[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for huge0:KIAA0059

[Show Plain Result]

#ERROR : Can't open dsspfile "2cupA.bssp"
#ERROR : Can't open dsspfile "2bq4B.bssp"
#ERROR : Can't open dsspfile "2bq4A.bssp"
#ERROR : Can't open dsspfile "2dloA.bssp"
#ERROR : Can't open dsspfile "2cs2A.bssp"
#ERROR : Can't open dsspfile "2egqA.bssp"
#ERROR : Can't open dsspfile "1cxxA.bssp"
#ERROR : Can't open dsspfile "2eheA.bssp"
#ERROR : Can't open dsspfile "2cuqA.bssp"
#ERROR : Can't open dsspfile "1a7iA.bssp"
#ERROR : Can't open dsspfile "2curA.bssp"
#ERROR : Can't open dsspfile "2d8zA.bssp"
#ERROR : Can't open dsspfile "1ctlA.bssp"
#ERROR : Can't open dsspfile "2cu8A.bssp"
#ERROR : Can't open dsspfile "2corA.bssp"
#ERROR : Can't open dsspfile "2d8xA.bssp"
#ERROR : Can't open dsspfile "2cupA.bssp"
#ERROR : Can't open dsspfile "2bq4B.bssp"
#ERROR : Can't open dsspfile "2bq4A.bssp"
#ERROR : Can't open dsspfile "2dloA.bssp"
#ERROR : Can't open dsspfile "2cs2A.bssp"
#ERROR : Can't open dsspfile "2egqA.bssp"
#ERROR : Can't open dsspfile "1cxxA.bssp"
#ERROR : Can't open dsspfile "1cxxA.bssp"
#ERROR : Can't open dsspfile "2eheA.bssp"
#ERROR : Can't open dsspfile "2cuqA.bssp"
#ERROR : Can't open dsspfile "1a7iA.bssp"
#ERROR : Can't open dsspfile "1ctlA.bssp"
#ERROR : Can't open dsspfile "2cu8A.bssp"
#ERROR : Can't open dsspfile "2corA.bssp"

## Summary of PDB Search
:724
    6e-14  26%  2cupA  [x.x.x] SKELETAL MUSCLE LIM-PROTEIN 1
    5e-12   8%  2bq4B  [x.x.x] BASIC CYTOCHROME C3
    6e-12   7%  2bq4A  [x.x.x] BASIC CYTOCHROME C3
    2e-11  25%  2dloA  [x.x.x] THYROID RECEPTOR-INTERACTING PROTEIN 6
    9e-11  20%  2cs2A  [x.x.x] POLY [ADP-RIBOSE] POLYMERASE-1
    1e-10  25%  2egqA  [x.x.x] FHL1 PROTEIN
    7e-10  32%  1cxxA  [g.39.1 - g.39.1] CYSTEINE AND GLYCINE-RICH PROTEIN CRP2
    1e-09  29%  2eheA  [x.x.x] FOUR AND A HALF LIM DOMAINS 3
    3e-08  16%  2cuqA  [x.x.x] FOUR AND A HALF LIM DOMAINS 3
    4e-08  27%  1a7iA  [x.x.x] QCRP2 (LIM1)
    1e-06  26%  2curA  [x.x.x] SKELETAL MUSCLE LIM-PROTEIN 1
    4e-06  20%  2d8zA  [x.x.x] FOUR AND A HALF LIM DOMAINS 2
    7e-06  30%  1ctlA  [x.x.x] AVIAN CYSTEINE RICH PROTEIN
    2e-05  29%  2cu8A  [x.x.x] CYSTEINE-RICH PROTEIN 2
    5e-05  27%  2corA  [x.x.x] PINCH PROTEIN
    6e-05  33%  2d8xA  [x.x.x] PROTEIN PINCH
    1e-12  25%  2cupA  [x.x.x] SKELETAL MUSCLE LIM-PROTEIN 1(query 166->260)
    2e-04   6%  2bq4B  [x.x.x] BASIC CYTOCHROME C3(query 236->284)
    3e-04   6%  2bq4A  [x.x.x] BASIC CYTOCHROME C3(query 236->284)
    5e-10  26%  2dloA  [x.x.x] THYROID RECEPTOR-INTERACTING PROTEIN 6(query 35->104)
    2e-10  21%  2cs2A  [x.x.x] POLY [ADP-RIBOSE] POLYMERASE-1(query 212->287)
    9e-10  24%  2egqA  [x.x.x] FHL1 PROTEIN(query 215->282)
    7e-07  31%  1cxxA  [g.39.1 - g.39.1] CYSTEINE AND GLYCINE-RICH PROTEIN CRP2(query 44->98)
    4e-05  29%  1cxxA  [g.39.1 - g.39.1] CYSTEINE AND GLYCINE-RICH PROTEIN CRP2(query 101->148)
    2e-09  28%  2eheA  [x.x.x] FOUR AND A HALF LIM DOMAINS 3(query 165->233)
    7e-07  14%  2cuqA  [x.x.x] FOUR AND A HALF LIM DOMAINS 3(query 215->284)
    5e-07  31%  1a7iA  [x.x.x] QCRP2 (LIM1)(query 44->101)
    2e-05  37%  1ctlA  [x.x.x] AVIAN CYSTEINE RICH PROTEIN(query 172->230)
    1e-04  22%  2cu8A  [x.x.x] CYSTEINE-RICH PROTEIN 2(query 34->108)
    3e-04  21%  2corA  [x.x.x] PINCH PROTEIN(query 35->108)
:724

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPHHPSEKPVIHCHKCGEPCKGEVLRVQTKHFHIKCFT
2cupA           -------------------------------------------GCVECRKPIGADEVHYKNRFWHDTCFR
2bq4B           ----------------------------------------------------------------------
2bq4A           ----------------------------------------------------------------------
2dloA           ----------------------------------------------------------------------
2cs2A           ----------------------------------------------------------------------
2egqA           ----------------------------------------------------------------------
1cxxA           ----------------------------------------------------------------------
2eheA           --------------------------------------------CAECQQLHDSRELFYEDRHFHEGCFR
2cuqA           ---------------------------------PCYENKFAP-RCARCSKTLTQGGVTYRDQPWHRECLV
1a7iA           ----------------------------------------------------------------------
2curA           --------------------------------------------CVKCNKAITSGGITYQDQPWHADCFV
2d8zA           -------------------------------------------GCVQCKKPITTGGVTYREQPWHKECFV
1ctlA           -----------------------------------GGSDG----CPRCGQAVYAEKVIGAGKSWHKSCFR
2cu8A           ----------------------------------------------------------------------
2corA           ----------------------------------------------------------------------
2d8xA           --------------------------------------------CHQCGEFIIGRVIKAMNNSWHPECFR
2cupA           ----------------------------------------------------------------------
2bq4B           ----------------------------------------------------------------------
2bq4A           ----------------------------------------------------------------------
2dloA           ----------------------------------CYVATLEK--CATCSQPILDRILRAMGKAYHPGCFT
2cs2A           ----------------------------------------------------------------------
2egqA           ----------------------------------------------------------------------
1cxxA           -------------------------------------------KCSACGDSYAAEKVIGAGKPWHKNCFR
1cxxA           ----------------------------------------------------------------------
2eheA           ----------------------------------------------------------------------
2cuqA           ----------------------------------------------------------------------
1a7iA           -------------------------------------------KCGACGRTYHAEEVQCDGRSFHRCCFL
1ctlA           ----------------------------------------------------------------------
2cu8A           ---------------------------------SSGSSGMASK-CPKCDKTVYAEKVSSLGKDWHKFCLK
2corA           ----------------------------------KARGLGKY-ICQKCHAIIDEQPLIFKNDPYHPDHFN


                         .         .         *         .         .         .         .:140
query           CKVCGCDLAQGGFFIKNGEYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPG
2cupA           CAKCLHPLANETFVAKDNKILCNKCTTREDSPKCKGCFKAIVAQNVEYKGTVWHKDCFSGPSS-------
2bq4B           --------------------------------------QVPADVVIDHLSNPNAKLEYKVKFSHKAHASL
2bq4A           --------------------------------------QVPADVVIDHLSNPNAKLEYKVKFSHKAHASL
2dloA           ----------------------------------------------------------------------
2cs2A           ---------------KTLGDFAA-EYAKSNRSTCKGCMEKIEKGQVGMIDRWYHPGCFVKNREELGFRPE
2egqA           -----------------SSGSSGDCYKNFVAKKCAGCKNPITGSVVAYEGQSWHDYCFHCKKCSVNL-AN
1cxxA           ----------------------------------------------------------------------
2eheA           CCRCQRSLADEPFTCQDSELLCNDCYCSAFSSGP-SSG--------------------------------
2cuqA           CTGCQTPLAGQQFTSRDEDPYCVACFGELFASGP------------------------------------
1a7iA           ----------------------------------------------------------------------
2curA           CVTCSKKLAGQRFTAVEDQYYCVDCYKNFVSGPSSG----------------------------------
2d8zA           CTACRKQLSGQRFTARDDFAYCLNCFCDLYASGPS-SG--------------------------------
1ctlA           CAKCGKSLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQ-------------------------------
2cu8A           ----------------------------------------------------------------------
2corA           ----------------------------------------------------------------------
2d8xA           CDLCQEVLADIGFVKNAGRHLCRPCHNREKASGPS-SG--------------------------------
2cupA           ----------------------------------------------------------------------
2bq4B           ----------------------------------------------------------------------
2bq4A           ----------------------------------------------------------------------
2dloA           CVVCHRGLDGIPFVDATSQIHCIEDFHRKFASGP------------------------------------
2cs2A           ----------------------------------------------------------------------
2egqA           ----------------------------------------------------------------------
1cxxA           CAKCGKSLESTTLTEKEGEIYCKGCYAK------------------------------------------
1cxxA           ------------------------------AEKCSACGDVYAAEKVIGAGKPWHKNCFRCAKCGKSLEST
2eheA           ----------------------------------------------------------------------
2cuqA           ----------------------------------------------------------------------
1a7iA           CMVCRKNLDSTTVAIHDAEVYCKSCYGKKYG---------------------------------------
1ctlA           ----------------------------------------------------------------------
2cu8A           CERCSKTLTPGGHAEHDGKPFCHKPCYATLFGSGPSSG--------------------------------
2corA           CANCGKELTA-DARELKGELYCLPCHDKMGVSGP-SSG--------------------------------


                         +         .         .         .         .         *         .:210
query           DRVTFNGRDCLCQLCAQPMSSSPKETTFSSNCAGCGRDIKNGQALLALDKQWHLGCFKCKSCGKVLTGEY
2cupA           ----------------------------------------------------------------------
2bq4B           GTDAAACQKCHHKWDGKSE--IGGCATEGCHADTTSFKATEKDPKFLMTAFHSKSPMSCQGCHKEM-KTA
2bq4A           GTDAAACQKCHHKWDGKSEIGGCATEGC--HADTTSFKATEKDPKFLMTAFHSKSPMSCQGCHKEM-KTA
2dloA           ----------------SGSSGEGCYVATLEKCATCSQPIL-DRILRAMGKAYHPGCFTCVVCHRGLDGIT
2cs2A           YSASQKGFSLLATEDKE------ALKKQLPGVKSEGKRKG------------------------------
2egqA           KRFVFHQEQVYCPDCAKKL---------------------------------------------------
1cxxA           ----------------------------AEKCSACGDSVYAAEKVIGAGKPWHKNCFRCAKCGKSLESTL
2eheA           ----------------------------------------------------------------------
2cuqA           ----------------------------------------------------------------------
1a7iA           -----------------------------NKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDTTV
2curA           ----------------------------------------------------------------------
2d8zA           ----------------------------------------------------------------------
1ctlA           ----------------------------------------------------------------------
2cu8A           -------------------------------CPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGH
2corA           -------------------------------CQKCHAIID-EQPLIFKNDPYHPDHFNCANCGKELTADA
2d8xA           ----------------------------------------------------------------------
2cupA           -------------------------SSGSSGCVECRKPIGADSKEVYKNRFWHDTCFRCAKCLHPLANEF
2bq4B           ----------------------------------------------------------------------
2bq4A           ----------------------------------------------------------------------
2dloA           ----------------------------------------------------------------------
2cs2A           ----------------------------------------------------------------------
2egqA           ----------------------------------------------------------------------
1cxxA           ----------------------------------------------------------------------
1cxxA           TLTEKEGE--------------------------------------------------------------
2eheA           ------------------------DNTFANTCAECQQLIGHDSRELYEDRHFHEGCFRCCRCQRSLADPF
2cuqA           ----------------------------------------------------------------------
1a7iA           ----------------------------------------------------------------------
1ctlA           -------------------------------CPRCGQAVYAAEKVIGAGKSWHKSCFRCAKCGKSLESTL
2cu8A           ----------------------------------------------------------------------
2corA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ISKDGAPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHP
2cupA           ----------------------------------------------------------------------
2bq4B           KKTTGPTACAQCH---------------------------------------------------------
2bq4A           KKTTGPTACAQCH---------------------------------------------------------
2dloA           VDATSQIHCIEDFHRKFASGPSS-----------------------------------------------
2cs2A           ----------------------------------------------------------------------
2egqA           ----------------------------------------------------------------------
1cxxA           TEKEGEIYCKGCYA--------------------------------------------------------
2eheA           ----------------------------------------------------------------------
2cuqA           ----------------------------------------------------------------------
1a7iA           AIHDAEVYCKSCYGKKYG----------------------------------------------------
2curA           ----------------------------------------------------------------------
2d8zA           ----------------------------------------------------------------------
1ctlA           ----------------------------------------------------------------------
2cu8A           AEHDGKPFCHKPCYATLFGSGPSS----------------------------------------------
2corA           RELKGELYCLPCHDKMGVSGP-------------------------------------------------
2d8xA           ----------------------------------------------------------------------
2cupA           VAKDNKILCNKCTTREDSPKCKGCFKAIVAQNVEYKGTVWHKDCFSGPSS--------------------
2bq4B           -------------------------QVPADVVIDHLSNPNAKLEYKVKFSHKAHASLGTDAAACQKCHHK
2bq4A           -------------------------QVPADVVIDHLSNPNAKLEYKVKFSHKAHASLGTDAAACQKCHHK
2dloA           ----------------------------------------------------------------------
2cs2A           -EKTLGDFA-AEYAKSNRSTCKGCMEKIEKGQVRLSDRWYHPGCFVKNREELGFRPEYSASLKGFSLLAT
2egqA           ----SSGSSGDCYKNFVAKKCAGCKNPITGSVVAYEGQSWHDYCFHCKKCSVNLA-NKRFVFHQEQVYCP
1cxxA           ----------------------------------------------------------------------
1cxxA           ----------------------------------------------------------------------
2eheA           TCQDSELLCNDCYCSAFSSGPSS-----------------------------------------------
2cuqA           ----SSGSSGPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCVA
1a7iA           ----------------------------------------------------------------------
1ctlA           ADKDGEIYCKGCYAKNFGPK--------------------------------------------------
2cu8A           ----------------------------------------------------------------------
2corA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           DCKQSTKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2cupA           ----------------------------------------------------------------------
2bq4B           ----------------------------------------------------------------------
2bq4A           ----------------------------------------------------------------------
2dloA           ----------------------------------------------------------------------
2cs2A           ----------------------------------------------------------------------
2egqA           ----------------------------------------------------------------------
1cxxA           ----------------------------------------------------------------------
2eheA           ----------------------------------------------------------------------
2cuqA           ----------------------------------------------------------------------
1a7iA           ----------------------------------------------------------------------
2curA           ----------------------------------------------------------------------
2d8zA           ----------------------------------------------------------------------
1ctlA           ----------------------------------------------------------------------
2cu8A           ----------------------------------------------------------------------
2corA           ----------------------------------------------------------------------
2d8xA           ----------------------------------------------------------------------
2cupA           ----------------------------------------------------------------------
2bq4B           WDGK------------------------------------------------------------------
2bq4A           WDGK------------------------------------------------------------------
2dloA           ----------------------------------------------------------------------
2cs2A           EDKEALK---------------------------------------------------------------
2egqA           DC--------------------------------------------------------------------
1cxxA           ----------------------------------------------------------------------
1cxxA           ----------------------------------------------------------------------
2eheA           ----------------------------------------------------------------------
2cuqA           CFGE------------------------------------------------------------------
1a7iA           ----------------------------------------------------------------------
1ctlA           ----------------------------------------------------------------------
2cu8A           ----------------------------------------------------------------------
2corA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2cupA           ----------------------------------------------------------------------
2bq4B           ----------------------------------------------------------------------
2bq4A           ----------------------------------------------------------------------
2dloA           ----------------------------------------------------------------------
2cs2A           ----------------------------------------------------------------------
2egqA           ----------------------------------------------------------------------
1cxxA           ----------------------------------------------------------------------
2eheA           ----------------------------------------------------------------------
2cuqA           ----------------------------------------------------------------------
1a7iA           ----------------------------------------------------------------------
2curA           ----------------------------------------------------------------------
2d8zA           ----------------------------------------------------------------------
1ctlA           ----------------------------------------------------------------------
2cu8A           ----------------------------------------------------------------------
2corA           ----------------------------------------------------------------------
2d8xA           ----------------------------------------------------------------------
2cupA           ----------------------------------------------------------------------
2bq4B           ----------------------------------------------------------------------
2bq4A           ----------------------------------------------------------------------
2dloA           ----------------------------------------------------------------------
2cs2A           ----------------------------------------------------------------------
2egqA           ----------------------------------------------------------------------
1cxxA           ----------------------------------------------------------------------
1cxxA           ----------------------------------------------------------------------
2eheA           ----------------------------------------------------------------------
2cuqA           ----------------------------------------------------------------------
1a7iA           ----------------------------------------------------------------------
1ctlA           ----------------------------------------------------------------------
2cu8A           ----------------------------------------------------------------------
2corA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2cupA           ----------------------------------------------------------------------
2bq4B           ----------------------------------------------------------------------
2bq4A           ----------------------------------------------------------------------
2dloA           ----------------------------------------------------------------------
2cs2A           ----------------------------------------------------------------------
2egqA           ----------------------------------------------------------------------
1cxxA           ----------------------------------------------------------------------
2eheA           ----------------------------------------------------------------------
2cuqA           ----------------------------------------------------------------------
1a7iA           ----------------------------------------------------------------------
2curA           ----------------------------------------------------------------------
2d8zA           ----------------------------------------------------------------------
1ctlA           ----------------------------------------------------------------------
2cu8A           ----------------------------------------------------------------------
2corA           ----------------------------------------------------------------------
2d8xA           ----------------------------------------------------------------------
2cupA           ----------------------------------------------------------------------
2bq4B           ----------------------------------------------------------------------
2bq4A           ----------------------------------------------------------------------
2dloA           ----------------------------------------------------------------------
2cs2A           ----------------------------------------------------------------------
2egqA           ----------------------------------------------------------------------
1cxxA           ----------------------------------------------------------------------
1cxxA           ----------------------------------------------------------------------
2eheA           ----------------------------------------------------------------------
2cuqA           ----------------------------------------------------------------------
1a7iA           ----------------------------------------------------------------------
1ctlA           ----------------------------------------------------------------------
2cu8A           ----------------------------------------------------------------------
2corA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2cupA           ----------------------------------------------------------------------
2bq4B           ----------------------------------------------------------------------
2bq4A           ----------------------------------------------------------------------
2dloA           ----------------------------------------------------------------------
2cs2A           ----------------------------------------------------------------------
2egqA           ----------------------------------------------------------------------
1cxxA           ----------------------------------------------------------------------
2eheA           ----------------------------------------------------------------------
2cuqA           ----------------------------------------------------------------------
1a7iA           ----------------------------------------------------------------------
2curA           ----------------------------------------------------------------------
2d8zA           ----------------------------------------------------------------------
1ctlA           ----------------------------------------------------------------------
2cu8A           ----------------------------------------------------------------------
2corA           ----------------------------------------------------------------------
2d8xA           ----------------------------------------------------------------------
2cupA           ----------------------------------------------------------------------
2bq4B           ----------------------------------------------------------------------
2bq4A           ----------------------------------------------------------------------
2dloA           ----------------------------------------------------------------------
2cs2A           ----------------------------------------------------------------------
2egqA           ----------------------------------------------------------------------
1cxxA           ----------------------------------------------------------------------
1cxxA           ----------------------------------------------------------------------
2eheA           ----------------------------------------------------------------------
2cuqA           ----------------------------------------------------------------------
1a7iA           ----------------------------------------------------------------------
1ctlA           ----------------------------------------------------------------------
2cu8A           ----------------------------------------------------------------------
2corA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2cupA           ----------------------------------------------------------------------
2bq4B           ----------------------------------------------------------------------
2bq4A           ----------------------------------------------------------------------
2dloA           ----------------------------------------------------------------------
2cs2A           ----------------------------------------------------------------------
2egqA           ----------------------------------------------------------------------
1cxxA           ----------------------------------------------------------------------
2eheA           ----------------------------------------------------------------------
2cuqA           ----------------------------------------------------------------------
1a7iA           ----------------------------------------------------------------------
2curA           ----------------------------------------------------------------------
2d8zA           ----------------------------------------------------------------------
1ctlA           ----------------------------------------------------------------------
2cu8A           ----------------------------------------------------------------------
2corA           ----------------------------------------------------------------------
2d8xA           ----------------------------------------------------------------------
2cupA           ----------------------------------------------------------------------
2bq4B           ----------------------------------------------------------------------
2bq4A           ----------------------------------------------------------------------
2dloA           ----------------------------------------------------------------------
2cs2A           ----------------------------------------------------------------------
2egqA           ----------------------------------------------------------------------
1cxxA           ----------------------------------------------------------------------
1cxxA           ----------------------------------------------------------------------
2eheA           ----------------------------------------------------------------------
2cuqA           ----------------------------------------------------------------------
1a7iA           ----------------------------------------------------------------------
1ctlA           ----------------------------------------------------------------------
2cu8A           ----------------------------------------------------------------------
2corA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2cupA           ----------------------------------------------------------------------
2bq4B           ----------------------------------------------------------------------
2bq4A           ----------------------------------------------------------------------
2dloA           ----------------------------------------------------------------------
2cs2A           ----------------------------------------------------------------------
2egqA           ----------------------------------------------------------------------
1cxxA           ----------------------------------------------------------------------
2eheA           ----------------------------------------------------------------------
2cuqA           ----------------------------------------------------------------------
1a7iA           ----------------------------------------------------------------------
2curA           ----------------------------------------------------------------------
2d8zA           ----------------------------------------------------------------------
1ctlA           ----------------------------------------------------------------------
2cu8A           ----------------------------------------------------------------------
2corA           ----------------------------------------------------------------------
2d8xA           ----------------------------------------------------------------------
2cupA           ----------------------------------------------------------------------
2bq4B           ----------------------------------------------------------------------
2bq4A           ----------------------------------------------------------------------
2dloA           ----------------------------------------------------------------------
2cs2A           ----------------------------------------------------------------------
2egqA           ----------------------------------------------------------------------
1cxxA           ----------------------------------------------------------------------
1cxxA           ----------------------------------------------------------------------
2eheA           ----------------------------------------------------------------------
2cuqA           ----------------------------------------------------------------------
1a7iA           ----------------------------------------------------------------------
1ctlA           ----------------------------------------------------------------------
2cu8A           ----------------------------------------------------------------------
2corA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxx
2cupA           ------------------------
2bq4B           ------------------------
2bq4A           ------------------------
2dloA           ------------------------
2cs2A           ------------------------
2egqA           ------------------------
1cxxA           ------------------------
2eheA           ------------------------
2cuqA           ------------------------
1a7iA           ------------------------
2curA           ------------------------
2d8zA           ------------------------
1ctlA           ------------------------
2cu8A           ------------------------
2corA           ------------------------
2d8xA           ------------------------
2cupA           ------------------------
2bq4B           ------------------------
2bq4A           ------------------------
2dloA           ------------------------
2cs2A           ------------------------
2egqA           ------------------------
1cxxA           ------------------------
1cxxA           ------------------------
2eheA           ------------------------
2cuqA           ------------------------
1a7iA           ------------------------
1ctlA           ------------------------
2cu8A           ------------------------
2corA           ------------------------