[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for huge0:KIAA1464

[Show Plain Result]


## Summary of Sequence Search
    1::621
    1::620       0.0 100%  620 aa  RBP10_HUMAN RecName: Full=Ran-binding protein 10;       
    1::620       0.0  96%  620 aa  RBP10_BOVIN RecName: Full=Ran-binding protein 10;       
   28::648       0.0  98%  648 aa  RBP10_MOUSE RecName: Full=Ran-binding protein 10;       
   20::604       0.0  83%  604 aa  RBP10_DANRE RecName: Full=Ran-binding protein 10;       
   26::597       0.0  73%  597 aa  RANB9_DANRE RecName: Full=Ran-binding protein 9;       
   69::653       0.0  73%  653 aa  RANB9_MOUSE RecName: Full=Ran-binding protein 9;       
  144::729       0.0  71%  729 aa  RANB9_HUMAN RecName: Full=Ran-binding protein 9;       
   29::548       0.0  70%  548 aa  RANB9_XENLA RecName: Full=Ran-binding protein 9;       
   29::548       0.0  69%  548 aa  RANB9_XENTR RecName: Full=Ran-binding protein 9;       
  404::957     e-108  57%  962 aa  RBP9X_DROME RecName: Full=Ran-binding proteins 9/10
   55::353     1e-59  40%  486 aa  YC5C_SCHPO RecName: Full=Uncharacterized protein C1259.12c;
  196::333     5e-19  37%  523 aa  SSH4_SCLS1 RecName: Full=Protein ssh4;
  210::347     5e-19  37%  537 aa  SSH4_BOTFB RecName: Full=Protein ssh4;
  209::352     9e-19  35%  511 aa  SSH4_ASPCL RecName: Full=Protein ssh4;
  209::352     1e-18  35%  507 aa  SSH4_NEOFI RecName: Full=Protein ssh4;
  233::327     1e-18  42%  442 aa  SPRY3_HUMAN RecName: Full=SPRY domain-containing protein 3;
  209::352     2e-18  35%  507 aa  SSH4_ASPFU RecName: Full=Protein ssh4;
 1075::1210    3e-18  40% 2410 aa  PYK1_DICDI RecName: Full=Dual specificity protein kinase pyk1;       
  203::346     6e-18  36%  494 aa  SSH4_COCIM RecName: Full=Protein SSH4;
  233::327     1e-17  41%  442 aa  SPRY3_PONAB RecName: Full=SPRY domain-containing protein 3;
  141::284     2e-17  34%  500 aa  SSH4_NEUCR RecName: Full=Protein ssh-4;
  485::825     1e-16  36%  958 aa  VID30_YEAST RecName: Full=Vacuolar import and degradation protein
  159::295     2e-15  38%  382 aa  YCRA_SCHPO RecName: Full=SPRY domain-containing protein C285.10c;
   88::248     2e-10  34%  727 aa  DDX1_DROME RecName: Full=ATP-dependent RNA helicase Ddx1;       
  118::261     3e-10  34% 1314 aa  RN123_HUMAN RecName: Full=E3 ubiquitin-protein ligase RNF123;      
  218::385     3e-10  38%  550 aa  EAR1_YEAST RecName: Full=Protein EAR1;AltName: Full=Endosomal
  118::319     4e-10  34% 1314 aa  RN123_MOUSE RecName: Full=E3 ubiquitin-protein ligase RNF123;      
  125::259     2e-09  35%  765 aa  DDX1_DICDI RecName: Full=Probable ATP-dependent RNA helicase ddx1; 
  182::253     1e-07  41%  740 aa  DDX1_XENTR RecName: Full=ATP-dependent RNA helicase DDX1;       
   33::196     2e-07  36%  228 aa  U559_DICDI RecName: Full=UPF0559 protein;
   23::189     3e-07  32%  225 aa  U559_NEMVE RecName: Full=UPF0559 protein v1g247787;
   26::119     4e-07  28%  228 aa  CT011_DANRE RecName: Full=Protein C20orf11 homolog;
   26::119     4e-07  26%  228 aa  CT011_CHICK RecName: Full=Protein C20orf11 homolog;
   26::119     6e-07  26%  228 aa  CT011_MOUSE RecName: Full=Protein C20orf11 homolog;AltName:
   26::119     6e-07  26%  228 aa  CT011_HUMAN RecName: Full=Protein C20orf11;AltName: Full=Two
   26::119     6e-07  26%  228 aa  CT011_BOVIN RecName: Full=Protein C20orf11 homolog;
 1085::1168    8e-07  33% 4870 aa  RYR3_HUMAN RecName: Full=Ryanodine receptor 3;         Short=RYR-3;  
 1076::1206    8e-07  30% 5037 aa  RYR1_RABIT RecName: Full=Ryanodine receptor 1;         Short=RYR-1;  
 1075::1205    1e-06  30% 5038 aa  RYR1_HUMAN RecName: Full=Ryanodine receptor 1;         Short=RYR-1;  
 1087::1180    2e-06  30% 4967 aa  RYR2_RABIT RecName: Full=Ryanodine receptor 2;         Short=RYR-2;  
  182::253     2e-06  40%  740 aa  DDX1_RAT RecName: Full=ATP-dependent RNA helicase DDX1;       
  182::253     2e-06  40%  740 aa  DDX1_MOUSE RecName: Full=ATP-dependent RNA helicase DDX1;       
 1087::1180    3e-06  30% 4965 aa  RYR2_HUMAN RecName: Full=Ryanodine receptor 2;         Short=RYR-2;  
 1076::1206    3e-06  30% 5035 aa  RYR1_PIG RecName: Full=Ryanodine receptor 1;         Short=RYR-1;    
  400::491     4e-06  33%  623 aa  ASH2L_MOUSE RecName: Full=Set1/Ash2 histone methyltransferase
  405::496     4e-06  33%  628 aa  ASH2L_HUMAN RecName: Full=Set1/Ash2 histone methyltransferase
  182::253     8e-06  39%  740 aa  DDX1_PONAB RecName: Full=ATP-dependent RNA helicase DDX1;       
  182::253     8e-06  39%  740 aa  DDX1_MACFA RecName: Full=ATP-dependent RNA helicase DDX1;       
  182::253     8e-06  39%  740 aa  DDX1_HUMAN RecName: Full=ATP-dependent RNA helicase DDX1;       
  182::253     8e-06  39%  740 aa  DDX1_BOVIN RecName: Full=ATP-dependent RNA helicase DDX1;       
  172::319     1e-05  30%  529 aa  SSH4_DEBHA RecName: Full=Protein SSH4;
  107::256     2e-05  34%  355 aa  SPSB3_HUMAN RecName: Full=SPRY domain-containing SOCS box protein
  129::240     2e-05  26%  410 aa  FYV10_NEUCR RecName: Full=Protein fyv-10;
  326::415     3e-05  37%  745 aa  HNRL2_MOUSE RecName: Full=Heterogeneous nuclear ribonucleoprotein
  328::417     3e-05  37%  747 aa  HNRL2_HUMAN RecName: Full=Heterogeneous nuclear ribonucleoprotein
  182::253     4e-05  37%  740 aa  DDX1_XENLA RecName: Full=ATP-dependent RNA helicase DDX1;       
  106::255     5e-05  31%  345 aa  SPSB3_BOVIN RecName: Full=SPRY domain-containing SOCS box protein
  182::253     5e-05  34%  740 aa  DDX1_CHICK RecName: Full=ATP-dependent RNA helicase DDX1;       
  129::220     7e-05  28%  441 aa  FYV10_CHAGB RecName: Full=Protein FYV10;
  388::463     9e-05  34%  652 aa  ASH2_SCHPO RecName: Full=Set1 complex component ash2;       
  297::387     1e-04  40%  859 aa  HNRL1_MOUSE RecName: Full=Heterogeneous nuclear ribonucleoprotein
  296::386     1e-04  40%  856 aa  HNRL1_HUMAN RecName: Full=Heterogeneous nuclear ribonucleoprotein
  232::335     2e-04  28%  579 aa  SSH4_YEAST RecName: Full=Protein SSH4;AltName: Full=Suppressor of
  232::335     2e-04  28%  579 aa  SSH4_YEAS7 RecName: Full=Protein SSH4;AltName: Full=Suppressor of
   66::177     3e-04  30%  196 aa  CLLD6_RAT RecName: Full=Chronic lymphocytic leukemia deletion
   66::177     3e-04  30%  196 aa  CLLD6_MOUSE RecName: Full=Chronic lymphocytic leukemia deletion
   66::177     3e-04  30%  196 aa  CLLD6_HUMAN RecName: Full=Chronic lymphocytic leukemia deletion
 1092::1176    4e-04  29% 5127 aa  RY44_DROME RecName: Full=Ryanodine receptor 44F;
   63::159     4e-04  28% 1159 aa  NU124_SCHPO RecName: Full=Nucleoporin nup124;AltName: Full=Nuclear
   66::177     4e-04  29%  196 aa  CLLD6_CHICK RecName: Full=Chronic lymphocytic leukemia deletion
   66::177     4e-04  30%  196 aa  CLLD6_BOVIN RecName: Full=Chronic lymphocytic leukemia deletion
  107::256     5e-04  29%  360 aa  SPSB3_XENTR RecName: Full=SPRY domain-containing SOCS box protein
  118::256     5e-04  32%  354 aa  SPSB3_MOUSE RecName: Full=SPRY domain-containing SOCS box protein
  160::238     5e-04  39%  258 aa  FBSP1_ANOGA RecName: Full=F-box/SPRY domain-containing protein 1;
  361::432     6e-04  40%  825 aa  HNRPU_HUMAN RecName: Full=Heterogeneous nuclear ribonucleoprotein
  101::198     6e-04  24%  376 aa  DAPE_SHEWM RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    1::621

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           KMAAATADPGAGNPQXXXXXXXXXXXXXXXXXEQELSRRLQRLYPAVNQQETPLPRSWSPKDKYNYIGLS
RBP10_HUMAN     -MAAATADPGAGNPQXXXXXXXXXXXXXXXXXEQELSRRLQRLYPAVNQQETPLPRSWSPKDKYNYIGLS
RBP10_BOVIN     -MAAATADPGAGSPQVGDSSGGATGCGLPSPGEQELSRRLQRLYPAVNQHETPLPRSWSPKDKYNYIGLS
RBP10_MOUSE     KMAAATADPGAGNPQAXXXXXXXXXXXXXXXXEQELSRRLQRLYPAVNQHETPLPRSWSPKDKYNYIGLS
RBP10_DANRE     --------------------------------EHELNERLKRLYPAVNEEETPLPRSWSPKDKYSYIGLS
RANB9_DANRE     --------------------------------EKELNQRLRRLYPAVNEQETPLPRSWSPKDKFSYIGLS
RANB9_MOUSE     --------------------------------EKELQRRLKRLYPAVDEQETPLPRSWSPKDKFSYIGLS
RANB9_HUMAN     --------------------------------EKELQRRLKRLYPAVDEQETPLPRSWSPKDKFSYIGLS
RANB9_XENLA     --------------------------------------------------------------KCSYLGLS
RANB9_XENTR     --------------------------------------------------------------KCSYLGLS
RBP9X_DROME     ---------------------------------------LRLLYPNVNESETPLPRCWSPHDKCLSIGLS
YC5C_SCHPO      -----------------------------------------------NVTNTPIPSSWNPNDKSDSLELM
SSH4_SCLS1      ----------------------------------------------------------------------
SSH4_BOTFB      ----------------------------------------------------------------------
SSH4_ASPCL      ----------------------------------------------------------------------
SSH4_NEOFI      ----------------------------------------------------------------------
SPRY3_HUMAN     ----------------------------------------------------------------------
SSH4_ASPFU      ----------------------------------------------------------------------
PYK1_DICDI      ----------------------------------------------------------------------
SSH4_COCIM      ----------------------------------------------------------------------
SPRY3_PONAB     ----------------------------------------------------------------------
SSH4_NEUCR      ----------------------------------------------------------------------
VID30_YEAST     ----------------------------------------------------------------------
YCRA_SCHPO      ----------------------------------------------------------------------
DDX1_DROME      ------------------------------------------------------PWTMSFFDRGNALAVT
RN123_HUMAN     ----------------------------------------------------------------------
EAR1_YEAST      ----------------------------------------------------------------------
RN123_MOUSE     ----------------------------------------------------------------------
DDX1_DICDI      ----------------------------------------------------------------------
DDX1_XENTR      ----------------------------------------------------------------------
U559_DICDI      ----------------------------------------------------------------------
U559_NEMVE      ----------------------------------------------------------------------
CT011_DANRE     ----------------------------------------------------------------------
CT011_CHICK     ----------------------------------------------------------------------
CT011_MOUSE     ----------------------------------------------------------------------
CT011_HUMAN     ----------------------------------------------------------------------
CT011_BOVIN     ----------------------------------------------------------------------
RYR3_HUMAN      ----------------------------------------------------------------------
RYR1_RABIT      ----------------------------------------------------------------------
RYR1_HUMAN      ----------------------------------------------------------------------
RYR2_RABIT      ----------------------------------------------------------------------
DDX1_RAT        ----------------------------------------------------------------------
DDX1_MOUSE      ----------------------------------------------------------------------
RYR2_HUMAN      ----------------------------------------------------------------------
RYR1_PIG        ----------------------------------------------------------------------
ASH2L_MOUSE     ----------------------------------------------------------------------
ASH2L_HUMAN     ----------------------------------------------------------------------
DDX1_PONAB      ----------------------------------------------------------------------
DDX1_MACFA      ----------------------------------------------------------------------
DDX1_HUMAN      ----------------------------------------------------------------------
DDX1_BOVIN      ----------------------------------------------------------------------
SSH4_DEBHA      ----------------------------------------------------------------------
SPSB3_HUMAN     ---------------------------------------------------------WDDLNKSSATLLS
FYV10_NEUCR     ----------------------------------------------------------------------
HNRL2_MOUSE     ----------------------------------------------------------------------
HNRL2_HUMAN     ----------------------------------------------------------------------
DDX1_XENLA      ----------------------------------------------------------------------
SPSB3_BOVIN     ---------------------------------------------------------WDDLNKSSATLLS
DDX1_CHICK      ----------------------------------------------------------------------
FYV10_CHAGB     ----------------------------------------------------------------------
ASH2_SCHPO      ----------------------------------------------------------------------
HNRL1_MOUSE     ----------------------------------------------------------------------
HNRL1_HUMAN     ----------------------------------------------------------------------
SSH4_YEAST      ----------------------------------------------------------------------
SSH4_YEAS7      ----------------------------------------------------------------------
CLLD6_RAT       ----------------------------------------------------------------------
CLLD6_MOUSE     ----------------------------------------------------------------------
CLLD6_HUMAN     ----------------------------------------------------------------------
RY44_DROME      ----------------------------------------------------------------------
NU124_SCHPO     ----------------------------------------------------------------------
CLLD6_CHICK     ----------------------------------------------------------------------
CLLD6_BOVIN     ----------------------------------------------------------------------
SPSB3_XENTR     ---------------------------------------------------------WDDCSKSTATVLS
SPSB3_MOUSE     --------------------------------------------------------------------LS
FBSP1_ANOGA     ----------------------------------------------------------------------
HNRPU_HUMAN     ----------------------------------------------------------------------
DAPE_SHEWM      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QGNLRVHYKGHGKNHKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPGWDKHS
RBP10_HUMAN     QGNLRVHYKGHGKNHKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPGWDKHS
RBP10_BOVIN     QGNLRVHYKGHGKNHKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPGWDKHS
RBP10_MOUSE     QGNLRVHYKGHGKNHKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPGWDKHS
RBP10_DANRE     QNNLRVHYKGHGKNHKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPGWDKHS
RANB9_DANRE     QNNLRVHYKGHGKTPKDAASVRATHPIPAACGVYYFEVKIISKGRDGYMGIGLSAQGVNMNRLPGWDKHS
RANB9_MOUSE     QNNLRVHYKGHGKTPKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPGWDKHS
RANB9_HUMAN     QNNLRVHYKGHGKTPKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPGWDKHS
RANB9_XENLA     HGNLRVHYKGHGKTSKDAASVRSTHPIPAACGIFYFEVKIISKGRDGYMGIGLSTQGVNLNRLPGWDKHS
RANB9_XENTR     HGNLRVHYKGHGKTSKDAASVRSTHPIPAACGIFYFEVKIISKGRDGYMGIGLSTQGVNLSRLPGWDKHS
RBP9X_DROME     QNNLRVTYKGVGKQHSDAASVRTAYPIPSSCGLYYFEVRIISKGRNGYMGIGLTAQQFRMNRLPGWDKQS
YC5C_SCHPO      NNNMGVYFFGPGTEH-DAASVKADHAIPSNTSIYYYEIQILSRGKEGKMGVGFCRKSMQTNRLPGCTAES
SSH4_SCLS1      -------------------------PVPKQNEVYYWESKIYDKPENTLISIGVATKPYPLFRLPGWHKYS
SSH4_BOTFB      -------------------------PVPKQNEVYYWESKIYDKPENTLISIGVATKPYPLFRLPGWHKYS
SSH4_ASPCL      -------------------SVQTNLPVPKQNDVYYWEAKIYDKPENTLVSVGMTTKPYPLFRLPGFHKYS
SSH4_NEOFI      -------------------SVQTNLPVPKQNDVYYWEAKIYEKPESTHISIGMTTKPYPLFRLPGFHKTS
SPRY3_HUMAN     -----LEYLGKGKSIVDVGLAQARHPLSTRS--HYFEVEIVDPGEKCYIALGLARKDYPKNRHPGWSRGS
SSH4_ASPFU      -------------------SVQTNLPVPKQNDVYYWEAKIYEKPESTLISIGMTTKPYPLFRLPGFHKTS
PYK1_DICDI      --------------------VRATQPFGE--GFCYFEV-IIDQLDKGQLSIGLANLEYPTFYHVGWMPRS
SSH4_COCIM      -------------------SVQSNLPVPKQNEVYYWEAKIYDKPETSLISIGMTTKPYPLFRLPGFHKTS
SPRY3_PONAB     -----LEYLGKGKSIVDVGLAQARHPLSTRS--HYFEVEIVDPGEKCYIALGLARKDYPKNRHPGWSRGS
SSH4_NEUCR      -------------------TVMSNLPVPKQNEVYYWEAKIYDKPENTLISIGMATKPYPLFRLPGFHKYS
VID30_YEAST     ----------------------------------------------GVSAMSLNVDGINKCQKYGFDLNV
YCRA_SCHPO      -------------------------PLQRINEVYYFEVKLLDVPIDTLVSIGLATKPYPPFRLPGWNFWS
DDX1_DROME      PDGLRCQ----SREFKEWHGCRATTGVRGK-GKFYFEATVTD---EGLCRVGWSTQQANLDL--GTCRMG
RN123_HUMAN     --------------HSNFGTIRSTTCVYK--GKWLYEVLISSQG---LMQIGWCTISCRFNQEEGGDTHS
EAR1_YEAST      -------------NYNYDASISTNLPIPCINKVYYCEFKIVSKG---VISFGLSTQPYPYFRLPGRHHHS
RN123_MOUSE     --------------HSNFGTIRSTTCVYK--GKWVYEVLISSQG---LMQIGWCTINCRFNQEEGGDTHS
DDX1_DICDI      ----------------DWCGIKATKGISS--GKFYYESIVRDEGLCR-IGFALKKSSRNI----GTDKFS
DDX1_XENTR      ----------------------------------------------------------------------
U559_DICDI      ----------------------------------------------------------------------
U559_NEMVE      ----------------------------------------------------------------------
CT011_DANRE     ----------------------------------------------------------------------
CT011_CHICK     ----------------------------------------------------------------------
CT011_MOUSE     ----------------------------------------------------------------------
CT011_HUMAN     ----------------------------------------------------------------------
CT011_BOVIN     ----------------------------------------------------------------------
RYR3_HUMAN      -------------------------------GKWYFEFEVVTGGD---MRVGWARPGCRPDVELGADDQA
RYR1_RABIT      ---------------------RAEKSYTVQSGRWYFEFEAVTTGE---MRVGWARPELRPDVELGADELA
RYR1_HUMAN      ---------------------RAEKSYTVQSGRWYFEFEAVTTGE---MRVGWARPELRPDVELGADELA
RYR2_RABIT      ---------------------RAEKTYAVKAGRWYFEFEAVTSGD---MRVGWSRPGCQPDQELGSDERA
DDX1_RAT        ----------------------------------------------------------------------
DDX1_MOUSE      ----------------------------------------------------------------------
RYR2_HUMAN      ---------------------RAEKTYAVKAGRWYFEFETVTAGD---MRVGWSRPGCQPDQELGSDERA
RYR1_PIG        ---------------------RAEKSYAVQSGRWYFEFEAVTTGE---MRVGWARPELRPDVELGADELA
ASH2L_MOUSE     ---------------KGYSMVRASHGVRK--GAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFS
ASH2L_HUMAN     ---------------KGYSMVRASHGVRK--GAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFS
DDX1_PONAB      ----------------------------------------------------------------------
DDX1_MACFA      ----------------------------------------------------------------------
DDX1_HUMAN      ----------------------------------------------------------------------
DDX1_BOVIN      ----------------------------------------------------------------------
SSH4_DEBHA      ----------------------------------YFEVKVFSENPNGHFAIGLVTKPYPSDRLPGYNNFS
SPSB3_HUMAN     CDNRKVSF--HMEYSCGTAAIRGTKELGE--GQHFWEIKMTSPGTDMMVGIGTSDVDLDKYRLLGRDEDS
FYV10_NEUCR     ----------------------------------------------------------------------
HNRL2_MOUSE     ----------------------------------------------------------------GEDEFS
HNRL2_HUMAN     ----------------------------------------------------------------GEDEFS
DDX1_XENLA      ----------------------------------------------------------------------
SPSB3_BOVIN     CDNRKVSF--HMEYSCGTAAIRGTKELGE--GQHFWEIKMTSPVYGTDMMVGIGTSDVDLDKLLGRDEDS
DDX1_CHICK      ----------------------------------------------------------------------
FYV10_CHAGB     ----------------------------------------------------------------------
ASH2_SCHPO      -------------------------------GEWYFEIKIEKGGGDAHVRIGVSRREAPLDAPVGYDAYS
HNRL1_MOUSE     ----------------------------------------------------------------GEEPFS
HNRL1_HUMAN     ----------------------------------------------------------------GEEPFS
SSH4_YEAST      ----------------------------------YFEVKIFRQKSNSIFSIGLTTVPYPYFRVPGMAKYS
SSH4_YEAS7      ----------------------------------YFEVKIFRQKSNSIFSIGLTTVPYPYFRVPGMAKYS
CLLD6_RAT       ----------------------------------YFEFKIQSTG---IWGIGVATQKVNLNQIPGRDMHS
CLLD6_MOUSE     ----------------------------------YFEFKIQSTG---IWGIGVATQKVNLNQIPGRDMHS
CLLD6_HUMAN     ----------------------------------YFEFKIQSTG---IWGIGVATQKVNLNQIPGRDMHS
RY44_DROME      -------------------------------GKWYFEFEVLTSGP---MRVGWARADCYPGAMLGSEDTS
NU124_SCHPO     ----------------------------------------------------------------------
CLLD6_CHICK     ----------------------------------YFEFKIQSTG---IWGIGVATQKANLNQIPGRDVHS
CLLD6_BOVIN     ----------------------------------YFEFKIQSTG---IWGIGVATQKVNLNQIPGRDVHS
SPSB3_XENTR     CDNRKVSF--HMEYSCGTAAIRGNRMLTE--GQHFWEIKMTSPVYGTDMMVGIGTSDVNLDKLLGKDAES
SPSB3_MOUSE     CDNRKVSF--HMEYSCGTAAIRGTKEL--GDGQHFWEIKMTSPVYGTDMMVGIGTSDVDLDKLLGRDEDS
FBSP1_ANOGA     --------------------------------------------------------------LLGADDQS
HNRPU_HUMAN     ------------------------------------------------IGWSLTTSGM----LLGEEEFS
DAPE_SHEWM      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           YGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINGTCFYTKNGHSLGIAFTDLPANLYPTVGLQTP
RBP10_HUMAN     YGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINGTCFYTKNGHSLGIAFTDLPANLYPTVGLQTP
RBP10_BOVIN     YGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINGTCFYTKNGHSLGIAFTDLPANLYPTVGLQTP
RBP10_MOUSE     YGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINGTCFYTKNGHSLGIAFTDLPANLYPTVGLQTP
RBP10_DANRE     YGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINNTCFYTKNGHSLGVAFTDLPPNLYPTVGLQTP
RANB9_DANRE     YGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINNTCFYTKNGHSLGIAFTDLPPNLYPTVGLQTP
RANB9_MOUSE     YGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINNTCFYTKNGHSLGIAFTDLPPNLYPTVGLQTP
RANB9_HUMAN     YGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINNTCFYTKNGHSLGIAFTDLPPNLYPTVGLQTP
RANB9_XENLA     YGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLIDNTCFYTKNGHSLGIAFTDLPPNLYPTVGLQTP
RANB9_XENTR     YGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLIDNTCFYTKNGHSLGIAFTDLPPNLYPTVGLQTP
RBP9X_DROME     YGYHXXXXXXXXXXXXXQTYGPTFTTGDVIGCCVNFVNNTCFYTKNGVDLGIAFRDLPTKLYPTVGLQTP
YC5C_SCHPO      WGYHGNSGEKFNCSKTGEAYGPEFTTGDIIGCGVNFINRTIFYTKNGAYLGVAFKKVSDVLYPVIGLKSH
SSH4_SCLS1      VAYTSTGHRRYNQPFSGPVYGPQYVQGDVIGVGYRPRTGTIFFTRNGKKLDVAHGLKSQNLFPAVGANGP
SSH4_BOTFB      VAYTSTGHRRYNQPFSGPVYGPQYVQGDVIGVGYRPRTGTIFFTRNGKKLDVAHGLKSQNLFPAVGANGP
SSH4_ASPCL      VAYSSTGHRRHNQPFASTPYGPPLSQGDVIGVGYRPRSGTIFFTRNGKKLDVVHAAKTQNFFPTVGANGP
SSH4_NEOFI      VAYLSTGHRRYNQPFSATPYGPPLAQGDVVGVGYRPRSGTIFFTRNGKKLDVVHGAKTQNFFPTVGANGP
SPRY3_HUMAN     VAYHADDGKIFHGSGVGDPFGPRCYKGDIMGC--------------------------------------
SSH4_ASPFU      VAYLSTGHRRYNQPFSASPYGPALAQGDVVGVGYRPRSGTIFFTRNGKKLDVVHGAKTQNFFPTVGANGP
PYK1_DICDI      YGYHNDDGRKFRGVNEGESYGSSYKKGDIIGCGLSFTSREIFFTKNGMYLGTAFSNVYGVFYPSVAFNEP
SSH4_COCIM      ISYQSTGHRRHNQPFTPTLYGPEFVQGDVVGVGYRPRSGTIFFTRNGKKLDVAHGLKSQNFFPTVGANGP
SPRY3_PONAB     VAYHADDGKIFHGSGVGDPFEPRCYKGDIMGC--------------------------------------
SSH4_NEUCR      VAYLSNGTRRYNQPFNATSYGPQVVQGDVIGVGYRPRSGTIFFTRNGKKLEDVVHGLKSNFFPSIGANGP
VID30_YEAST     FGYCGFDGLITNSTEQSKEYAKPFGRDDVIGCGINFIDGSIFFTKNGIHLGNAFTDLDLEFVPYVALR-P
YCRA_SCHPO      TAYVSDGTRRSNSPFTGKPYSSFYQQGDVIGVGYKPKCNRIFFTRNGRRC----AELPCNLYPTVGAIGP
DDX1_DROME      FGFGGTGKKS--NNRQFDDYGEAFGKADVIGCLLDLKNQEVSFTKNGQNLGVAFR-LPDNLYPAVVLKNA
RN123_HUMAN     YAYDGNRVRKWNVTTTN--YGKAWAAGDIVSCLIDLDDGTLSFCLNGVSLGTAFENLSRGLFPAISLSFK
EAR1_YEAST      IAYDSNGARRFNDSEQLRTLFPQCEKGDIVGIGYRSRSGTVFFTRNGHIRGWKF----QYLYPIIGSNVP
RN123_MOUSE     YAYDGNRVRKWNVTTTN--YGKAWAAGDIVSCLIDLDDGTLSFCLNGVSLGTAFENLSRGLFPAISLSFK
DDX1_DICDI      WGYGGTGKKSHESKFID--YGKPFGNNDVIGCYINFDEEIIGFTKNGQDFGEAFTSKAGIFYPALVLKNA
DDX1_XENTR      -------------------YGEEFTMHDTIGCYIDIDNGTVKYSKNGKDLGLAF-QIPAHLKNQAVFASK
U559_DICDI      ----------------------------------------------------------------------
U559_NEMVE      ----------------------------------------------------------------------
CT011_DANRE     ----------------------------------------------------------------------
CT011_CHICK     ----------------------------------------------------------------------
CT011_MOUSE     ----------------------------------------------------------------------
CT011_HUMAN     ----------------------------------------------------------------------
CT011_BOVIN     ----------------------------------------------------------------------
RYR3_HUMAN      FVFEGNRGQRW-HQGSGY-FGRTWQPGDVVGCMINLDDASMIFTLNGELL--------------------
RYR1_RABIT      YVFNGHRGQRWHLGS--EPFGRPWQSGDVVGCMIDLTENTIIFTLNGEVLETAFREIEIGFLPVCSL-GP
RYR1_HUMAN      YVFNGHRGQRWHLGS--EPFGRPWQPGDVVGCMIDLTENTIIFTLNGEVLETAFREIEIGFLPVCSL-GP
RYR2_RABIT      FAFDGFKAQRWHQGN--EHYGRSWQAGDVVGCMVDMNEHTMMFTLNGEIL--------------------
DDX1_RAT        -------------------YGEEFTMHDTIGCYLDIDKGHVKFSKNGKDLGLAF-EIPAHLFPACVLKNA
DDX1_MOUSE      -------------------YGEEFTMHDTIGCYLDIDKGHVKFSKNGKDLGLAF-EIPAHLFPACVLKNA
RYR2_HUMAN      FAFDGFKAQRWHQGN--EHYGRSWQAGDVVGCMVDMNEHTMMFTLNGEIL--------------------
RYR1_PIG        YVFNGHRGQRWHLGS--ELFGRPWQSGDVVGCMIDLTENTIIFTLNGEVLETAFRDIEVGFLPVCSL-GP
ASH2L_MOUSE     YSWRSKKGTKFHQS-IGKHYSSGYGQGDVLGFYINLPEDT------------------------------
ASH2L_HUMAN     YSWRSKKGTKFHQS-IGKHYSSGYGQGDVLGFYINLPEDT------------------------------
DDX1_PONAB      -------------------YGEEFTMHDTIGCYLDIDKGHVKFSKNGKDLGLAF-EIPPHLFPACVLKNA
DDX1_MACFA      -------------------YGEEFTMHDTIGCYLDIDKGHVKFSKNGKDLGLAF-EIPPHLFPACVLKNA
DDX1_HUMAN      -------------------YGEEFTMHDTIGCYLDIDKGHVKFSKNGKDLGLAF-EIPPHLFPACVLKNA
DDX1_BOVIN      -------------------YGEEFTMHDTIGCYLDIDKGHVKFSKNGKDLGLAF-EIPPHLFPACVLKNA
SSH4_DEBHA      IAYESTGNLKINKQGDNSQYNPPLQQSDIVGFGYVVSTGTLFITRNGKKVMDVMRGCFIDLYPAVGCFSS
SPSB3_HUMAN     WGHHKGDKTSFSSR---------FGQGSIIGVHLDTWHGTLTFFKNRKCIGVAATKLQKRFYPMV-----
FYV10_NEUCR     ----------------------------------------------------------------------
HNRL2_MOUSE     YGF---DGRGLAENGQFEEFGQTFGENDVIGCFANFETEELSFSKNGEDLGVAFRISKESLADRALLPCK
HNRL2_HUMAN     YGF---DGRGLAENGQFEEFGQTFGENDVIGCFANFETEELSFSKNGEDLGVAFKDSLADRALLPHVLCK
DDX1_XENLA      -------------------YGEEFTMHDTIGCYLDIDNSIVKFSKNGKDLGLAF-QIPSHMFFTSCVLKN
SPSB3_BOVIN     WGHHKGDKTSFSSR---------FGQGSIIGVHLDTWHGTLTFFKNRKCIGVAATQLQKRFYPMV-----
DDX1_CHICK      -------------------YGEEFTMHDTIGCYLDIDKGQIKFSKNGKDLGLAFEFPPRNQALFAACVLK
FYV10_CHAGB     ----------------------------------------------------------------------
ASH2_SCHPO      YGLR-DLGGQKVHMSRPRNFMDSFGTGDIIGLHISL----------------------------------
HNRL1_MOUSE     YGYGGTGKKS--TNSRFENYGDKFAENDVIGCFADFECGNLSFTKNGKWMGIAFRIQKQALYPHVLVKNC
HNRL1_HUMAN     YGYGGTGKKS--TNSRFENYGDKFAENDVIGCFADFECGNLSFTKNGKWMGIAFRIQKQALYPHVLVKNC
SSH4_YEAST      IAYESTGKLRINNPFTASTLLPKLEEGDTVGFGYRYKTGTIFITHNGKKLMDVTQNIGIDLFIGIG----
SSH4_YEAS7      IAYESTGKLRINNPFTASTLLPKLEEGDTVGFGYRYKTGTIFITHNGKKLMDVTQNIGIDLFIGIG----
CLLD6_RAT       LVMRNDGALYHNNEEKNRPANSLPQEGDVVGITYDHVELNVYL--NGKNMHCPASGIRGTVYPVVYVD-D
CLLD6_MOUSE     LVMRNDGALYHNNEEKNRPANSLPQEGDVVGITYDHVELNVYL--NGKNMHCPASGIRGTVYPVVYVD-D
CLLD6_HUMAN     LVMRNDGALYHNNEEKNRPANSLPQEGDVVGITYDHVELNVYL--NGKNMHCPASGIRGTVYPVVYVD-D
RY44_DROME      WAF---DGHNVTKAGSIEHFGVRYEAGDVIGCFIDVKEQTISFSLNGELL--------------------
NU124_SCHPO     ----------------------------------------------------------------------
CLLD6_CHICK     LVMRNDGALYYNNEEKNRPANSLPQEGDVVGITYDHVELNVYL--NGKNMHCPASGIRGTVYPVVYVD-D
CLLD6_BOVIN     LVMRNDGALYHNNEEKNRPANSLPQEGDVVGITYDHVELNVYL--NGKNMHCPASGIRGTVYPVVYVD-D
SPSB3_XENTR     WGYTGLLQHK----GDKSNFSSRFGQGSIIGVHLDTWHGVLTFYKNRKCIGVAATQLNKKLFPMV-----
SPSB3_MOUSE     WGHHKGDKTSFSSR---------FGQGSIIGVHLDTWHGTLTFFKNRKCIGVAATRLQRRFYPMV-----
FBSP1_ANOGA     WGWHNGDAHGIYPLLNN---APKYKVGERIRVILDCDENTLSFEKNYEFLGVAFTDLPKNFYPTV-----
HNRPU_HUMAN     YGY-SLKGIKTCNCET-EDYGEKFDENDVITCFANFESDEVSYAKNGQDLGVAF----------------
DAPE_SHEWM      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GEIVDANFGQQPFLFDIEDYMREWRAKVQGTVHCFPISARLGEWQAVLQNMVSSYLVHHGYCATATAFAR
RBP10_HUMAN     GEIVDANFGQQPFLFDIEDYMREWRAKVQGTVHCFPISARLGEWQAVLQNMVSSYLVHHGYCATATAFAR
RBP10_BOVIN     GEIVDANFGQQPFLFDIEDYMREWRAKVQGTVHCFPISARLGEWQAVLQNMVSSYLVHHGYCATATAFAR
RBP10_MOUSE     GEIVDANFGQQPFLFDIEDYMREWRAKVQGTVHGFPISARLGEWQAVLQNMVSSYLVHHGYCSTATAFAR
RBP10_DANRE     GEIVDANFGQQPFVFDIEDYMSEWRAKIHSMIARFPIGERLGDWQAVLQNMVSSYLVHHGYCATAMAFAR
RANB9_DANRE     GEVVDANFGQHPFVFDIEDYMREWRTKIQSQIDRFPIGEREGEWQAMIQKMVASYLVHHSYCATAEAFAK
RANB9_MOUSE     GEVVDANFGQHPFVFDIEDYMREWRTKIQAQIDRFPIGDREGEWQTMIQKMVSSYLVHHGYCATAEAFAR
RANB9_HUMAN     GEVVDANFGQHPFVFDIEDYMREWRTKIQAQIDRFPIGDREGEWQTMIQKMVSSYLVHHGYCATAEAFAR
RANB9_XENLA     GEVVDANFGQSPFVFDIEDYIREWRSKIQAQIERFPVA---GEWQSMIQRMVSSYLVHHGYCSTAEAFAK
RANB9_XENTR     GEVVDANFGQSPFVFDIEDYIREWRTKIQAQIERFPVG---GEWQSMIQRMVSSYLVHHGYCSTAEAFAK
RBP9X_DROME     GEEVDANFGQEPFKFDIVDMMKEMRSNVLRKIDRYPHLLETPE--NLMNRLVSTYLVHNAFSKTAEAFNG
YC5C_SCHPO      GEHVEVNFGQNPFLYDIDYAIQMEKNKLFEQATKSPKQEELKQRQEFLNELISSFLLNNGFVETAKKFC-
SSH4_SCLS1      C-TVHVNFGQSGFVF-IEANVKKW----------------------------------------------
SSH4_BOTFB      C-TVHVNFGQSGFVF-IEANVKKW----------------------------------------------
SSH4_ASPCL      C-TVHVNFGQMGFVF-IEANVKKW----------------------------------------------
SSH4_NEOFI      C-TVHVNFGQMGFVF-IEANVKKW----------------------------------------------
SPRY3_HUMAN     ----------------------------------------------------------------------
SSH4_ASPFU      C-TVHVNFGQMGFVF-IEANVKKW----------------------------------------------
PYK1_DICDI      GISITGVFG-PPFKF-------------------------------------------------------
SSH4_COCIM      C-TVHVNFGQLGFVF-IEANVKKW----------------------------------------------
SPRY3_PONAB     ----------------------------------------------------------------------
SSH4_NEUCR      C-IVHVNFGQAGFVF-IEANVKKW----------------------------------------------
VID30_YEAST     GNSIKTNFGNEDFVFDIIGYQDKWKS---------------GSLPNTLNVMINDYLIHEGLVDVAKGFLR
YCRA_SCHPO      CTL-HVNLGQAGYVF-IEANIKKWR---------------------------------------------
DDX1_DROME      E--MQFNFGKTDFKY-------------------------------------------------------
RN123_HUMAN     -ESVAFNFGSRPLRYPVAGY--------------------------------------------------
EAR1_YEAST      CQI-HVNFGTYGFVY-IEANVKKW----------------------------------------------
RN123_MOUSE     -ESVAFNFGSRPLRYPVQDPPFADLVRAQRLLGCFPVEGRLSEWQLQGQPTVLLTLAH------------
DDX1_DICDI      E--MEFNFGSKPMKHDLKGY--------------------------------------------------
DDX1_XENTR      NAELKFNFGEEDFKFPPKD---------------------------------------------------
U559_DICDI      -----------------------------------------------LNKLVMNYLVIEGYQEAAAKFQE
U559_NEMVE      --------------------------------------------RAEMNRLIMDYLVTEGYKEAAEKFRI
CT011_DANRE     --------------------------------------------RADMNRLIMNYLVTEGFKEAAEKFRM
CT011_CHICK     --------------------------------------------RADMNRLIMNYLVTEGFKEAAEKFRM
CT011_MOUSE     --------------------------------------------RADMNRLIMNYLVTEGFKEAAEKFRM
CT011_HUMAN     --------------------------------------------RADMNRLIMNYLVTEGFKEAAEKFRM
CT011_BOVIN     --------------------------------------------RADMNRLIMNYLVTEGFKEAAEKFRM
RYR3_HUMAN      ----------------------------------------------------------------------
RYR1_RABIT      GQVGHLNLGQ------------------------------------------------------------
RYR1_HUMAN      GQVGHLNLGQ------------------------------------------------------------
RYR2_RABIT      ----------------------------------------------------------------------
DDX1_RAT        E--LKFNFGEEEFKFPPKD---------------------------------------------------
DDX1_MOUSE      E--LKFNFGEEEFKFPPKD---------------------------------------------------
RYR2_HUMAN      ----------------------------------------------------------------------
RYR1_PIG        GQVGHLNLGQ------------------------------------------------------------
ASH2L_MOUSE     ----------------------------------------------------------------------
ASH2L_HUMAN     ----------------------------------------------------------------------
DDX1_PONAB      E--LKFNFGEEEFKFPPKD---------------------------------------------------
DDX1_MACFA      E--LKFNFGEEEFKFPPKD---------------------------------------------------
DDX1_HUMAN      E--LKFNFGEEEFKFPPKD---------------------------------------------------
DDX1_BOVIN      E--LKFNFGEEEFKFPPKD---------------------------------------------------
SSH4_DEBHA      NAKFQVNLGQLGFVW-IEANVRKY----------------------------------------------
SPSB3_HUMAN     ----------------------------------------------------------------------
FYV10_NEUCR     -----------------------------------------------LDRLLVDYMLRHGYNTSAQALAN
HNRL2_MOUSE     NCVVELNFGQK-----------------------------------------------------------
HNRL2_HUMAN     NCVVELNFGQK-----------------------------------------------------------
DDX1_XENLA      AEL-KFNFGEEDFKFPPKD---------------------------------------------------
SPSB3_BOVIN     ----------------------------------------------------------------------
DDX1_CHICK      NAELKFNFGEEDFKFPPKD---------------------------------------------------
FYV10_CHAGB     -----------------------------------------------LDRLLVDYMLRHGYDSSAIALAD
ASH2_SCHPO      ----------------------------------------------------------------------
HNRL1_MOUSE     A--VEFNFGQR-----------------------------------------------------------
HNRL1_HUMAN     A--VEFNFGQR-----------------------------------------------------------
SSH4_YEAST      ----------------------------------------------------------------------
SSH4_YEAS7      ----------------------------------------------------------------------
CLLD6_RAT       SAILDCQFSE------------------------------------------------------------
CLLD6_MOUSE     SAILDCQFSE------------------------------------------------------------
CLLD6_HUMAN     SAILDCQFSE------------------------------------------------------------
RY44_DROME      ----------------------------------------------------------------------
NU124_SCHPO     ----------------------------------------------------------------------
CLLD6_CHICK     SAILDCQFSE------------------------------------------------------------
CLLD6_BOVIN     SAILDCQFSE------------------------------------------------------------
SPSB3_XENTR     ----------------------------------------------------------------------
SPSB3_MOUSE     ----------------------------------------------------------------------
FBSP1_ANOGA     ----------------------------------------------------------------------
HNRPU_HUMAN     ----------------------------------------------------------------------
DAPE_SHEWM      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           MTETPIQEEQASIKNRQKIQKLVLEGRVGEAIETTQRFYPGLLEHNPNLLFMLKCRQFVEMVNGTDSEVR
RBP10_HUMAN     MTETPIQEEQASIKNRQKIQKLVLEGRVGEAIETTQRFYPGLLEHNPNLLFMLKCRQFVEMVNGTDSEVR
RBP10_BOVIN     MTETPIQEEQASIKNRQKIQKLVLEGRVGEAIETTQRFYPGLLEHNPNLLFMLKCRQFVEMVNGTDSEVR
RBP10_MOUSE     MTETPIQEEQASIKNRQKIQKLVLEGRVGEAIETTQRFYPGLLEHNPNLLFMLKCRQFVEMVNGTDSEVR
RBP10_DANRE     ATETMIQEDQTSIKNRQRIQKLVLAGRVGEAIDATQQLYPGLLEHNPNLLFMLKCRQFVEMVNGTDSEVR
RANB9_DANRE     STDQAVHEELASIKNRQKIQKLVLSGRMGEAIETTQQLYPSLLERNPDLLFMLKVRQFIEMVNGTDSEVR
RANB9_MOUSE     STDQTVLEELASIKNRQRIQKLVLAGRMGEAIETTQQLYPSLLERNPNLLFTLKVRQFIEMVNGTDSEVR
RANB9_HUMAN     STDQTVLEELASIKNRQRIQKLVLAGRMGEAIETTQQLYPSLLERNPNLLFTLKVRQFIEMVNGTDSEVR
RANB9_XENLA     STDQTVQEELASIKNRQRIQKLVLSGRMGEAIETTQQLYPSLLERNPNLLFTLKVRQFIEMVNGTDSEVR
RANB9_XENTR     STDQTVQEELASIKNRQRIQKLVLSGRMGEAIETTQQLYPSLLERNPNLLFTLKVRQFIEMVNGTDSEVR
RBP9X_DROME     YTNQTFNEDLASIKTRQKIIKLILTGKMSQAIEHTLRSFPGLLENNKNLWFALKCRQFIEMINGADIE--
YC5C_SCHPO      ----PENTEVSDASIRKEISSMLANGQLDLAMTKIDCQYPVAIQECPDLIMSLRFLRFLQLVKVTHDQ--
SSH4_SCLS1      ----------------------------------------------------------------------
SSH4_BOTFB      ----------------------------------------------------------------------
SSH4_ASPCL      ----------------------------------------------------------------------
SSH4_NEOFI      ----------------------------------------------------------------------
SPRY3_HUMAN     ----------------------------------------------------------------------
SSH4_ASPFU      ----------------------------------------------------------------------
PYK1_DICDI      ----------------------------------------------------------------------
SSH4_COCIM      ----------------------------------------------------------------------
SPRY3_PONAB     ----------------------------------------------------------------------
SSH4_NEUCR      ----------------------------------------------------------------------
VID30_YEAST     HNERQIMKEERMVKIRQELRYLINKGQISKCINYIDNEIPDLLKNNLELVFELKLANYLVMIKKSSSK--
YCRA_SCHPO      ----------------------------------------------------------------------
DDX1_DROME      ----------------------------------------------------------------------
RN123_HUMAN     ----------------------------------------------------------------------
EAR1_YEAST      ----------------------------------------------------------------------
RN123_MOUSE     ----------------------------------------------------------------------
DDX1_DICDI      ----------------------------------------------------------------------
DDX1_XENTR      ----------------------------------------------------------------------
U559_DICDI      ESSTQTTVDLASIADRMAIRSAIQCGDVEKGIEIVNDLNPEILDTNPQLYFHLQQQKLIELI--------
U559_NEMVE      ESGTQPTAPLDSLDDRIKIREAVQKGDLEQAVSMTNKLNPDILDSNQQLYFHLQQQRLIELIREKDIE--
CT011_DANRE     ESGIEPNVDLDSLDERIKIREMVLKGQIQEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRLRETE--
CT011_CHICK     ESGIEPSVDLETLDERIKIREMILKGQIQEAISLINSLHPELLDTNRYLYFHLQQQHLIELIRQRETE--
CT011_MOUSE     ESGIEPSVDLETLDERIKIREMILKGQIQEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETE--
CT011_HUMAN     ESGIEPSVDLETLDERIKIREMILKGQIQEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETE--
CT011_BOVIN     ESGIEPSVDLETLDERIKIREMILKGQIQEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETE--
RYR3_HUMAN      ----------------------------------------------------------------------
RYR1_RABIT      ----------------------------------------------------------------------
RYR1_HUMAN      ----------------------------------------------------------------------
RYR2_RABIT      ----------------------------------------------------------------------
DDX1_RAT        ----------------------------------------------------------------------
DDX1_MOUSE      ----------------------------------------------------------------------
RYR2_HUMAN      ----------------------------------------------------------------------
RYR1_PIG        ----------------------------------------------------------------------
ASH2L_MOUSE     ----------------------------------------------------------------------
ASH2L_HUMAN     ----------------------------------------------------------------------
DDX1_PONAB      ----------------------------------------------------------------------
DDX1_MACFA      ----------------------------------------------------------------------
DDX1_HUMAN      ----------------------------------------------------------------------
DDX1_BOVIN      ----------------------------------------------------------------------
SSH4_DEBHA      ----------------------------------------------------------------------
SPSB3_HUMAN     ----------------------------------------------------------------------
FYV10_NEUCR     EREMHDLVDVETFLTMSKIRESLENGSVTEALAWCNDNKKELRKLQSNLEFLLRCQQYIELINTPSKSVE
HNRL2_MOUSE     ----------------------------------------------------------------------
HNRL2_HUMAN     ----------------------------------------------------------------------
DDX1_XENLA      ----------------------------------------------------------------------
SPSB3_BOVIN     ----------------------------------------------------------------------
DDX1_CHICK      ----------------------------------------------------------------------
FYV10_CHAGB     ERGMRDLVDIDTFVVMSRIRKSLEGGSVQEALNWCNENKKELRKMQSNLEFLLRCQQYIEMMR-TDSPAK
ASH2_SCHPO      ----------------------------------------------------------------------
HNRL1_MOUSE     ----------------------------------------------------------------------
HNRL1_HUMAN     ----------------------------------------------------------------------
SSH4_YEAST      ----------------------------------------------------------------------
SSH4_YEAS7      ----------------------------------------------------------------------
CLLD6_RAT       ----------------------------------------------------------------------
CLLD6_MOUSE     ----------------------------------------------------------------------
CLLD6_HUMAN     ----------------------------------------------------------------------
RY44_DROME      ----------------------------------------------------------------------
NU124_SCHPO     -------------------------GRAGTKSLLTPELTPHYLGKSPRII-RVSNRSHVRTIDGIEEKVH
CLLD6_CHICK     ----------------------------------------------------------------------
CLLD6_BOVIN     ----------------------------------------------------------------------
SPSB3_XENTR     ----------------------------------------------------------------------
SPSB3_MOUSE     ----------------------------------------------------------------------
FBSP1_ANOGA     ----------------------------------------------------------------------
HNRPU_HUMAN     ----------------------------------------------------------------------
DAPE_SHEWM      -----------------------MKGSLAAMVVATERFVEKHPDHNGSIAFLITSDEEGPFINGTTRVID


                         .         .         .         .         *         .         .:420
query           SLSSRSPKSQDSYPGSPSLSPRHGPSSSHMHNTGADSPSCSNGVASTKSKQNHSKYPAPXXXXXXXXXXX
RBP10_HUMAN     SLSSRSPKSQDSYPGSPSLSPRHGPSSSHMHNTGADSPSCSNGVASTKSKQNHSKYPAPXXXXXXXXXXX
RBP10_BOVIN     SLSSRSPKSQDSYPGSPSLSPRHGPTSSHTHNTGADSPSCSNGVASTKSKQNHSKYPAPXXXXXXXXXXX
RBP10_MOUSE     SLSSRSPKSQDSYPGSPSLSPRHGPSSSHIHNTGADSPSCSNGVASTKNKQNHSKYPAPXXXXXXXXXXX
RBP10_DANRE     CFSVRSPKSQDSYPGSPNMSPRHGATNPHLHSTGADSPTCSNGVTPPNKNKSHNKYTG----IXXXXXXX
RANB9_DANRE     CLGGRSPKSQDSYPGSPRLSPVHKPSSSQAYQTGFDSNYC-NGVSSSKGHTSHSHKSCPPTLSSPELGVL
RANB9_MOUSE     CLGGRSPKSQDXXXXXXXLAP---GKSSTAHFSGFE--SCSNGVISNKAHQSHSKH--------------
RANB9_HUMAN     CLGGRSPKSQDXXXXXXXXXXXXXXXXXHIHNLASGKESCSNGVISNKAHQSY-----------------
RANB9_XENLA     CLGNRSLKSPDGCLGSDS--------------------NCSNGIISNKAHQTHCHSKS------------
RANB9_XENTR     CLGNRSLKSLXXXXXXXXXXXXXXXXXK-AHQTHCHSKSQSSNLNVTELNS-------------------
RBP9X_DROME     ----------------------------------------------------------------------
YC5C_SCHPO      ----------------------------------------------------------------------
SSH4_SCLS1      ----------------------------------------------------------------------
SSH4_BOTFB      ----------------------------------------------------------------------
SSH4_ASPCL      ----------------------------------------------------------------------
SSH4_NEOFI      ----------------------------------------------------------------------
SPRY3_HUMAN     ----------------------------------------------------------------------
SSH4_ASPFU      ----------------------------------------------------------------------
PYK1_DICDI      ----------------------------------------------------------------------
SSH4_COCIM      ----------------------------------------------------------------------
SPRY3_PONAB     ----------------------------------------------------------------------
SSH4_NEUCR      ----------------------------------------------------------------------
VID30_YEAST     ----------------------------------------------------------------------
YCRA_SCHPO      ----------------------------------------------------------------------
DDX1_DROME      ----------------------------------------------------------------------
RN123_HUMAN     ----------------------------------------------------------------------
EAR1_YEAST      ----------------------------------------------------------------------
RN123_MOUSE     ----------------------------------------------------------------------
DDX1_DICDI      ----------------------------------------------------------------------
DDX1_XENTR      ----------------------------------------------------------------------
U559_DICDI      ----------------------------------------------------------------------
U559_NEMVE      ----------------------------------------------------------------------
CT011_DANRE     ----------------------------------------------------------------------
CT011_CHICK     ----------------------------------------------------------------------
CT011_MOUSE     ----------------------------------------------------------------------
CT011_HUMAN     ----------------------------------------------------------------------
CT011_BOVIN     ----------------------------------------------------------------------
RYR3_HUMAN      ----------------------------------------------------------------------
RYR1_RABIT      ----------------------------------------------------------------------
RYR1_HUMAN      ----------------------------------------------------------------------
RYR2_RABIT      ----------------------------------------------------------------------
DDX1_RAT        ----------------------------------------------------------------------
DDX1_MOUSE      ----------------------------------------------------------------------
RYR2_HUMAN      ----------------------------------------------------------------------
RYR1_PIG        ----------------------------------------------------------------------
ASH2L_MOUSE     ----------------------------------------------------------------------
ASH2L_HUMAN     ----------------------------------------------------------------------
DDX1_PONAB      ----------------------------------------------------------------------
DDX1_MACFA      ----------------------------------------------------------------------
DDX1_HUMAN      ----------------------------------------------------------------------
DDX1_BOVIN      ----------------------------------------------------------------------
SSH4_DEBHA      ----------------------------------------------------------------------
SPSB3_HUMAN     ----------------------------------------------------------------------
FYV10_NEUCR     AITHAKAPFQEQYP--------------------------------------------------------
HNRL2_MOUSE     ----------------------------------------------------------------------
HNRL2_HUMAN     ----------------------------------------------------------------------
DDX1_XENLA      ----------------------------------------------------------------------
SPSB3_BOVIN     ----------------------------------------------------------------------
DDX1_CHICK      ----------------------------------------------------------------------
FYV10_CHAGB     ----------------------------------------------------------------------
ASH2_SCHPO      ----------------------------------------------------------------------
HNRL1_MOUSE     ----------------------------------------------------------------------
HNRL1_HUMAN     ----------------------------------------------------------------------
SSH4_YEAST      ----------------------------------------------------------------------
SSH4_YEAS7      ----------------------------------------------------------------------
CLLD6_RAT       ----------------------------------------------------------------------
CLLD6_MOUSE     ----------------------------------------------------------------------
CLLD6_HUMAN     ----------------------------------------------------------------------
RY44_DROME      ----------------------------------------------------------------------
NU124_SCHPO     TFEPRKPKQKQDYTNSPTLFKRHDELSLKSLNSLHPSSALSKKLGSTSQHQ-------------------
CLLD6_CHICK     ----------------------------------------------------------------------
CLLD6_BOVIN     ----------------------------------------------------------------------
SPSB3_XENTR     ----------------------------------------------------------------------
SPSB3_MOUSE     ----------------------------------------------------------------------
FBSP1_ANOGA     ----------------------------------------------------------------------
HNRPU_HUMAN     ----------------------------------------------------------------------
DAPE_SHEWM      TLEARNEKITWSLVGEPSSTHKLGDIVKNGRRGSLTGNLTINGI------QGHVAYP-------------


                         .         .         +         .         .         .         .:490
query           XXXXXXXXXXXXXXXXXTKSQHHSSTSNQETSDSEMEMEAEHYPNGVLGSMSTRIVNGAYKHEDLQTDES
RBP10_HUMAN     XXXXXXXXXXXXXXXXXTKSQHHSSTSNQETSDSEMEMEAEHYPNGVLGSMSTRIVNGAYKHEDLQTDES
RBP10_BOVIN     XXXXXXXXXXXXXXXXXTKSQPHSSTSNQETSDSEMEMEAEHYPNGVLESMSTRIVNGAYKHEDLQTDES
RBP10_MOUSE     XXXXXXXXXXXXXXXXXTKSQPHSSTSNQETSDSEMEMEAEHYPNGVLESVSTRIVNGAYKHDDLQTDES
RBP10_DANRE     XXXXXXXXXXXXXXXXXTKSQPHSATSNQETSDSEMEIEAEHYSNGVTES-STRIMNGTYKHQELQADDN
RANB9_DANRE     ----------------------NGSRGQQTIVSSEVEMEVDHFSNGVSESSSNGFLNGSSTHGTEQEDDM
RANB9_MOUSE     ------QLSSLTVPELNSLNVSRSQQVNNFTS-NDVDMETDHYSNGVGETSSNGFLNGSSKHDHEMEDEM
RANB9_HUMAN     CHSNKHQSSNLNVPELNSINMSRSQQVNNFTS-NDVDMETDHYSNGVGETSSNGFLNGSSKHDHEMEDEM
RANB9_XENLA     ----QSSNLNVTELNSINMTMSHQLNS---YSSNDVEMETDHYSNGFSASTSNGFLNGSSRHEELEECDT
RANB9_XENTR     --------------INMTMSHQLNSYSS-----NDVEMETDHYSNGFSASTSNGFLNGSSRHEELEECDT
RBP9X_DROME     -------------------------------------------------------------------DEE
YC5C_SCHPO      ----------------------------------------------------------------------
SSH4_SCLS1      ----------------------------------------------------------------------
SSH4_BOTFB      ----------------------------------------------------------------------
SSH4_ASPCL      ----------------------------------------------------------------------
SSH4_NEOFI      ----------------------------------------------------------------------
SPRY3_HUMAN     ----------------------------------------------------------------------
SSH4_ASPFU      ----------------------------------------------------------------------
PYK1_DICDI      ----------------------------------------------------------------------
SSH4_COCIM      ----------------------------------------------------------------------
SPRY3_PONAB     ----------------------------------------------------------------------
SSH4_NEUCR      ----------------------------------------------------------------------
VID30_YEAST     ----------------------------------------------------------------------
YCRA_SCHPO      ----------------------------------------------------------------------
DDX1_DROME      ----------------------------------------------------------------------
RN123_HUMAN     ----------------------------------------------------------------------
EAR1_YEAST      ----------------------------------------------------------------------
RN123_MOUSE     ----------------------------------------------------------------------
DDX1_DICDI      ----------------------------------------------------------------------
DDX1_XENTR      ----------------------------------------------------------------------
U559_DICDI      ----------------------------------------------------------------------
U559_NEMVE      ----------------------------------------------------------------------
CT011_DANRE     ----------------------------------------------------------------------
CT011_CHICK     ----------------------------------------------------------------------
CT011_MOUSE     ----------------------------------------------------------------------
CT011_HUMAN     ----------------------------------------------------------------------
CT011_BOVIN     ----------------------------------------------------------------------
RYR3_HUMAN      ----------------------------------------------------------------------
RYR1_RABIT      ----------------------------------------------------------------------
RYR1_HUMAN      ----------------------------------------------------------------------
RYR2_RABIT      ----------------------------------------------------------------------
DDX1_RAT        ----------------------------------------------------------------------
DDX1_MOUSE      ----------------------------------------------------------------------
RYR2_HUMAN      ----------------------------------------------------------------------
RYR1_PIG        ----------------------------------------------------------------------
ASH2L_MOUSE     ----------------------------------------------------------------------
ASH2L_HUMAN     ----------------------------------------------------------------------
DDX1_PONAB      ----------------------------------------------------------------------
DDX1_MACFA      ----------------------------------------------------------------------
DDX1_HUMAN      ----------------------------------------------------------------------
DDX1_BOVIN      ----------------------------------------------------------------------
SSH4_DEBHA      ----------------------------------------------------------------------
SPSB3_HUMAN     ----------------------------------------------------------------------
FYV10_NEUCR     ----------------------------------------------------------------------
HNRL2_MOUSE     ----------------------------------------------------------------------
HNRL2_HUMAN     ----------------------------------------------------------------------
DDX1_XENLA      ----------------------------------------------------------------------
SPSB3_BOVIN     ----------------------------------------------------------------------
DDX1_CHICK      ----------------------------------------------------------------------
FYV10_CHAGB     ----------------------------------------------------------------------
ASH2_SCHPO      ----------------------------------------------------------------------
HNRL1_MOUSE     ----------------------------------------------------------------------
HNRL1_HUMAN     ----------------------------------------------------------------------
SSH4_YEAST      ----------------------------------------------------------------------
SSH4_YEAS7      ----------------------------------------------------------------------
CLLD6_RAT       ----------------------------------------------------------------------
CLLD6_MOUSE     ----------------------------------------------------------------------
CLLD6_HUMAN     ----------------------------------------------------------------------
RY44_DROME      ----------------------------------------------------------------------
NU124_SCHPO     ----------------------------------------------------------------------
CLLD6_CHICK     ----------------------------------------------------------------------
CLLD6_BOVIN     ----------------------------------------------------------------------
SPSB3_XENTR     ----------------------------------------------------------------------
SPSB3_MOUSE     ----------------------------------------------------------------------
FBSP1_ANOGA     ----------------------------------------------------------------------
HNRPU_HUMAN     ----------------------------------------------------------------------
DAPE_SHEWM      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           SMDDRHPRRQLCGGNQAATERIILFGRELQALSEQLGREYGKNLAHTEMLQDAFSLLAYSDPWSCPVGQQ
RBP10_HUMAN     SMDDRHPRRQLCGGNQAATERIILFGRELQALSEQLGREYGKNLAHTEMLQDAFSLLAYSDPWSCPVGQQ
RBP10_BOVIN     SMDDGHPRRQLCGGNQAATERIILFGRELQALSEQLGREYGKDLAHTEMLQDAFSLLAYSDPWSCPVGQQ
RBP10_MOUSE     SMDDGHPRRQLCGGNQAATERIILFGRELQALSEQLGREYGKNLAHTEMLQDAFSLLAYSDPWSCPVGHQ
RBP10_DANRE     SVDDTCSSRQLCGGNQAATERMIQFGRELQTLSEQLCRQYGKNATHKKMLQDAFSLLAYSDPWNCPVGQQ
RANB9_DANRE     EVDSTQSKRQLCGGSQAAIERMIQFGRELQSMSEHLRRERGKNSANKKMLKDAFSLLAYSDPWNSPVGYQ
RANB9_MOUSE     EVDCSQLRRQLCGGSQAAIERMIHFGRELQAMSEQLRRECGKNTANKKMLKDAFSLLAYSDPWNSPVGNQ
RANB9_HUMAN     EVDSSQLRRQLCGGSQAAIERMIHFGRELQAMSEQLRRDCGKNTANKKMLKDAFSLLAYSDPWNSPVGNQ
RANB9_XENLA     EMDTSHGRRQLCGGSQAAVERMICFGRELQAMSEQLRRERGKNATNKNMLKDAFSLLAYSDPWNSPVGYQ
RANB9_XENTR     EMDTSHGRRQLCGGSQAAVERMICFGRELQAMSEQLRRERGKNATNKNMLKDAFSLLAYSDPWNSPVGYQ
RBP9X_DROME     MDVDVSPSSRNCG---RVIEKILEFGKELSSMGQQLEKENLMTEEERQMLEDAFSLIAYSNPWSSPLGWL
YC5C_SCHPO      ----------------------------------------------------------------------
SSH4_SCLS1      ----------------------------------------------------------------------
SSH4_BOTFB      ----------------------------------------------------------------------
SSH4_ASPCL      ----------------------------------------------------------------------
SSH4_NEOFI      ----------------------------------------------------------------------
SPRY3_HUMAN     ----------------------------------------------------------------------
SSH4_ASPFU      ----------------------------------------------------------------------
PYK1_DICDI      ----------------------------------------------------------------------
SSH4_COCIM      ----------------------------------------------------------------------
SPRY3_PONAB     ----------------------------------------------------------------------
SSH4_NEUCR      ----------------------------------------------------------------------
VID30_YEAST     ----------------------------------------------------------------------
YCRA_SCHPO      ----------------------------------------------------------------------
DDX1_DROME      ----------------------------------------------------------------------
RN123_HUMAN     ----------------------------------------------------------------------
EAR1_YEAST      ----------------------------------------------------------------------
RN123_MOUSE     ----------------------------------------------------------------------
DDX1_DICDI      ----------------------------------------------------------------------
DDX1_XENTR      ----------------------------------------------------------------------
U559_DICDI      ------------------------------------------------------SLLVFEDTAKSPLSSL
U559_NEMVE      ---------------------------------------------YLEELEQTMALLAFDNPEESPFGDL
CT011_DANRE     ----------------------------------------------------------------------
CT011_CHICK     ----------------------------------------------------------------------
CT011_MOUSE     ----------------------------------------------------------------------
CT011_HUMAN     ----------------------------------------------------------------------
CT011_BOVIN     ----------------------------------------------------------------------
RYR3_HUMAN      ----------------------------------------------------------------------
RYR1_RABIT      ----------------------------------------------------------------------
RYR1_HUMAN      ----------------------------------------------------------------------
RYR2_RABIT      ----------------------------------------------------------------------
DDX1_RAT        ----------------------------------------------------------------------
DDX1_MOUSE      ----------------------------------------------------------------------
RYR2_HUMAN      ----------------------------------------------------------------------
RYR1_PIG        ----------------------------------------------------------------------
ASH2L_MOUSE     ----------------------------------------------------------------------
ASH2L_HUMAN     ----------------------------------------------------------------------
DDX1_PONAB      ----------------------------------------------------------------------
DDX1_MACFA      ----------------------------------------------------------------------
DDX1_HUMAN      ----------------------------------------------------------------------
DDX1_BOVIN      ----------------------------------------------------------------------
SSH4_DEBHA      ----------------------------------------------------------------------
SPSB3_HUMAN     ----------------------------------------------------------------------
FYV10_NEUCR     ----------------------------------------------------------------------
HNRL2_MOUSE     ----------------------------------------------------------------------
HNRL2_HUMAN     ----------------------------------------------------------------------
DDX1_XENLA      ----------------------------------------------------------------------
SPSB3_BOVIN     ----------------------------------------------------------------------
DDX1_CHICK      ----------------------------------------------------------------------
FYV10_CHAGB     ----------------------------------------------------------------------
ASH2_SCHPO      ----------------------------------------------------------------------
HNRL1_MOUSE     ----------------------------------------------------------------------
HNRL1_HUMAN     ----------------------------------------------------------------------
SSH4_YEAST      ----------------------------------------------------------------------
SSH4_YEAS7      ----------------------------------------------------------------------
CLLD6_RAT       ----------------------------------------------------------------------
CLLD6_MOUSE     ----------------------------------------------------------------------
CLLD6_HUMAN     ----------------------------------------------------------------------
RY44_DROME      ----------------------------------------------------------------------
NU124_SCHPO     ----------------------------------------------------------------------
CLLD6_CHICK     ----------------------------------------------------------------------
CLLD6_BOVIN     ----------------------------------------------------------------------
SPSB3_XENTR     ----------------------------------------------------------------------
SPSB3_MOUSE     ----------------------------------------------------------------------
FBSP1_ANOGA     ----------------------------------------------------------------------
HNRPU_HUMAN     ----------------------------------------------------------------------
DAPE_SHEWM      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           LDPIQREPVCAALNSAILESQNLPKQPPLMLALGQASECLRLMARAGLGSCSFARVDDYLH
RBP10_HUMAN     LDPIQREPVCAALNSAILESQNLPKQPPLMLALGQASECLRLMARAGLGSCSFARVDDYLH
RBP10_BOVIN     LDPIQREPVCAALNSAILESQNLPKQPPLMLALGQASECLRLMARAGLGSCSFARVDDYLH
RBP10_MOUSE     LDPIQREPVCAALNSAILESQNLPKQPPLMLALGQASECLRLMARAGLGSCSFARVDDYLH
RBP10_DANRE     LDPMQREAICSALNSAILESQNLPKQPPLMLALGQATECVQLMARVRSGSCSFARVDNFLH
RANB9_DANRE     LDSIQREPVCSTLNSAILETHNLPKQPPLALAMGQAAQCLSLMARTGSGSCAFASVDDYLH
RANB9_MOUSE     LDPIQREPVCSALNSAILETHNLPKQPPLALAMGQATQCLGLMARSGVGSCAFATVEDYLH
RANB9_HUMAN     LDPIQREPVCSALNSAILETHNLPKQPPLALAMGQATQCLGLMARSGIGSCAFATVEDYLH
RANB9_XENLA     LDPIQREHVCSSLNSAILDIHNLPKQPPLSLALEQASQCLEMMAQCGIGSCAFARVADYLH
RANB9_XENTR     LDPIQREHVCSSLNSAILDIHNLPKQPPLSLALEQASQCLEMMAQCGIGSCAFARVADYLH
RBP9X_DROME     LCPSRRESVSTTLNSAILESLNFERRPPLEYLVAHASELIKVIGQHSLGEDAFITIDD---
YC5C_SCHPO      -------------------------------------------------------------
SSH4_SCLS1      -------------------------------------------------------------
SSH4_BOTFB      -------------------------------------------------------------
SSH4_ASPCL      -------------------------------------------------------------
SSH4_NEOFI      -------------------------------------------------------------
SPRY3_HUMAN     -------------------------------------------------------------
SSH4_ASPFU      -------------------------------------------------------------
PYK1_DICDI      -------------------------------------------------------------
SSH4_COCIM      -------------------------------------------------------------
SPRY3_PONAB     -------------------------------------------------------------
SSH4_NEUCR      -------------------------------------------------------------
VID30_YEAST     -------------------------------------------------------------
YCRA_SCHPO      -------------------------------------------------------------
DDX1_DROME      -------------------------------------------------------------
RN123_HUMAN     -------------------------------------------------------------
EAR1_YEAST      -------------------------------------------------------------
RN123_MOUSE     -------------------------------------------------------------
DDX1_DICDI      -------------------------------------------------------------
DDX1_XENTR      -------------------------------------------------------------
U559_DICDI      LDHSQRQKTAGELNSAILLSQSQDKDPKL--------------------------------
U559_NEMVE      LHTSQRQKVASELNAAILEAEHKKTQPKL--------------------------------
CT011_DANRE     -------------------------------------------------------------
CT011_CHICK     -------------------------------------------------------------
CT011_MOUSE     -------------------------------------------------------------
CT011_HUMAN     -------------------------------------------------------------
CT011_BOVIN     -------------------------------------------------------------
RYR3_HUMAN      -------------------------------------------------------------
RYR1_RABIT      -------------------------------------------------------------
RYR1_HUMAN      -------------------------------------------------------------
RYR2_RABIT      -------------------------------------------------------------
DDX1_RAT        -------------------------------------------------------------
DDX1_MOUSE      -------------------------------------------------------------
RYR2_HUMAN      -------------------------------------------------------------
RYR1_PIG        -------------------------------------------------------------
ASH2L_MOUSE     -------------------------------------------------------------
ASH2L_HUMAN     -------------------------------------------------------------
DDX1_PONAB      -------------------------------------------------------------
DDX1_MACFA      -------------------------------------------------------------
DDX1_HUMAN      -------------------------------------------------------------
DDX1_BOVIN      -------------------------------------------------------------
SSH4_DEBHA      -------------------------------------------------------------
SPSB3_HUMAN     -------------------------------------------------------------
FYV10_NEUCR     -------------------------------------------------------------
HNRL2_MOUSE     -------------------------------------------------------------
HNRL2_HUMAN     -------------------------------------------------------------
DDX1_XENLA      -------------------------------------------------------------
SPSB3_BOVIN     -------------------------------------------------------------
DDX1_CHICK      -------------------------------------------------------------
FYV10_CHAGB     -------------------------------------------------------------
ASH2_SCHPO      -------------------------------------------------------------
HNRL1_MOUSE     -------------------------------------------------------------
HNRL1_HUMAN     -------------------------------------------------------------
SSH4_YEAST      -------------------------------------------------------------
SSH4_YEAS7      -------------------------------------------------------------
CLLD6_RAT       -------------------------------------------------------------
CLLD6_MOUSE     -------------------------------------------------------------
CLLD6_HUMAN     -------------------------------------------------------------
RY44_DROME      -------------------------------------------------------------
NU124_SCHPO     -------------------------------------------------------------
CLLD6_CHICK     -------------------------------------------------------------
CLLD6_BOVIN     -------------------------------------------------------------
SPSB3_XENTR     -------------------------------------------------------------
SPSB3_MOUSE     -------------------------------------------------------------
FBSP1_ANOGA     -------------------------------------------------------------
HNRPU_HUMAN     -------------------------------------------------------------
DAPE_SHEWM      -------------------------------------------------------------