFPPTYKFEPGLGGYDSGEKKRIPAWCDRVI-YRDNQSISYT-------
INP5K_MOUSE     DQLFIAKKNDQLLREFQEGPLLFPPTYKFDRHSNNYDTSEKKRKPAWTDRILWRLKRQPSQASPLASSVP
SHIP1_RAT       DQLLLERKXXXXXXXXXXXXITFAPTYRFERDKYAYTTGMKYNLPSWCDRVLW--KSYPLVHVVCQ----
INP5K_HUMAN     DQLSIAKKHDPLLREFQEGRLLFPPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQP---CAGP----
IP5PB_ARATH     DQLLQEAERGEIFKGYSEGTLGFKPTYKYNVGSSDYDTSHKIRVPAWTDRILF--KIQDTDNIQATLHSY
FIG4_YEAST      ----------------------------------------------------------------------
YLE3_SCHPO      ----------------------------------------------------------------------
YLJ7_CAEEL      EQLKRALVERDAFIGFHEQPVTFEPTYRVTVGTTEQDGK---RVPSWTDRIL-----YKGDGITG-----
FIG4_MOUSE      ----------------------------------------------------------------------
FIG4_HUMAN      ----------------------------------------------------------------------
INP54_YEAST     XXXXXXXXKGELCKGFQELKITFPPTYKFKLFEK--ETYNTKRIPSWCDRILY-----------------
GLMS_PSEPK      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           DSDLDVDTKVRHTWSPGALQYYGRAELQASDHRPVLAIVEVEVQEVDVGARERVFQEVSSFQGPLDATVV
SYNJ2_HUMAN     DSDLDVDTKVRHTWSPGALQYYGRAELQASDHRPVLAIVEVEVQEVDVGARERVFQEVSSFQGPLDATVV
SYNJ2_MOUSE     DSDLDGDPQIRHTWSPGTLKYYGRAELQASDHRPVLAIVEVEVQEVDVGARERVFQEVSSVQGPLDATVV
SYNJ2_RAT       DSDLDGDANIRHTWSPGTLKYYGRAELQASDHRPVLAIVEVEVQEVDVGARERVFQEVSSVQGPLDATVI
SYNJ1_HUMAN     NASFQDESKILYTWTPGTLLHYGRAELKTSDHRPVVALIDIDIFEVEAEERQNIYKEVIAVQGPPDGTVL
SYNJ1_MOUSE     NASFQDESKILYTWTPGTLLHYGRAELKTSDHRPVVALIDIDIFEVEAEERQKIYKEVIAVQGPPDGTVL
SYNJ1_BOVIN     NASFQDESKILYTWTPGTLLHYGRAELKTSDHRPVVALIDIDIFEVEAEERQNIYKEVIAVQGPPDGTVL
SYNJ1_RAT       NASFQDESKILYTWTPGTLLHYGRAELKTSDHRPVVALIDIDIFEVEAEERQKIYKEVIAVQGPPDGTVL
SYJ1_SCHPO      ---------VPHSYQSVPLYY--------SDHRPIYATYEANIVKVDREKKKILFEEL------------
INP52_YEAST     --------------------AYSDAPLKISDHKPVYAAYRANVKFVD-----------------------
INP53_YEAST     PLS------------------YSDAPIMISDHRPVYAAYRAKITFVDLSLKKRLFTE-------------
INP51_YEAST     EQ----------------LEYKCCEDILFSDHRPVYAIFRARVTVVD-----------------------
SYJ2_SCHPO      ---------------------YKSCDIRCSDHRPVFATFSLKI---------------------------
OCRL_HUMAN      ----------RGT-NVNQLNYRSHMELKTSDHKPVSALFHIGVKVVDERRYRKVFED-------------
I5P2_HUMAN      Q-----------------LSYQSHMALKTSDHKPVSSVFDIGVRVVNDELYRKTLEEIVR---SLDKMEN
SAC1_XENLA      ----------------------------------------------------------------------
PI5PA_MOUSE     XXXXXXXXRESHRLQVTQHSYRSHMEYTVSDHKPVAA---------------------------------
PI5PA_RAT       XXXXXXXXRESHRLQVTQHSYRSHMEYTVSDHKPVAA---------------------------------
IP5P3_ARATH     ---------------------YVRGESRFSDHRPVYGIFCAEVE--------------------------
SAC2_DANRE      ----------------------------------------------------------------------
SAC1_DICDI      ----------------------------------------------------------------------
PI5PA_HUMAN     XXXXXXXXRKSHRLQVTQHSYRSHMEYTVSDHKPVAA---------------------------------
SAC1_RAT        ----------------------------------------------------------------------
SAC1_BOVIN      ----------------------------------------------------------------------
SAC1_MOUSE      ----------------------------------------------------------------------
YF51_SCHPO      ----------------------------------------------------------------------
IP5P1_ARATH     -----------------KLFNYRRNEIKLSDHRPVTALAEVEV---------------------------
SAC1_PONAB      ----------------------------------------------------------------------
SAC1_HUMAN      ----------------------------------------------------------------------
SAC2_MOUSE      ----------------------------------------------------------------------
SAC2_HUMAN      ----------------------------------------------------------------------
SAC1A_DANRE     ----------------------------------------------------------------------
SAC1_DROME      ----------------------------------------------------------------------
IP5P4_ARATH     GAECSLDCPVVSSIS----QYDACMEVTDSDHKPVRCVFSVKIARVDESVRRQEYGNI------------
YE8A_SCHPO      SA-----------------ENYTRYELKASDHRPVSALIHSKAKMVNAQSKRKWIEYADEFKRKAKITYV
SHIP2_MOUSE     CN-----------------SYGCTDDIVTSDHSPVFGTFEVGVTSQFISKKDQAYIEFESIEAIVKTAFF
SAC1B_DANRE     ----------------------------------------------------------------------
INP5E_MOUSE     --------KSRHKGDICPMKYSSCPGIKTSDHRPVYGLFQVKVR--------------------------
SHP2A_DANRE     CN-----------------SYGCTDDIVTSDHSPVFGTFEVGVTSQFVSKKGLPKSSEQAYIEFENIEAI
SHIP2_RAT       CN-----------------SYGCTDDIVTSDHSPVFGTFEVGVTSQFISKKDQAYIEFESIEAIVKTAFF
SHIP1_HUMAN     -------------------SYGSTSDIMTSDHSPVFATFEAGV---------------------------
INP5E_RAT       --------KSRHKGDICPMKYSSCPGIKTSDHRPVYGLFRVKVR--------------------------
SHIP2_HUMAN     CN-----------------SYGCTDDIVTSDHSPVFGTFEVGVTSQFISKKDQAYIEFESIEAIVKTAFF
SHP2B_DANRE     ----------------------------------------------------------------------
YG23_SCHPO      ----------------------------------------------------------------------
IP5P2_ARATH     --------GIRQ-------ECYKRSEIRMSDHRPVTSIFNVGVEVFD-----------------------
SHIP1_MOUSE     -------------------SYGSTSDIMTSDHSPVFATFEAGV---------------------------
SHIP1_XENLA     ------------------CQSYGTDDITTSDHSPVFGTFQVGV---------------------------
SAC1_YEAST      ----------------------------------------------------------------------
IP5PD_ARATH     SS---------------VIMYEACMDVTESDHKPVRCKFHATIAHVDKSVRRQ-----------------
INP5E_PANTR     ------ICPVSYSSCPG---------IKTSDHRPVYGLFRVKVR--------------------------
IP5PC_ARATH     -SECSLDCPV----VASIMLYDACMDVTESDHKPVRCKFHVKIEHVDRSVRRQEFGRI------------
INP5E_HUMAN     ------ICPVSYSSCPG---------IKTSDHRPVYGLFRVKVR--------------------------
IP5PE_ARATH     ------ECSLKCPVVSSTIMYEACMDVTESDHKPVRCKLHANIAHTDKSVRRQ-----------------
INP5K_MOUSE     TSYFLLTLK----------NYVSHMAYSISDHKPVTGTFDLEL---------------------------
SHIP1_RAT       -------------------SYGSTSDIMTSDHSPVFATFEAGV---------------------------
INP5K_HUMAN     ----DTPIPPASHFSLSLRGYSSHMTYGISDHKPVSGTFDLELK--------------------------
IP5PB_ARATH     DS---ID------------QVYG------SDHKPVKA---------------------------------
FIG4_YEAST      ----------------------------------------------------------------------
YLE3_SCHPO      ----------------------------------------------------------------------
YLJ7_CAEEL      ------------------LSYTNNKKAVASDHLPVVAMFRVTAPAAPKPQWEVIFEHLPTW---------
FIG4_MOUSE      ----------------------------------------------------------------------
FIG4_HUMAN      ----------------------------------------------------------------------
INP54_YEAST     ----------------------------------------------------------------------
GLMS_PSEPK      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           VNLQSPTLEEKNEFPEDLRTELMQTLGSYGTIVLVRINQGQMLVTFADSHSALSVLDVDGMKVKGRAVKI
SYNJ2_HUMAN     VNLQSPTLEEKNEFPEDLRTELMQTLGSYGTIVLVRINQGQMLVTFADSHSALSVLDVDGMKVKGRAVKI
SYNJ2_MOUSE     VNLQSPTLEEKNEFPEDLRTELMQTLGNYGTIILVRINQGQMLVTFADSHSALSVLDVDGMKVKGRAVKI
SYNJ2_RAT       VNLQSPTLEERNEFPEDLRTELMQTLGNYGTIILVRINQGQMLVTFADSHSALSVLDVDGMKVKGRAVKI
SYNJ1_HUMAN     VSIKS-SLPENNFFDDALIDELLQQFASFGEVILIRFVEDKMWVTFLEGSSALNVLSLNGKELLNRTITI
SYNJ1_MOUSE     VSIKS-SAQESTFFDDALIDELLRQFAHFGEVILIRFVEDKMWVTFLEGSSALNALSLNGKELLNRTITI
SYNJ1_BOVIN     VSIKS-SLPENNFFNDALIDELLQQFTNFGEVILIRFVEDKMWVTFLEGSSALNVLNLNGKELLGRTITI
SYNJ1_RAT       VSIKS-SAQENTFFDDALIDELLQQFAHFGEVILIRFVEDKMWVTFLEGSSALNVLSLNGKELLNRTITI
SYJ1_SCHPO      ----------------------------------------------------------------------
INP52_YEAST     ----------------------------------------------------------------------
INP53_YEAST     ----------------------------------------------------------------------
INP51_YEAST     ----------------------------------------------------------------------
SYJ2_SCHPO      ----------------------------------------------------------------------
OCRL_HUMAN      ----------------------------------------------------------------------
I5P2_HUMAN      ANIPSVSL-SKREF--------------------------------------------------------
SAC1_XENLA      ----------------------------------------------------------------------
PI5PA_MOUSE     ----------------------------------------------------------------------
PI5PA_RAT       ----------------------------------------------------------------------
IP5P3_ARATH     ----------------------------------------------------------------------
SAC2_DANRE      ----------------------------------------------------------------------
SAC1_DICDI      ----------------------------------------------------------------------
PI5PA_HUMAN     ----------------------------------------------------------------------
SAC1_RAT        ----------------------------------------------------------------------
SAC1_BOVIN      ----------------------------------------------------------------------
SAC1_MOUSE      ----------------------------------------------------------------------
YF51_SCHPO      ----------------------------------------------------------------------
IP5P1_ARATH     ----------------------------------------------------------------------
SAC1_PONAB      ----------------------------------------------------------------------
SAC1_HUMAN      ----------------------------------------------------------------------
SAC2_MOUSE      ----------------------------------------------------------------------
SAC2_HUMAN      ----------------------------------------------------------------------
SAC1A_DANRE     ----------------------------------------------------------------------
SAC1_DROME      ----------------------------------------------------------------------
IP5P4_ARATH     ----------------------------------------------------------------------
YE8A_SCHPO      MNYTSVSYQTAEQY--------------------------------------------------------
SHIP2_MOUSE     IEFYSTCLEEKKSFENDAQSNFLKVQWSSRQLPTLKPILAD-IEYLQDQHLLLTVKSMDGYESYGECVMI
SAC1B_DANRE     ----------------------------------------------------------------------
INP5E_MOUSE     ----------------------------------------------------------------------
SHP2A_DANRE     VKTASRTIEFYSTCLEEFKKSYENDTQSSDNVNFLRVGWSSKQLTLQDQHLLLTVKSLDGYESYGECVST
SHIP2_RAT       IEFYSTCLEEKKSFENDAQSNFLKVQWSSRQLPTLKPILAD-IEYLQDQHLLLTVKSMDGYESYGECVMI
SHIP1_HUMAN     ----------------------------------------------------------------------
INP5E_RAT       ----------------------------------------------------------------------
SHIP2_HUMAN     IEFYSTCLEEKKSFENDAQSNFLKVQWSSRQLPTLKPILAD-IEYLQDQHLLLTVKSMDGYESYGECVMI
SHP2B_DANRE     ----------------------------------------------------------------------
YG23_SCHPO      ----------------------------------------------------------------------
IP5P2_ARATH     ----------------------------------------------------------------------
SHIP1_MOUSE     ----------------------------------------------------------------------
SHIP1_XENLA     ----------------------------------------------------------------------
SAC1_YEAST      ----------------------------------------------------------------------
IP5PD_ARATH     ----------------------------------------------------------------------
INP5E_PANTR     ----------------------------------------------------------------------
IP5PC_ARATH     ----------------------------------------------------------------------
INP5E_HUMAN     ----------------------------------------------------------------------
IP5PE_ARATH     ----------------------------------------------------------------------
INP5K_MOUSE     ----------------------------------------------------------------------
SHIP1_RAT       ----------------------------------------------------------------------
INP5K_HUMAN     ----------------------------------------------------------------------
IP5PB_ARATH     ----------------------------------------------------------------------
FIG4_YEAST      ----------------------------------------------------------------------
YLE3_SCHPO      ----------------------------------------------------------------------
YLJ7_CAEEL      ----------------------------------------------------------------------
FIG4_MOUSE      ----------------------------------------------------------------------
FIG4_HUMAN      ----------------------------------------------------------------------
INP54_YEAST     ----------------------------------------------------------------------
GLMS_PSEPK      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           RPKTKDWLKGLREEIIRKRDSMAPVSPTANSCLLEENFDFTSLDYESEGDILEDDEDYLVDEFNQPXXXX
SYNJ2_HUMAN     RPKTKDWLKGLREEIIRKRDSMAPVSPTANSCLLEENFDFTSLDYESEGDILEDDEDYLVDEFNQPXXXX
SYNJ2_MOUSE     RPKTKDWXXXXXXXXXXXXDSMAPVSPTANSCLLEENFDFSSLDYESXXXXXXXXXXXXXXXFGQPVVSD
SYNJ2_RAT       RPKTKDWLEGLREELIRKRDSMAPVSPTANSCLLEENFDFTSLDYESEGDVLEDDEDYLADEFGQPVVXX
SYNJ1_HUMAN     ALKSPDWIKNLEEEMSLEKISIALPSST-SSTLLGEDAE-VAADFDMEGDV--DDYSAEVEE--------
SYNJ1_MOUSE     TLKSPDWIKHLEEEMSLEKISVT-LPSSASSTLLGEDAE-VAADFDMEGDV--DDYSAEVEE--------
SYNJ1_BOVIN     TLKSPDWIKTLEEEMSLEKINVXXXXXXXXXXXGEDAEVTADFDMEGDVDDYSAEVEEILPQHLQPSSSS
SYNJ1_RAT       TLKSPDWIKTLEEEMSLEKIXXXXXXXXXXXXXGED--AEVSADFDMEGDV--DDYSAEVEE--------
SYJ1_SCHPO      ----------------------------------------------------------------------
INP52_YEAST     ----------------------------------------------------------------------
INP53_YEAST     ----------------------------------------------------------------------
INP51_YEAST     ----------------------------------------------------------------------
SYJ2_SCHPO      ----------------------------------------------------------------------
OCRL_HUMAN      ----------------------------------------------------------------------
I5P2_HUMAN      ----------------------------------------------------------------------
SAC1_XENLA      ----------------------------------------------------------------------
PI5PA_MOUSE     ----------------------------------------------------------------------
PI5PA_RAT       ----------------------------------------------------------------------
IP5P3_ARATH     ----------------------------------------------------------------------
SAC2_DANRE      ----------------------------------------------------------------------
SAC1_DICDI      ----------------------------------------------------------------------
PI5PA_HUMAN     ----------------------------------------------------------------------
SAC1_RAT        ----------------------------------------------------------------------
SAC1_BOVIN      ----------------------------------------------------------------------
SAC1_MOUSE      ----------------------------------------------------------------------
YF51_SCHPO      ----------------------------------------------------------------------
IP5P1_ARATH     ----------------------------------------------------------------------
SAC1_PONAB      ----------------------------------------------------------------------
SAC1_HUMAN      ----------------------------------------------------------------------
SAC2_MOUSE      ----------------------------------------------------------------------
SAC2_HUMAN      ----------------------------------------------------------------------
SAC1A_DANRE     ----------------------------------------------------------------------
SAC1_DROME      ----------------------------------------------------------------------
IP5P4_ARATH     ----------------------------------------------------------------------
YE8A_SCHPO      ----------------------------------------------------------------------
SHIP2_MOUSE     GSTAQQFLTFLSEETGNIRGSMKVRVPTERLGTRERLYEWISIDKDDTG---------------------
SAC1B_DANRE     ----------------------------------------------------------------------
INP5E_MOUSE     ----------------------------------------------------------------------
SHP2A_DANRE     AQQFHTYLSHRGEETGNIRGSMRVRVPSERMGTRERLYEWISVDKDDMG---------------------
SHIP2_RAT       GSTAQQFLTFLSEETGNIRGSMKVRVPTERLGTRERLYEWISIDKDDTG---------------------
SHIP1_HUMAN     ----------------------------------------------------------------------
INP5E_RAT       ----------------------------------------------------------------------
SHIP2_HUMAN     GSTAQQFLTFLSEETGNIRGSMKVRVPTERLGTRERLYEWISIDKDEAG---------------------
SHP2B_DANRE     ----------------------------------------------------------------------
YG23_SCHPO      ----------------------------------------------------------------------
IP5P2_ARATH     ----------------------------------------------------------------------
SHIP1_MOUSE     ----------------------------------------------------------------------
SHIP1_XENLA     ----------------------------------------------------------------------
SAC1_YEAST      ----------------------------------------------------------------------
IP5PD_ARATH     ----------------------------------------------------------------------
INP5E_PANTR     ----------------------------------------------------------------------
IP5PC_ARATH     ----------------------------------------------------------------------
INP5E_HUMAN     ----------------------------------------------------------------------
IP5PE_ARATH     ----------------------------------------------------------------------
INP5K_MOUSE     ----------------------------------------------------------------------
SHIP1_RAT       ----------------------------------------------------------------------
INP5K_HUMAN     ----------------------------------------------------------------------
IP5PB_ARATH     ----------------------------------------------------------------------
FIG4_YEAST      ----------------------------------------------------------------------
YLE3_SCHPO      ----------------------------------------------------------------------
YLJ7_CAEEL      ----------------------------------------------------------------------
FIG4_MOUSE      ----------------------------------------------------------------------
FIG4_HUMAN      ----------------------------------------------------------------------
INP54_YEAST     ----------------------------------------------------------------------
GLMS_PSEPK      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           XXXXXXXXXXXPGPTALAPPSKSPALTKKKQHPTYKDDADLVELKRELEAVGEFRHRSPSRSLSVPNXXX
SYNJ2_HUMAN     XXXXXXXXXXXPGPTALAPPSKSPALTKKKQHPTYKDDADLVELKRELEAVGEFRHRSPSRSLSVPNXXX
SYNJ2_MOUSE     SELGGDNSSDT--MSSLTXXXXXXXXXXXXQHPTYK----------------------------------
SYNJ2_RAT       XXXXXXXXXXT--MXXXXXXXXXXXXXXXXQHPTYKDDADLMTLKLELEVAGNFRHRSPSRSLSVXXXXX
SYNJ1_HUMAN     ----------------------------------------------------------------------
SYNJ1_MOUSE     ----------------------------------------------------------------------
SYNJ1_BOVIN     ALARPPVLHPGPVPASHLPYRRGP----------------------------------------------
SYNJ1_RAT       ----------------------------------------------------------------------
SYJ1_SCHPO      ----------------------------------------------------------------------
INP52_YEAST     ----------------------------------------------------------------------
INP53_YEAST     ----------------------------------------------------------------------
INP51_YEAST     ----------------------------------------------------------------------
SYJ2_SCHPO      ----------------------------------------------------------------------
OCRL_HUMAN      ----------------------------------------------------------------------
I5P2_HUMAN      ----------------------------------------------------------------------
SAC1_XENLA      ----------------------------------------------------------------------
PI5PA_MOUSE     ----------------------------------------------------------------------
PI5PA_RAT       ----------------------------------------------------------------------
IP5P3_ARATH     ----------------------------------------------------------------------
SAC2_DANRE      ----------------------------------------------------------------------
SAC1_DICDI      ----------------------------------------------------------------------
PI5PA_HUMAN     ----------------------------------------------------------------------
SAC1_RAT        ----------------------------------------------------------------------
SAC1_BOVIN      ----------------------------------------------------------------------
SAC1_MOUSE      ----------------------------------------------------------------------
YF51_SCHPO      ----------------------------------------------------------------------
IP5P1_ARATH     ----------------------------------------------------------------------
SAC1_PONAB      ----------------------------------------------------------------------
SAC1_HUMAN      ----------------------------------------------------------------------
SAC2_MOUSE      ----------------------------------------------------------------------
SAC2_HUMAN      ----------------------------------------------------------------------
SAC1A_DANRE     ----------------------------------------------------------------------
SAC1_DROME      ----------------------------------------------------------------------
IP5P4_ARATH     ----------------------------------------------------------------------
YE8A_SCHPO      ----------------------------------------------------------------------
SHIP2_MOUSE     ----------------------------------------------------------------------
SAC1B_DANRE     ----------------------------------------------------------------------
INP5E_MOUSE     ----------------------------------------------------------------------
SHP2A_DANRE     ----------------------------------------------------------------------
SHIP2_RAT       ----------------------------------------------------------------------
SHIP1_HUMAN     ----------------------------------------------------------------------
INP5E_RAT       ----------------------------------------------------------------------
SHIP2_HUMAN     ----------------------------------------------------------------------
SHP2B_DANRE     ----------------------------------------------------------------------
YG23_SCHPO      ----------------------------------------------------------------------
IP5P2_ARATH     ----------------------------------------------------------------------
SHIP1_MOUSE     ----------------------------------------------------------------------
SHIP1_XENLA     ----------------------------------------------------------------------
SAC1_YEAST      ----------------------------------------------------------------------
IP5PD_ARATH     ----------------------------------------------------------------------
INP5E_PANTR     ----------------------------------------------------------------------
IP5PC_ARATH     ----------------------------------------------------------------------
INP5E_HUMAN     ----------------------------------------------------------------------
IP5PE_ARATH     ----------------------------------------------------------------------
INP5K_MOUSE     ----------------------------------------------------------------------
SHIP1_RAT       ----------------------------------------------------------------------
INP5K_HUMAN     ----------------------------------------------------------------------
IP5PB_ARATH     ----------------------------------------------------------------------
FIG4_YEAST      ----------------------------------------------------------------------
YLE3_SCHPO      ----------------------------------------------------------------------
YLJ7_CAEEL      ----------------------------------------------------------------------
FIG4_MOUSE      ----------------------------------------------------------------------
FIG4_HUMAN      ----------------------------------------------------------------------
INP54_YEAST     ----------------------------------------------------------------------
GLMS_PSEPK      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           XXXXXXXXXXXTGLMVKKSASDASISSGTHGQYSILQTARLLPGAPQQPPKARTGISKPYNVKQIKTTNA
SYNJ2_HUMAN     XXXXXXXXXXXTGLMVKKSASDASISSGTHGQYSILQTARLLPGAPQQPPKARTGISKPYNVKQIKTTNA
SYNJ2_MOUSE     -----------AGLMVKKSASDASISSGTHGQYSILQTAKLLPGAPQQPPKARTGISKPYNVKQIKTTNA
SYNJ2_RAT       XXXXXXXXXXXTGLMVKKSASDASISSGTHGQYSILQTAKLLPGAPQQPPKARTGISKPYNVKQIKTTNA
SYNJ1_HUMAN     ----------------------------------------------------------------------
SYNJ1_MOUSE     ----------------------------------------------------------------------
SYNJ1_BOVIN     ----------------------------------------------------------------------
SYNJ1_RAT       ----------------------------------------------------------------------
SYJ1_SCHPO      ----------------------------------------------------------------------
INP52_YEAST     ----------------------------------------------------------------------
INP53_YEAST     ----------------------------------------------------------------------
INP51_YEAST     ----------------------------------------------------------------------
SYJ2_SCHPO      ----------------------------------------------------------------------
OCRL_HUMAN      ----------------------------------------------------------------------
I5P2_HUMAN      ----------------------------------------------------------------------
SAC1_XENLA      ----------------------------------------------------------------------
PI5PA_MOUSE     ----------------------------------------------------------------------
PI5PA_RAT       ----------------------------------------------------------------------
IP5P3_ARATH     ----------------------------------------------------------------------
SAC2_DANRE      ----------------------------------------------------------------------
SAC1_DICDI      ----------------------------------------------------------------------
PI5PA_HUMAN     ----------------------------------------------------------------------
SAC1_RAT        ----------------------------------------------------------------------
SAC1_BOVIN      ----------------------------------------------------------------------
SAC1_MOUSE      ----------------------------------------------------------------------
YF51_SCHPO      ----------------------------------------------------------------------
IP5P1_ARATH     ----------------------------------------------------------------------
SAC1_PONAB      ----------------------------------------------------------------------
SAC1_HUMAN      ----------------------------------------------------------------------
SAC2_MOUSE      ----------------------------------------------------------------------
SAC2_HUMAN      ----------------------------------------------------------------------
SAC1A_DANRE     ----------------------------------------------------------------------
SAC1_DROME      ----------------------------------------------------------------------
IP5P4_ARATH     ----------------------------------------------------------------------
YE8A_SCHPO      ----------------------------------------------------------------------
SHIP2_MOUSE     ----------------------------------------------------------------------
SAC1B_DANRE     ----------------------------------------------------------------------
INP5E_MOUSE     ----------------------------------------------------------------------
SHP2A_DANRE     ----------------------------------------------------------------------
SHIP2_RAT       ----------------------------------------------------------------------
SHIP1_HUMAN     ----------------------------------------------------------------------
INP5E_RAT       ----------------------------------------------------------------------
SHIP2_HUMAN     ----------------------------------------------------------------------
SHP2B_DANRE     ----------------------------------------------------------------------
YG23_SCHPO      ----------------------------------------------------------------------
IP5P2_ARATH     ----------------------------------------------------------------------
SHIP1_MOUSE     ----------------------------------------------------------------------
SHIP1_XENLA     ----------------------------------------------------------------------
SAC1_YEAST      ----------------------------------------------------------------------
IP5PD_ARATH     ----------------------------------------------------------------------
INP5E_PANTR     ----------------------------------------------------------------------
IP5PC_ARATH     ----------------------------------------------------------------------
INP5E_HUMAN     ----------------------------------------------------------------------
IP5PE_ARATH     ----------------------------------------------------------------------
INP5K_MOUSE     ----------------------------------------------------------------------
SHIP1_RAT       ----------------------------------------------------------------------
INP5K_HUMAN     ----------------------------------------------------------------------
IP5PB_ARATH     ----------------------------------------------------------------------
FIG4_YEAST      ----------------------------------------------------------------------
YLE3_SCHPO      ----------------------------------------------------------------------
YLJ7_CAEEL      ----------------------------------------------------------------------
FIG4_MOUSE      ----------------------------------------------------------------------
FIG4_HUMAN      ----------------------------------------------------------------------
INP54_YEAST     ----------------------------------------------------------------------
GLMS_PSEPK      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           QEAEAAIRCLLEARGGASEEALSAVAPRDLEASSEPEPTPGAAKPETPQAXXXXXXXXXXXXXAIKKPTL
SYNJ2_HUMAN     QEAEAAIRCLLEARGGASEEALSAVAPRDLEASSEPEPTPGAAKPETPQAXXXXXXXXXXXXXAIKKPTL
SYNJ2_MOUSE     QEAEAAIRCLLEASGGVPESAPGAI----------PLRNQGSSKPEATLGXXXXXXXXXXXXXTMKKPTL
SYNJ2_RAT       QEAEAAIRCLLEAGGGVPESAPGAT----------PLRNQGSSKPEASLGXXXXXXXXXXXXXTMKKPTL
SYNJ1_HUMAN     ----------------------------------------------------------------------
SYNJ1_MOUSE     ----------------------------------------------------------------------
SYNJ1_BOVIN     ----------------------------------------------------------------------
SYNJ1_RAT       ----------------------------------------------------------------------
SYJ1_SCHPO      ----------------------------------------------------------------------
INP52_YEAST     ----------------------------------------------------------------------
INP53_YEAST     ----------------------------------------------------------------------
INP51_YEAST     ----------------------------------------------------------------------
SYJ2_SCHPO      ----------------------------------------------------------------------
OCRL_HUMAN      ----------------------------------------------------------------------
I5P2_HUMAN      ----------------------------------------------------------------------
SAC1_XENLA      ----------------------------------------------------------------------
PI5PA_MOUSE     ----------------------------------------------------------------------
PI5PA_RAT       ----------------------------------------------------------------------
IP5P3_ARATH     ----------------------------------------------------------------------
SAC2_DANRE      ----------------------------------------------------------------------
SAC1_DICDI      ----------------------------------------------------------------------
PI5PA_HUMAN     ----------------------------------------------------------------------
SAC1_RAT        ----------------------------------------------------------------------
SAC1_BOVIN      ----------------------------------------------------------------------
SAC1_MOUSE      ----------------------------------------------------------------------
YF51_SCHPO      ----------------------------------------------------------------------
IP5P1_ARATH     ----------------------------------------------------------------------
SAC1_PONAB      ----------------------------------------------------------------------
SAC1_HUMAN      ----------------------------------------------------------------------
SAC2_MOUSE      ----------------------------------------------------------------------
SAC2_HUMAN      ----------------------------------------------------------------------
SAC1A_DANRE     ----------------------------------------------------------------------
SAC1_DROME      ----------------------------------------------------------------------
IP5P4_ARATH     ----------------------------------------------------------------------
YE8A_SCHPO      ----------------------------------------------------------------------
SHIP2_MOUSE     ----------------------------------------------------------------------
SAC1B_DANRE     ----------------------------------------------------------------------
INP5E_MOUSE     ----------------------------------------------------------------------
SHP2A_DANRE     ----------------------------------------------------------------------
SHIP2_RAT       ----------------------------------------------------------------------
SHIP1_HUMAN     ----------------------------------------------------------------------
INP5E_RAT       ----------------------------------------------------------------------
SHIP2_HUMAN     ----------------------------------------------------------------------
SHP2B_DANRE     ----------------------------------------------------------------------
YG23_SCHPO      ----------------------------------------------------------------------
IP5P2_ARATH     ----------------------------------------------------------------------
SHIP1_MOUSE     ----------------------------------------------------------------------
SHIP1_XENLA     ----------------------------------------------------------------------
SAC1_YEAST      ----------------------------------------------------------------------
IP5PD_ARATH     ----------------------------------------------------------------------
INP5E_PANTR     ----------------------------------------------------------------------
IP5PC_ARATH     ----------------------------------------------------------------------
INP5E_HUMAN     ----------------------------------------------------------------------
IP5PE_ARATH     ----------------------------------------------------------------------
INP5K_MOUSE     ----------------------------------------------------------------------
SHIP1_RAT       ----------------------------------------------------------------------
INP5K_HUMAN     ----------------------------------------------------------------------
IP5PB_ARATH     ----------------------------------------------------------------------
FIG4_YEAST      ----------------------------------------------------------------------
YLE3_SCHPO      ----------------------------------------------------------------------
YLJ7_CAEEL      ----------------------------------------------------------------------
FIG4_MOUSE      ----------------------------------------------------------------------
FIG4_HUMAN      ----------------------------------------------------------------------
INP54_YEAST     ----------------------------------------------------------------------
GLMS_PSEPK      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           RRTGKPLSPEEQFEQQTVHFTIGPPETSVEXXXXXXXXXXXXXXXXXXFQPGKAAERPSHRKPASDEXXX
SYNJ2_HUMAN     RRTGKPLSPEEQFEQQTVHFTIGPPETSVEXXXXXXXXXXXXXXXXXXFQPGKAAERPSHRKPASDEXXX
SYNJ2_MOUSE     RRTGKPMLPEENFEPQPVHFTMASQEMNLEXXXXXXXXXXXXXXXXXXLQPGKGVERPSSGKPEPDEVTG
SYNJ2_RAT       RRTGKPMLPEEQCEQQPVHFTMASQEMNLE-XXXXXXXXXXXXXXXRTFQPGRGVERPSGGKPEPDD---
SYNJ1_HUMAN     ----------------------------------------------------------------------
SYNJ1_MOUSE     ----------------------------------------------------------------------
SYNJ1_BOVIN     ----------------------------------------------------------------------
SYNJ1_RAT       ----------------------------------------------------------------------
SYJ1_SCHPO      ----------------------------------------------------------------------
INP52_YEAST     ----------------------------------------------------------------------
INP53_YEAST     ----------------------------------------------------------------------
INP51_YEAST     ----------------------------------------------------------------------
SYJ2_SCHPO      ----------------------------------------------------------------------
OCRL_HUMAN      ----------------------------------------------------------------------
I5P2_HUMAN      ----------------------------------------------------------------------
SAC1_XENLA      ----------------------------------------------------------------------
PI5PA_MOUSE     ----------------------------------------------------------------------
PI5PA_RAT       ----------------------------------------------------------------------
IP5P3_ARATH     ----------------------------------------------------------------------
SAC2_DANRE      ----------------------------------------------------------------------
SAC1_DICDI      ----------------------------------------------------------------------
PI5PA_HUMAN     ----------------------------------------------------------------------
SAC1_RAT        ----------------------------------------------------------------------
SAC1_BOVIN      ----------------------------------------------------------------------
SAC1_MOUSE      ----------------------------------------------------------------------
YF51_SCHPO      ----------------------------------------------------------------------
IP5P1_ARATH     ----------------------------------------------------------------------
SAC1_PONAB      ----------------------------------------------------------------------
SAC1_HUMAN      ----------------------------------------------------------------------
SAC2_MOUSE      ----------------------------------------------------------------------
SAC2_HUMAN      ----------------------------------------------------------------------
SAC1A_DANRE     ----------------------------------------------------------------------
SAC1_DROME      ----------------------------------------------------------------------
IP5P4_ARATH     ----------------------------------------------------------------------
YE8A_SCHPO      ----------------------------------------------------------------------
SHIP2_MOUSE     ----------------------------------------------------------------------
SAC1B_DANRE     ----------------------------------------------------------------------
INP5E_MOUSE     ----------------------------------------------------------------------
SHP2A_DANRE     ----------------------------------------------------------------------
SHIP2_RAT       ----------------------------------------------------------------------
SHIP1_HUMAN     ----------------------------------------------------------------------
INP5E_RAT       ----------------------------------------------------------------------
SHIP2_HUMAN     ----------------------------------------------------------------------
SHP2B_DANRE     ----------------------------------------------------------------------
YG23_SCHPO      ----------------------------------------------------------------------
IP5P2_ARATH     ----------------------------------------------------------------------
SHIP1_MOUSE     ----------------------------------------------------------------------
SHIP1_XENLA     ----------------------------------------------------------------------
SAC1_YEAST      ----------------------------------------------------------------------
IP5PD_ARATH     ----------------------------------------------------------------------
INP5E_PANTR     ----------------------------------------------------------------------
IP5PC_ARATH     ----------------------------------------------------------------------
INP5E_HUMAN     ----------------------------------------------------------------------
IP5PE_ARATH     ----------------------------------------------------------------------
INP5K_MOUSE     ----------------------------------------------------------------------
SHIP1_RAT       ----------------------------------------------------------------------
INP5K_HUMAN     ----------------------------------------------------------------------
IP5PB_ARATH     ----------------------------------------------------------------------
FIG4_YEAST      ----------------------------------------------------------------------
YLE3_SCHPO      ----------------------------------------------------------------------
YLJ7_CAEEL      ----------------------------------------------------------------------
FIG4_MOUSE      ----------------------------------------------------------------------
FIG4_HUMAN      ----------------------------------------------------------------------
INP54_YEAST     ----------------------------------------------------------------------
GLMS_PSEPK      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:1330
query           XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFHXXXXXXXXXXXXXXTYNSSDSPSGHPPAAGTVFPQGDF
SYNJ2_HUMAN     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFHXXXXXXXXXXXXXXTYNSSDSPSGHPPAAGTVFPQGDF
SYNJ2_MOUSE     TVXXXXXXXXXXXXXXXKVPPRRKKSAPAAFHXXXXXXXXXXXXXXTCSSSSPPSLKPDTHPLCLQVA--
SYNJ2_RAT       ----------------------------------------------------------------------
SYNJ1_HUMAN     ----------------------------------------------------------------------
SYNJ1_MOUSE     ----------------------------------------------------------------------
SYNJ1_BOVIN     ----------------------------------------------------------------------
SYNJ1_RAT       ----------------------------------------------------------------------
SYJ1_SCHPO      ----------------------------------------------------------------------
INP52_YEAST     ----------------------------------------------------------------------
INP53_YEAST     ----------------------------------------------------------------------
INP51_YEAST     ----------------------------------------------------------------------
SYJ2_SCHPO      ----------------------------------------------------------------------
OCRL_HUMAN      ----------------------------------------------------------------------
I5P2_HUMAN      ----------------------------------------------------------------------
SAC1_XENLA      ----------------------------------------------------------------------
PI5PA_MOUSE     ----------------------------------------------------------------------
PI5PA_RAT       ----------------------------------------------------------------------
IP5P3_ARATH     ----------------------------------------------------------------------
SAC2_DANRE      ----------------------------------------------------------------------
SAC1_DICDI      ----------------------------------------------------------------------
PI5PA_HUMAN     ----------------------------------------------------------------------
SAC1_RAT        ----------------------------------------------------------------------
SAC1_BOVIN      ----------------------------------------------------------------------
SAC1_MOUSE      ----------------------------------------------------------------------
YF51_SCHPO      ----------------------------------------------------------------------
IP5P1_ARATH     ----------------------------------------------------------------------
SAC1_PONAB      ----------------------------------------------------------------------
SAC1_HUMAN      ----------------------------------------------------------------------
SAC2_MOUSE      ----------------------------------------------------------------------
SAC2_HUMAN      ----------------------------------------------------------------------
SAC1A_DANRE     ----------------------------------------------------------------------
SAC1_DROME      ----------------------------------------------------------------------
IP5P4_ARATH     ----------------------------------------------------------------------
YE8A_SCHPO      ----------------------------------------------------------------------
SHIP2_MOUSE     ----------------------------------------------------------------------
SAC1B_DANRE     ----------------------------------------------------------------------
INP5E_MOUSE     ----------------------------------------------------------------------
SHP2A_DANRE     ----------------------------------------------------------------------
SHIP2_RAT       ----------------------------------------------------------------------
SHIP1_HUMAN     ----------------------------------------------------------------------
INP5E_RAT       ----------------------------------------------------------------------
SHIP2_HUMAN     ----------------------------------------------------------------------
SHP2B_DANRE     ----------------------------------------------------------------------
YG23_SCHPO      ----------------------------------------------------------------------
IP5P2_ARATH     ----------------------------------------------------------------------
SHIP1_MOUSE     ----------------------------------------------------------------------
SHIP1_XENLA     ----------------------------------------------------------------------
SAC1_YEAST      ----------------------------------------------------------------------
IP5PD_ARATH     ----------------------------------------------------------------------
INP5E_PANTR     ----------------------------------------------------------------------
IP5PC_ARATH     ----------------------------------------------------------------------
INP5E_HUMAN     ----------------------------------------------------------------------
IP5PE_ARATH     ----------------------------------------------------------------------
INP5K_MOUSE     ----------------------------------------------------------------------
SHIP1_RAT       ----------------------------------------------------------------------
INP5K_HUMAN     ----------------------------------------------------------------------
IP5PB_ARATH     ----------------------------------------------------------------------
FIG4_YEAST      ----------------------------------------------------------------------
YLE3_SCHPO      ----------------------------------------------------------------------
YLJ7_CAEEL      ----------------------------------------------------------------------
FIG4_MOUSE      ----------------------------------------------------------------------
FIG4_HUMAN      ----------------------------------------------------------------------
INP54_YEAST     ----------------------------------------------------------------------
GLMS_PSEPK      ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:1400
query           LSTSSATSPDSDGTKAMKPEAAPLLGDYQDPFWNLLHHPKLLNNTWLSKSSDPLDSGTRSPKRDPIDPVS
SYNJ2_HUMAN     LSTSSATSPDSDGTKAMKPEAAPLLGDYQDPFWNLLHHPKLLNNTWLSKSSDPLDSGTRSPKRDPIDPVS
SYNJ2_MOUSE     LGTSSARSPETHGPRVTEPEAASFHGNYPDPFWSLLHHPKLLNNTWLSKSSEPLDVGSRNPERTHTEPAQ
SYNJ2_RAT       LGTSSAISPETDGPRVTEPEAASFHGDYPDPFWSLLHHPKLLNNTWLSKSSEPLDLGSRTPERTHTDSAQ
SYNJ1_HUMAN     ----------------------------------------------------------------------
SYNJ1_MOUSE     ----------------------------------------------------------------------
SYNJ1_BOVIN     ----------------------------------------------------------------------
SYNJ1_RAT       ----------------------------------------------------------------------
SYJ1_SCHPO      ----------------------------------------------------------------------
INP52_YEAST     ----------------------------------------------------------------------
INP53_YEAST     ----------------------------------------------------------------------
INP51_YEAST     ----------------------------------------------------------------------
SYJ2_SCHPO      ----------------------------------------------------------------------
OCRL_HUMAN      ----------------------------------------------------------------------
I5P2_HUMAN      ----------------------------------------------------------------------
SAC1_XENLA      ----------------------------------------------------------------------
PI5PA_MOUSE     ----------------------------------------------------------------------
PI5PA_RAT       ----------------------------------------------------------------------
IP5P3_ARATH     ----------------------------------------------------------------------
SAC2_DANRE      ----------------------------------------------------------------------
SAC1_DICDI      ----------------------------------------------------------------------
PI5PA_HUMAN     ----------------------------------------------------------------------
SAC1_RAT        ----------------------------------------------------------------------
SAC1_BOVIN      ----------------------------------------------------------------------
SAC1_MOUSE      ----------------------------------------------------------------------
YF51_SCHPO      ----------------------------------------------------------------------
IP5P1_ARATH     ----------------------------------------------------------------------
SAC1_PONAB      ----------------------------------------------------------------------
SAC1_HUMAN      ----------------------------------------------------------------------
SAC2_MOUSE      ----------------------------------------------------------------------
SAC2_HUMAN      ----------------------------------------------------------------------
SAC1A_DANRE     ----------------------------------------------------------------------
SAC1_DROME      ----------------------------------------------------------------------
IP5P4_ARATH     ----------------------------------------------------------------------
YE8A_SCHPO      ----------------------------------------------------------------------
SHIP2_MOUSE     ----------------------------------------------------------------------
SAC1B_DANRE     ----------------------------------------------------------------------
INP5E_MOUSE     ----------------------------------------------------------------------
SHP2A_DANRE     ----------------------------------------------------------------------
SHIP2_RAT       ----------------------------------------------------------------------
SHIP1_HUMAN     ----------------------------------------------------------------------
INP5E_RAT       ----------------------------------------------------------------------
SHIP2_HUMAN     ----------------------------------------------------------------------
SHP2B_DANRE     ----------------------------------------------------------------------
YG23_SCHPO      ----------------------------------------------------------------------
IP5P2_ARATH     ----------------------------------------------------------------------
SHIP1_MOUSE     ----------------------------------------------------------------------
SHIP1_XENLA     ----------------------------------------------------------------------
SAC1_YEAST      ----------------------------------------------------------------------
IP5PD_ARATH     ----------------------------------------------------------------------
INP5E_PANTR     ----------------------------------------------------------------------
IP5PC_ARATH     ----------------------------------------------------------------------
INP5E_HUMAN     ----------------------------------------------------------------------
IP5PE_ARATH     ----------------------------------------------------------------------
INP5K_MOUSE     ----------------------------------------------------------------------
SHIP1_RAT       ----------------------------------------------------------------------
INP5K_HUMAN     ----------------------------------------------------------------------
IP5PB_ARATH     ----------------------------------------------------------------------
FIG4_YEAST      ----------------------------------------------------------------------
YLE3_SCHPO      ----------------------------------------------------------------------
YLJ7_CAEEL      ----------------------------------------------------------------------
FIG4_MOUSE      ----------------------------------------------------------------------
FIG4_HUMAN      ----------------------------------------------------------------------
INP54_YEAST     ----------------------------------------------------------------------
GLMS_PSEPK      ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:1470
query           AGASAAKAELPPDHEHKTLGHWVTISDQEKRTALQVFDPLAKT
SYNJ2_HUMAN     AGASAAKAELPPDHEHKTLGHWVTISDQEKRTALQVFDPLAKT
SYNJ2_MOUSE     VNASLAERGLPPDHGGKDLSHWVTASNKDKRTTLGV-------
SYNJ2_RAT       VNASVVERGLPPDHGGKDFSHWMAASNKDKRTTLGV-------
SYNJ1_HUMAN     -------------------------------------------
SYNJ1_MOUSE     -------------------------------------------
SYNJ1_BOVIN     -------------------------------------------
SYNJ1_RAT       -------------------------------------------
SYJ1_SCHPO      -------------------------------------------
INP52_YEAST     -------------------------------------------
INP53_YEAST     -------------------------------------------
INP51_YEAST     -------------------------------------------
SYJ2_SCHPO      -------------------------------------------
OCRL_HUMAN      -------------------------------------------
I5P2_HUMAN      -------------------------------------------
SAC1_XENLA      -------------------------------------------
PI5PA_MOUSE     -------------------------------------------
PI5PA_RAT       -------------------------------------------
IP5P3_ARATH     -------------------------------------------
SAC2_DANRE      -------------------------------------------
SAC1_DICDI      -------------------------------------------
PI5PA_HUMAN     -------------------------------------------
SAC1_RAT        -------------------------------------------
SAC1_BOVIN      -------------------------------------------
SAC1_MOUSE      -------------------------------------------
YF51_SCHPO      -------------------------------------------
IP5P1_ARATH     -------------------------------------------
SAC1_PONAB      -------------------------------------------
SAC1_HUMAN      -------------------------------------------
SAC2_MOUSE      -------------------------------------------
SAC2_HUMAN      -------------------------------------------
SAC1A_DANRE     -------------------------------------------
SAC1_DROME      -------------------------------------------
IP5P4_ARATH     -------------------------------------------
YE8A_SCHPO      -------------------------------------------
SHIP2_MOUSE     -------------------------------------------
SAC1B_DANRE     -------------------------------------------
INP5E_MOUSE     -------------------------------------------
SHP2A_DANRE     -------------------------------------------
SHIP2_RAT       -------------------------------------------
SHIP1_HUMAN     -------------------------------------------
INP5E_RAT       -------------------------------------------
SHIP2_HUMAN     -------------------------------------------
SHP2B_DANRE     -------------------------------------------
YG23_SCHPO      -------------------------------------------
IP5P2_ARATH     -------------------------------------------
SHIP1_MOUSE     -------------------------------------------
SHIP1_XENLA     -------------------------------------------
SAC1_YEAST      -------------------------------------------
IP5PD_ARATH     -------------------------------------------
INP5E_PANTR     -------------------------------------------
IP5PC_ARATH     -------------------------------------------
INP5E_HUMAN     -------------------------------------------
IP5PE_ARATH     -------------------------------------------
INP5K_MOUSE     -------------------------------------------
SHIP1_RAT       -------------------------------------------
INP5K_HUMAN     -------------------------------------------
IP5PB_ARATH     -------------------------------------------
FIG4_YEAST      -------------------------------------------
YLE3_SCHPO      -------------------------------------------
YLJ7_CAEEL      -------------------------------------------
FIG4_MOUSE      -------------------------------------------
FIG4_HUMAN      -------------------------------------------
INP54_YEAST     -------------------------------------------
GLMS_PSEPK      -------------------------------------------