[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for huge0:KIAA0348

[Show Plain Result]

#ERROR : Can't open dsspfile "2ddsA.bssp"
#ERROR : Can't open dsspfile "2ddsD.bssp"
#ERROR : Can't open dsspfile "2ddrC.bssp"
#ERROR : Can't open dsspfile "2ddrB.bssp"
#ERROR : Can't open dsspfile "2ddrA.bssp"
#ERROR : Can't open dsspfile "1dewA.bssp"
#ERROR : Can't open dsspfile "2ddtA.bssp"
#ERROR : Can't open dsspfile "1dewB.bssp"
#ERROR : Can't open dsspfile "2ddtB.bssp"
#ERROR : Can't open dsspfile "1e9nA.bssp"
#ERROR : Can't open dsspfile "1de8B.bssp"
#ERROR : Can't open dsspfile "1bixA.bssp"
#ERROR : Can't open dsspfile "1akoA.bssp"
#ERROR : Can't open dsspfile "2a40B.bssp"
#ERROR : Can't open dsspfile "2dnjA.bssp"
#ERROR : Can't open dsspfile "1atnD.bssp"
#ERROR : Can't open dsspfile "2a42B.bssp"
#ERROR : Can't open dsspfile "1dnkA.bssp"
#ERROR : Can't open dsspfile "1d8wA.bssp"
#ERROR : Can't open dsspfile "3bqtB.bssp"
#ERROR : Can't open dsspfile "3bqtA.bssp"
#ERROR : Can't open dsspfile "3b4mD.bssp"
#ERROR : Can't open dsspfile "3efxJ.bssp"
#ERROR : Can't open dsspfile "3d45B.bssp"

## Summary of PDB Search
:1443
    5e-39  14%  2ddsA  [x.x.x] SPHINGOMYELIN PHOSPHODIESTERASE
    5e-37  15%  2ddsD  [x.x.x] SPHINGOMYELIN PHOSPHODIESTERASE
    6e-35  14%  2ddrC  [x.x.x] SPHINGOMYELIN PHOSPHODIESTERASE
    7e-33  15%  2ddrB  [x.x.x] SPHINGOMYELIN PHOSPHODIESTERASE
    1e-32  17%  2ddrA  [x.x.x] SPHINGOMYELIN PHOSPHODIESTERASE
    4e-31  16%  1dewA  [d.151.1] MAJOR APURINIC/APYRIMIDINIC ENDONUCLEASE
    3e-30  16%  2ddtA  [x.x.x] SPHINGOMYELIN PHOSPHODIESTERASE
    2e-29  15%  1dewB  [d.151.1] MAJOR APURINIC/APYRIMIDINIC ENDONUCLEASE
    3e-29  15%  2ddtB  [x.x.x] SPHINGOMYELIN PHOSPHODIESTERASE
    7e-29  19%  1e9nA  [d.151.1] DNA-(APURINIC OR APYRIMIDINIC SITE) LYASE
    1e-28  17%  1de8B  [d.151.1] MAJOR APURINIC/APYRIMIDINIC ENDONUCLEASE
    5e-28  18%  1bixA  [x.x.x] AP ENDONUCLEASE 1
    7e-28  14%  1akoA  [x.x.x] EXONUCLEASE III
    7e-25  15%  2a40B  [x.x.x] DEOXYRIBONUCLEASE-1
    2e-20  14%  2dnjA  [d.151.1] DEOXYRIBONUCLEASE I
    3e-20  14%  1atnD  [d.151.1] DEOXYRIBONUCLEASE I
    3e-19  14%  2a42B  [x.x.x] DEOXYRIBONUCLEASE-1
    1e-18  13%  1dnkA  [d.151.1] PROTEIN (DEOXYRIBONUCLEASE I (DNASE I)
    5e-09  10%  1d8wA  [c.1.15] L-RHAMNOSE ISOMERASE
    1e-07  17%  3bqtB  [x.x.x] UNCHARACTERIZED PROTEIN
    9e-06  15%  3bqtA  [x.x.x] UNCHARACTERIZED PROTEIN
    2e-04  30%  3b4mD  [x.x.x] POLYADENYLATE-BINDING PROTEIN 2
    4e-04  13%  3efxJ  [x.x.x] CHOLERA ENTEROTOXIN SUBUNIT B, HEAT-LABILE
    8e-04  16%  3d45B  [x.x.x] POLY(A)-SPECIFIC RIBONUCLEASE PARN
:1443

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ddsA           ----------------------------------------------------------------------
2ddsD           ----------------------------------------------------------------------
2ddrC           ----------------------------------------------------------------------
2ddrB           ----------------------------------------------------------------------
2ddrA           ----------------------------------------------------------------------
1dewA           ----------------------------------------------------------------------
2ddtA           ----------------------------------------------------------------------
1dewB           ----------------------------------------------------------------------
2ddtB           ----------------------------------------------------------------------
1e9nA           ----------------------------------------------------------------------
1de8B           ----------------------------------------------------------------------
1bixA           ----------------------------------------------------------------------
1akoA           ----------------------------------------------------------------------
2a40B           ----------------------------------------------------------------------
2dnjA           ----------------------------------------------------------------------
1atnD           ----------------------------------------------------------------------
2a42B           ----------------------------------------------------------------------
1dnkA           ----------------------------------------------------------------------
1d8wA           ----------------------------------------------------------------------
3bqtB           ----------------------------------------------------------------------
3bqtA           ----------------------------------------------------------------------
3b4mD           ----------------------------------------------------------------------
3efxJ           ----------------------------------------------------------------------
3d45B           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ddsA           ----------------------------------------------------------------------
2ddsD           ----------------------------------------------------------------------
2ddrC           ----------------------------------------------------------------------
2ddrB           ----------------------------------------------------------------------
2ddrA           ----------------------------------------------------------------------
1dewA           ----------------------------------------------------------------------
2ddtA           ----------------------------------------------------------------------
1dewB           ----------------------------------------------------------------------
2ddtB           ----------------------------------------------------------------------
1e9nA           ----------------------------------------------------------------------
1de8B           ----------------------------------------------------------------------
1bixA           ----------------------------------------------------------------------
1akoA           ----------------------------------------------------------------------
2a40B           ----------------------------------------------------------------------
2dnjA           ----------------------------------------------------------------------
1atnD           ----------------------------------------------------------------------
2a42B           ----------------------------------------------------------------------
1dnkA           ----------------------------------------------------------------------
1d8wA           ----------------------------------------------------------------------
3bqtB           ----------------------------------------------------------------------
3bqtA           ----------------------------------------------------------------------
3b4mD           ----------------------------------------------------------------------
3efxJ           ----------------------------------------------------------------------
3d45B           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ddsA           ----------------------------------------------------------------------
2ddsD           ----------------------------------------------------------------------
2ddrC           ----------------------------------------------------------------------
2ddrB           ----------------------------------------------------------------------
2ddrA           ----------------------------------------------------------------------
1dewA           ----------------------------------------------------------------------
2ddtA           ----------------------------------------------------------------------
1dewB           ----------------------------------------------------------------------
2ddtB           ----------------------------------------------------------------------
1e9nA           ----------------------------------------------------------------------
1de8B           ----------------------------------------------------------------------
1bixA           ----------------------------------------------------------------------
1akoA           ----------------------------------------------------------------------
2a40B           ----------------------------------------------------------------------
2dnjA           ----------------------------------------------------------------------
1atnD           ----------------------------------------------------------------------
2a42B           ----------------------------------------------------------------------
1dnkA           ----------------------------------------------------------------------
1d8wA           ----------------------------------------------------------------------
3bqtB           ----------------------------------------------------------------------
3bqtA           ----------------------------------------------------------------------
3b4mD           ----------------------------------------------------------------------
3efxJ           ----------------------------------------------------------------------
3d45B           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ddsA           ----------------------------------------------------------------------
2ddsD           ----------------------------------------------------------------------
2ddrC           ----------------------------------------------------------------------
2ddrB           ----------------------------------------------------------------------
2ddrA           ----------------------------------------------------------------------
1dewA           ----------------------------------------------------------------------
2ddtA           ----------------------------------------------------------------------
1dewB           ----------------------------------------------------------------------
2ddtB           ----------------------------------------------------------------------
1e9nA           ----------------------------------------------------------------------
1de8B           ----------------------------------------------------------------------
1bixA           ----------------------------------------------------------------------
1akoA           ----------------------------------------------------------------------
2a40B           ----------------------------------------------------------------------
2dnjA           ----------------------------------------------------------------------
1atnD           ----------------------------------------------------------------------
2a42B           ----------------------------------------------------------------------
1dnkA           ----------------------------------------------------------------------
1d8wA           ----------------------------------------------------------------------
3bqtB           ----------------------------------------------------------------------
3bqtA           ----------------------------------------------------------------------
3b4mD           ----------------------------------------------------------------------
3efxJ           ----------------------------------------------------------------------
3d45B           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ddsA           ----------------------------------------------------------------------
2ddsD           ----------------------------------------------------------------------
2ddrC           ----------------------------------------------------------------------
2ddrB           ----------------------------------------------------------------------
2ddrA           ----------------------------------------------------------------------
1dewA           ----------------------------------------------------------------------
2ddtA           ----------------------------------------------------------------------
1dewB           ----------------------------------------------------------------------
2ddtB           ----------------------------------------------------------------------
1e9nA           ----------------------------------------------------------------------
1de8B           ----------------------------------------------------------------------
1bixA           ----------------------------------------------------------------------
1akoA           ----------------------------------------------------------------------
2a40B           ----------------------------------------------------------------------
2dnjA           ----------------------------------------------------------------------
1atnD           ----------------------------------------------------------------------
2a42B           ----------------------------------------------------------------------
1dnkA           ----------------------------------------------------------------------
1d8wA           ----------------------------------------------------------------------
3bqtB           ----------------------------------------------------------------------
3bqtA           ----------------------------------------------------------------------
3b4mD           ----------------------------------------------------------------------
3efxJ           ----------------------------------------------------------------------
3d45B           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VLHLQLKTLGLSSKPIVDRFVESFKAMWSLNGHSLSKVFTGSRALEGKAKVGKLKDGARSMSRTIQSNFF
2ddsA           ----------------------------------------------------------------------
2ddsD           ----------------------------------------------------------------------
2ddrC           ----------------------------------------------------------------------
2ddrB           ----------------------------------------------------------------------
2ddrA           ----------------------------------------------------------------------
1dewA           ----------------------------------------------------------------------
2ddtA           ----------------------------------------------------------------------
1dewB           ----------------------------------------------------------------------
2ddtB           ----------------------------------------------------------------------
1e9nA           ----------------------------------------------------------------------
1de8B           ----------------------------------------------------------------------
1bixA           ----------------------------------------------------------------------
1akoA           ----------------------------------------------------------------------
2a40B           ----------------------------------------------------------------------
2dnjA           ----------------------------------------------------------------------
1atnD           ----------------------------------------------------------------------
2a42B           ----------------------------------------------------------------------
1dnkA           ----------------------------------------------------------------------
1d8wA           ----------------------------------------------------------------------
3bqtB           VLEQDLIKAGIKTPLKDVGSKEAFLRIWENDSSVCSELYALEGAVQGI-----RWHGLDEAKKIELKKFH
3bqtA           ----DLIKAGIKTPVELVGSKEAFLRIWENDSSVCSELYALEGAVQGI-----RWHGLDEAKKIELKKFH
3b4mD           ----------------------------------------------------------------------
3efxJ           ----------------------------------------------------------------------
3d45B           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           DGVKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPRILKAMTERQSEFTNFKRIRIAMGTWNVNGGK
2ddsA           --------------------------------------------------------DTLKVMTHNVYMLS
2ddsD           --------------------------------------------------------DTLKVMTHNVYMLS
2ddrC           --------------------------------------------------------LKVM--THNVYMLS
2ddrB           --------------------------------------------------------DTLKVMTHNVYMLS
2ddrA           --------------------------------------------------------DTLKVMTHNVYMLS
1dewA           ----------------------------------------LYEDPPDHKTSPSGKPATLKICSWNVDGLR
2ddtA           --------------------------------------------------------LKVM--THNVYMLS
1dewB           -------------------------------------GPALYEDPPDHKTSPSGKPATLKICSWNVDGLR
2ddtB           ----------------------------------------------------------LKVMTHNVYMLS
1e9nA           ----------------------------------------LYEDPPDQKTSPSGKPATLKICSWNVDGLR
1de8B           ----------------------------------------LYEDPPDHKTSPSGKPATLKICSWNVDGLR
1bixA           ----------------------------------------LYEDPPDQKTSPSGKPATLKICSWNVDGLR
1akoA           --------------------------------------------------------MKFV--SFNINGLR
2a40B           --------------------------------------------------------LKIA--AFNIRT--
2dnjA           --------------------------------------------------------LKIA--AFNIRT--
1atnD           --------------------------------------------------------LKIA--AFNIRT--
2a42B           --------------------------------------------------------LKIA--AFNIRT--
1dnkA           --------------------------------------------------------LKIA--AFNIRT--
1d8wA           ----------------------------------------------------------------------
3bqtB           QSLE------------------------------------------------------------------
3bqtA           QSLE------------------------------------------------------------------
3b4mD           ----------------------------------------------------------------------
3efxJ           ----------------------------------------------------------------------
3d45B           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           QFRSNVLRTAELTDWLLDSPQLSGATDSQDDSSPADIFAVGFEEMVELSAGNIVNASTTNKKMWGEQLQK
2ddsA           TNLYPNWGQTERADLIGAADY------------IKNQDVVILNEVFDNSASDRLLGNLKKEYPNQTAVLS
2ddsD           TNLYPNWGQTERADLIGAADY------------IKNQDVVILNEVFDNSASDRLLGNLKKEYPNQTAVL-
2ddrC           TNLYPNWGQTERADLIGAADY------------IKNQDVVILNEVFDNSASDRLLGNLKKEYPNQTAVLS
2ddrB           TNLYPNWGQTERADLIGAADY------------IKNQDVVILNEVFDNSASDRLLGNLKKEYPNQTAVLG
2ddrA           TNLYPNWGQTERADLIGAA----------DYIKNQDV--VILNEVFDNSASDRLLGNLKKEYPNQTAV-L
1dewA           AWIKK-----KGLDWV--------------KEEAPDILCL--------------QETKCSENKLPAELQE
2ddtA           TNLYPNWGQTERADLIGAADY------------IKNQDVVILNEVFDNSASDRLLGNLKKEYPNQTAVLG
1dewB           AWIKK-----KGLDWV--------------KEEAPDI--LCLQET------------KCSENKLPAELQE
2ddtB           TNLYPNWGQTERADLIGAADY------------IKNQDVVILNEVFDNSASDRLLGNLKKEYPNQTAV-L
1e9nA           AWIKK-----KGLDWV--------------KEEAPDILCLQETKC--------------SENKLPAELQE
1de8B           AWIKK-----KGLDWV--------------KEEAPDILCLQETKC--------------SENKLPAELQE
1bixA           AWIKK-----KGLDWV--------------KEEAPDI--LCLQET------------KCSENKLPAELQE
1akoA           A------RPHQLEAIV--------------EKHQPDVIGLQE------------------TKVHDDMFPL
2a40B           -FGETKMSNATLASYIVR------------IVRRYDI--VLIQE--------VRDSHLVAVGKLLDYLNQ
2dnjA           -FGETKMSNATLASYIVRIV--------------RRYDIVLIQE-VRDSHLVAVGKLLDYLNQDD-----
1atnD           -FGETKMSNATLASYIVR------------IVRRYDI--VLIQEV------RDSHLVAVGKLLDYLNQDD
2a42B           -FGETKMSNATLASYIVRIVR------------RYDI--VLIQE-VRDSHLVAV-------GKLLDYLNQ
1dnkA           -FGETKMSNATLASYIVR------------IVRRYDI--VLIQEV------RDSHLVAVGKLLDYLNQDD
1d8wA           -------------------------------------------------FENYPGKARNASELRADLEQ-
3bqtB           ----------------------------------------------------------------------
3bqtA           ----------------------------------------------------------------------
3b4mD           ----------------------------------------------------------------------
3efxJ           ----------------------------------------------------------------------
3d45B           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           AISRSHRYILLTSAQLVGVCLYIFVRPYHVPFIRDVAIDTVKTGMGGKAGNKGAVGIRFQFHSTSFCFIC
2ddsA           GSEWDKTLGNYSSSTPEDGGVAIVSKWPIAEKIQY---VFAKGCGPDNLSNKGFVYTKIKKNDRFVHVIG
2ddsD           --GRSSGSEWDKTLGNYSSSTPEDGGVAIVSKWPIAEKIQYVFAKGCNLSNKGFVYTKIKKNDRFVHVIG
2ddrC           GSEWDKTLGNYSSSTPEDGGVAIVSKWPIAEKIQY---VFAKGCGPDNLSNKGFVYTKIKKNDRFVHVIG
2ddrB           RSSGSETLGNYSSSTPEDGGVAIVSKWPIAE------KIQYVFAKGCNLSNKGFVYTKIKKNDRFVHVIG
2ddrA           GRSSGSEWDKTLGNYSSSTPEDGGVAIVSKWPIAEK---IQYVFAKGCLSNKGFVYTKIKKNDRFVHVIG
1dewA           LPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSY---------GIGDEEHDQEGRVIVAEFDS--FVLVT
2ddtA           RSSGDKTLGNYSSSTPEDGGVAIVSKWPIAEKIQYVFAKG------CNLSNKGFVYTKIKKNDRFVHVIG
1dewB           LPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEG-----------RVIVAEFDSFVLVT
2ddtB           GRSSGSEWDKTLGNYSSSTPEDGGVAIVSKWPIAEK---IQYVFAKGCLSNKGFVYTKIKKNDRFVHVIG
1e9nA           LPGLSHQYWSAPSEGYSGVGLLSRQCPLKVS-----------YGIGDEEHDQEGRVIVAEFDS--FVLVT
1de8B           LPGLSHQYWSAPSDKEGYSGVGLLSRQCPL---------KVSYGIGDEEHDQEGRVIVAEFD--SFVLVT
1bixA           LPGLSHQYWSAPSDKEGYSGVGLLSRQCP---------LKVSYGIGDEEHDQEGRVIVAEFDS--FVLVT
1akoA           EEVAKLGYNVFYHGQKGHYGVALLTKETPIAVRR-------GFPGDDEEAQRRIIMAEIPSLLGNVTVIN
2a40B           DDPNTYHYVEPLGRNSYKERYLFLFRPNKVSVLDTYQYDDGCESCGNDSFSREPAVVKFSSHSKEFAIVA
2dnjA           ----PNTYHYVVSEPLGRNSYKERYLFLFRPNKVSVLDTYQYDDDSFSREPAVVKFSSHSTKVKEFAIVA
1atnD           PNTYHYVVSEPLGRNSYKERYLFLFRPNKVSVLDTYQYDDGCCGNDSFSREPAVVKFSSHTKVKEFAIVA
2a42B           DDPNHYVVSEPLGRNSYKERYLFLFRPNKVSVLDTYQYDDGNDSF--SREPAVVKFSSHSTKVKEFAIVA
1dnkA           PNTYHYVVSEPLGRNSYKERYLFLFRPNKVSVLDTYQYS-------FSREPAVVKFSSHSTKVKEFAIVA
1d8wA           ---------ARLIPGPKRLNLHIYLESDTPVSRDQIKPEHFKNWVEWAKANQLGLDFNPSCFSHPLSADG
3bqtB           ----------------------------------------------------------------------
3bqtA           ----------------------------------------------------------------------
3b4mD           ----------------------------------------------------------------------
3efxJ           ----------------------------------------------------------------------
3d45B           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           SHLTAGQSQVKERNEDYKEITQKLCFPMGRNVFSHDYVFWCGDFNYRIDLTYEEVFYFVKRQDWKKLLEF
2ddsA           THLQAEDSMCGKTSPASVRTNQIQDFIKNKNIPNNEYVLIGGDMNVNKINAENN-----NDSEYASMFKT
2ddsD           THLQAEDSSPASVRTNQ--LKEIQDFIKNKNIPNNEYVLIGGDMNVN--KINAENNNDSEYASMFKTLNA
2ddrC           THLQAEDSMCGKTSPASVRTKEIQDFIKNKNIPNNEYVLIGGDMNVNKINAENN-----NDSEYASMFKT
2ddrB           THLQAESPASVRTNQLKEIQDFIKNKNI----PNNEYVLIGGDMNVNKINAENNND-------SEYASMF
2ddrA           THLQAESPASVRTNQLKEI----QDFIKNKNIPNNEYVLIGGDMNVNKI-------NAENNNDSEYASMF
1dewA           AYVPNAGRGLVRLEYRQRWD--EAFRKFLKGLASRKPLVLCGDLNVA----HEEIDLRNPKGNKKNAGFT
2ddtA           THLQAESPASVRTNQLKEIQDFIKNKNIPN----NEYVLIGGDMNVNKI-------NAENNNDSEYASMF
1dewB           AYVPNAGRGLVRLEYRQRWD--EAFRKFLKGLASRKPLVLCGDLNVAHE----EIDLRNPKGNKKNAGFT
2ddtB           THLQAESPASVRTNQLKEIQDFIKNKNIPN----NEYVLIGGDMNVNKI-------NAENNNDSEYASMF
1e9nA           AYVPNAGRGLVRLEYRQRWDEAFRKFL--KGLASRKPLVLCGDLNVA----HEEIDLRNPKGNKKNAGFT
1de8B           AYVPNAGRGLVRLEYRQRWDEAFRKFLKGLA--SRKPLVLCGDLNVAHE----EIDLRNPKGNKKNAGFT
1bixA           AYVPNAGRGLVRLEYRQRWDEAFRKFLKGLA--SRKPLVLCGDLNVA----HEEIDLRNPKGNKKNAGFT
1akoA           GYFPQGESRDHPIKFPAKAQYQNLQNYLETELKRDNPVLIMGDMNSPTDLDIGIGEENRKRWLRTGKCSF
2a40B           LHSAPSDAV--AEINSLYDVYLDV-----QQKWHLNDVMLMGDFNADCS-----------YVTSSQWSSI
2dnjA           LHSAPSDAVAEINSLY-------DVYLDVQQKWHLNDVMLMGDFNADCS-------------------YV
1atnD           LHSAPSDAV--AEINSLYDVYLDV-----QQKWHLNDVMLMGDFNADCS-----------YVTSSQWSSI
2a42B           LHS--APSDAVAEINSLYDVYLDV-----QQKWHLNDVMLMGDFNADCS-----------YVTSSQWSSI
1dnkA           LHS--APSDAVAEINSLYDVYLDV-----QQKWHLNDVMLMGDFN-------------ADCSYVTSSQWS
1d8wA           FTLSHADDSIRQFWIDHCKASRRVSAYFGEQLGTPSVNIWIPD---------------------------
3bqtB           ----------------------------------------------------------------------
3bqtA           ----------------------------------------------------------------------
3b4mD           ----------------------------------------------------------------------
3efxJ           ----------------------------------------------------------------------
3d45B           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           DQLQLQKSSGKIFKDFHEGAINFGPTYKYDVGSAAYDTSDKCRTPAWTDRVLWWRKKHPFDKTAGELNLL
2ddsA           LNASVPSYTGHTATWDATTNSIAKYNFPDSPAEYIIASKDHANPSYIENKVLQ-----------------
2ddsD           SVPSYTGHTATWDATTNSIAKYNFPDSPAEYLDYIIASKDHANPSYIENKVLQ-----------------
2ddrC           LNASVPSYTGHTATWDATTNSIAKYNFPDSPAEYIIASKDHANPSYIENKVLQ-----------------
2ddrB           KTLNASVPSYTGHTATWDATTNSIAKYNFPDSPAIIASKDHANPSYIENKVLQPKSPQWTVT--------
2ddrA           KTLNASVPSYTGHTATWDATTNSIAKYNFPDSPAIIASKDHANPSYIENKVLQ-----------------
1dewA           PQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWLDYFLL-----------------
2ddtA           KTLNASVPSYTGHTATWDATTNSIAKYNFPDSPAIIASKDHANPSYIENKVLQPKSPQWTVTSW------
1dewB           PQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWLDYFLL-----------------
2ddtB           KTLNASVPSYTGHTATWDATTNSIAKYNFPDSPAIIASKDHANPSYIENKVLQ-----------------
1e9nA           PQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRDYFLL-----------------
1de8B           PQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRDYFLL-----------------
1bixA           PQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWLDYFLL-----------------
1akoA           LPEEREWMDRLMSWGLVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRDLLLASQPLAECCVET------
2a40B           RLRTSSTFQWLIPDSADTTATSTNCAYDR------IVVAGSLLQSSVVPGSAA-----------------
2dnjA           TSSQWSSIRLRTSSTFQWLIPDSADTTATSTNCARIVVAGSLLQSSVVPGSAAPF---------------
1atnD           RLRTSSTFQWLIPDSADTTATSTNCAYDRIV----VAGSLLQSSVVPGSAAPFD----------------
2a42B           RLRTSSTFQWLIPDSADTTATSTNCAYDR------IVVAGSLLQSSVVPGSAA-----------------
1dnkA           SIRLRTSSTFQWLIPDSADTTATSTNCAYD----RIVVAGSLLQSSVVPGSAA-----------------
1d8wA           ----------------------------------------------------------------------
3bqtB           ----------------------------------------------------------------------
3bqtA           ----------------------------------------------------------------------
3b4mD           ----------------------------------------------------------------------
3efxJ           ----------------------------------------------------------------------
3d45B           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           DSDLDVDTKVRHTWSPGALQYYGRAELQASDHRPVLAIVEVxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ddsA           ---------PKSPQWTVTSWFQKYTYNDYSDHYPVEATISM-----------------------------
2ddsD           ---------PKSPQWTVTSWFQKYTYNDYSDHYPVEATISM-----------------------------
2ddrC           ---------PKSPQWTVTSWFQKYTYNDYSDHYPVEATISM-----------------------------
2ddrB           ------------------SWFQKYTYNDYSDHYPVEATISM-----------------------------
2ddrA           ---------PKSPQWTVTSWFQKYTYNDYSDHYPVEATISM-----------------------------
1dewA           ----------SHSLLPALCDSKIRSKALGSDHCPITLYLAL-----------------------------
2ddtA           --------------------FQKYTYNDYSDHYPVEATISM-----------------------------
1dewB           ----------SHSLLPALCDSKIRSKALGSDHCPITLYLAL-----------------------------
2ddtB           ---------PKSPQWTVTSWFQKYTYNDYSDHYPVEATISM-----------------------------
1e9nA           ----------SHSLLPALCDSKIRSKALGSDHCPITLYLAL-----------------------------
1de8B           ----------SHSLLPALCDSKIRSKALGSDHCPITLYLAL-----------------------------
1bixA           ----------SHSLLPALCDSKIRSKALGSDHCPITLYLAL-----------------------------
1akoA           -----------------GIDYEIRSMEKPSDHAPVWA---------------------------------
2a40B           -----------PFDFQAAYGLSNEMALAISDHYPVEV---------------------------------
2dnjA           -------------DFQAAYGLSNEMALAISDHYPVEV---------------------------------
1atnD           --------------FQAAYGLSNEMALAISDHYPVEV---------------------------------
2a42B           -----------PFDFQAAYGLSNEMALAISDHYPVEV---------------------------------
1dnkA           -----------PFDFQAAYGLSNEMALAISDHYPVEV---------------------------------
1d8wA           ----------------------------------------------------------------------
3bqtB           ----------------------------------------------------------------------
3bqtA           ----------------------------------------------------------------------
3b4mD           ----------------------------------------------------------------------
3efxJ           ----------------------------------------------------------------------
3d45B           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxFPEDLRTELMQTLGSYGTIVLVRINQGQMLVTFADSHSALSVLDVDGMKVKGRAVKI
2ddsA           ----------------------------------------------------------------------
2ddsD           ----------------------------------------------------------------------
2ddrC           ----------------------------------------------------------------------
2ddrB           ----------------------------------------------------------------------
2ddrA           ----------------------------------------------------------------------
1dewA           ----------------------------------------------------------------------
2ddtA           ----------------------------------------------------------------------
1dewB           ----------------------------------------------------------------------
2ddtB           ----------------------------------------------------------------------
1e9nA           ----------------------------------------------------------------------
1de8B           ----------------------------------------------------------------------
1bixA           ----------------------------------------------------------------------
1akoA           ----------------------------------------------------------------------
2a40B           ----------------------------------------------------------------------
2dnjA           ----------------------------------------------------------------------
1atnD           ----------------------------------------------------------------------
2a42B           ----------------------------------------------------------------------
1dnkA           ----------------------------------------------------------------------
1d8wA           ----------------------------------------------------------------------
3bqtB           ----------------------------------------------------------------------
3bqtA           ----------------------------------------------------------------------
3b4mD           --------------------ELEAHFHGCGSVNRVTIPKGFAYIEFSDKESVRTSLALDESLFRGRQIKV
3efxJ           --------------PQNITELCSEYHNTQIYTINDKIGREMAIITFKNGATFQVEV--QKKAIERMKDTL
3d45B           -------------FPKEWKTSLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVQIAVNSKYAESRIQTYA-


                         .         .         .         +         .         .         .:980
query           RPKTKDWLKGLREEIIRKRDSMAPVSPTANSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ddsA           ----------------------------------------------------------------------
2ddsD           ----------------------------------------------------------------------
2ddrC           ----------------------------------------------------------------------
2ddrB           ----------------------------------------------------------------------
2ddrA           ----------------------------------------------------------------------
1dewA           ----------------------------------------------------------------------
2ddtA           ----------------------------------------------------------------------
1dewB           ----------------------------------------------------------------------
2ddtB           ----------------------------------------------------------------------
1e9nA           ----------------------------------------------------------------------
1de8B           ----------------------------------------------------------------------
1bixA           ----------------------------------------------------------------------
1akoA           ----------------------------------------------------------------------
2a40B           ----------------------------------------------------------------------
2dnjA           ----------------------------------------------------------------------
1atnD           ----------------------------------------------------------------------
2a42B           ----------------------------------------------------------------------
1dnkA           ----------------------------------------------------------------------
1d8wA           ----------------------------------------------------------------------
3bqtB           ----------------------------------------------------------------------
3bqtA           ----------------------------------------------------------------------
3b4mD           IPK-------------------------------------------------------------------
3efxJ           R---IAYLTEAKVEKLCVWNNKTPNSIAAIS---------------------------------------
3d45B           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ddsA           ----------------------------------------------------------------------
2ddsD           ----------------------------------------------------------------------
2ddrC           ----------------------------------------------------------------------
2ddrB           ----------------------------------------------------------------------
2ddrA           ----------------------------------------------------------------------
1dewA           ----------------------------------------------------------------------
2ddtA           ----------------------------------------------------------------------
1dewB           ----------------------------------------------------------------------
2ddtB           ----------------------------------------------------------------------
1e9nA           ----------------------------------------------------------------------
1de8B           ----------------------------------------------------------------------
1bixA           ----------------------------------------------------------------------
1akoA           ----------------------------------------------------------------------
2a40B           ----------------------------------------------------------------------
2dnjA           ----------------------------------------------------------------------
1atnD           ----------------------------------------------------------------------
2a42B           ----------------------------------------------------------------------
1dnkA           ----------------------------------------------------------------------
1d8wA           ----------------------------------------------------------------------
3bqtB           ----------------------------------------------------------------------
3bqtA           ----------------------------------------------------------------------
3b4mD           ----------------------------------------------------------------------
3efxJ           ----------------------------------------------------------------------
3d45B           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ddsA           ----------------------------------------------------------------------
2ddsD           ----------------------------------------------------------------------
2ddrC           ----------------------------------------------------------------------
2ddrB           ----------------------------------------------------------------------
2ddrA           ----------------------------------------------------------------------
1dewA           ----------------------------------------------------------------------
2ddtA           ----------------------------------------------------------------------
1dewB           ----------------------------------------------------------------------
2ddtB           ----------------------------------------------------------------------
1e9nA           ----------------------------------------------------------------------
1de8B           ----------------------------------------------------------------------
1bixA           ----------------------------------------------------------------------
1akoA           ----------------------------------------------------------------------
2a40B           ----------------------------------------------------------------------
2dnjA           ----------------------------------------------------------------------
1atnD           ----------------------------------------------------------------------
2a42B           ----------------------------------------------------------------------
1dnkA           ----------------------------------------------------------------------
1d8wA           ----------------------------------------------------------------------
3bqtB           ----------------------------------------------------------------------
3bqtA           ----------------------------------------------------------------------
3b4mD           ----------------------------------------------------------------------
3efxJ           ----------------------------------------------------------------------
3d45B           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ddsA           ----------------------------------------------------------------------
2ddsD           ----------------------------------------------------------------------
2ddrC           ----------------------------------------------------------------------
2ddrB           ----------------------------------------------------------------------
2ddrA           ----------------------------------------------------------------------
1dewA           ----------------------------------------------------------------------
2ddtA           ----------------------------------------------------------------------
1dewB           ----------------------------------------------------------------------
2ddtB           ----------------------------------------------------------------------
1e9nA           ----------------------------------------------------------------------
1de8B           ----------------------------------------------------------------------
1bixA           ----------------------------------------------------------------------
1akoA           ----------------------------------------------------------------------
2a40B           ----------------------------------------------------------------------
2dnjA           ----------------------------------------------------------------------
1atnD           ----------------------------------------------------------------------
2a42B           ----------------------------------------------------------------------
1dnkA           ----------------------------------------------------------------------
1d8wA           ----------------------------------------------------------------------
3bqtB           ----------------------------------------------------------------------
3bqtA           ----------------------------------------------------------------------
3b4mD           ----------------------------------------------------------------------
3efxJ           ----------------------------------------------------------------------
3d45B           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ddsA           ----------------------------------------------------------------------
2ddsD           ----------------------------------------------------------------------
2ddrC           ----------------------------------------------------------------------
2ddrB           ----------------------------------------------------------------------
2ddrA           ----------------------------------------------------------------------
1dewA           ----------------------------------------------------------------------
2ddtA           ----------------------------------------------------------------------
1dewB           ----------------------------------------------------------------------
2ddtB           ----------------------------------------------------------------------
1e9nA           ----------------------------------------------------------------------
1de8B           ----------------------------------------------------------------------
1bixA           ----------------------------------------------------------------------
1akoA           ----------------------------------------------------------------------
2a40B           ----------------------------------------------------------------------
2dnjA           ----------------------------------------------------------------------
1atnD           ----------------------------------------------------------------------
2a42B           ----------------------------------------------------------------------
1dnkA           ----------------------------------------------------------------------
1d8wA           ----------------------------------------------------------------------
3bqtB           ----------------------------------------------------------------------
3bqtA           ----------------------------------------------------------------------
3b4mD           ----------------------------------------------------------------------
3efxJ           ----------------------------------------------------------------------
3d45B           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:1330
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ddsA           ----------------------------------------------------------------------
2ddsD           ----------------------------------------------------------------------
2ddrC           ----------------------------------------------------------------------
2ddrB           ----------------------------------------------------------------------
2ddrA           ----------------------------------------------------------------------
1dewA           ----------------------------------------------------------------------
2ddtA           ----------------------------------------------------------------------
1dewB           ----------------------------------------------------------------------
2ddtB           ----------------------------------------------------------------------
1e9nA           ----------------------------------------------------------------------
1de8B           ----------------------------------------------------------------------
1bixA           ----------------------------------------------------------------------
1akoA           ----------------------------------------------------------------------
2a40B           ----------------------------------------------------------------------
2dnjA           ----------------------------------------------------------------------
1atnD           ----------------------------------------------------------------------
2a42B           ----------------------------------------------------------------------
1dnkA           ----------------------------------------------------------------------
1d8wA           ----------------------------------------------------------------------
3bqtB           ----------------------------------------------------------------------
3bqtA           ----------------------------------------------------------------------
3b4mD           ----------------------------------------------------------------------
3efxJ           ----------------------------------------------------------------------
3d45B           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:1400
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ddsA           ----------------------------------------------------------------------
2ddsD           ----------------------------------------------------------------------
2ddrC           ----------------------------------------------------------------------
2ddrB           ----------------------------------------------------------------------
2ddrA           ----------------------------------------------------------------------
1dewA           ----------------------------------------------------------------------
2ddtA           ----------------------------------------------------------------------
1dewB           ----------------------------------------------------------------------
2ddtB           ----------------------------------------------------------------------
1e9nA           ----------------------------------------------------------------------
1de8B           ----------------------------------------------------------------------
1bixA           ----------------------------------------------------------------------
1akoA           ----------------------------------------------------------------------
2a40B           ----------------------------------------------------------------------
2dnjA           ----------------------------------------------------------------------
1atnD           ----------------------------------------------------------------------
2a42B           ----------------------------------------------------------------------
1dnkA           ----------------------------------------------------------------------
1d8wA           ----------------------------------------------------------------------
3bqtB           ----------------------------------------------------------------------
3bqtA           ----------------------------------------------------------------------
3b4mD           ----------------------------------------------------------------------
3efxJ           ----------------------------------------------------------------------
3d45B           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:1470
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ddsA           -------------------------------------------
2ddsD           -------------------------------------------
2ddrC           -------------------------------------------
2ddrB           -------------------------------------------
2ddrA           -------------------------------------------
1dewA           -------------------------------------------
2ddtA           -------------------------------------------
1dewB           -------------------------------------------
2ddtB           -------------------------------------------
1e9nA           -------------------------------------------
1de8B           -------------------------------------------
1bixA           -------------------------------------------
1akoA           -------------------------------------------
2a40B           -------------------------------------------
2dnjA           -------------------------------------------
1atnD           -------------------------------------------
2a42B           -------------------------------------------
1dnkA           -------------------------------------------
1d8wA           -------------------------------------------
3bqtB           -------------------------------------------
3bqtA           -------------------------------------------
3b4mD           -------------------------------------------
3efxJ           -------------------------------------------
3d45B           -------------------------------------------