[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for huge0:KIAA1268

[Show Plain Result]

#ERROR : Can't open dsspfile "2bfqA.bssp"
#ERROR : Can't open dsspfile "2acfC.bssp"
#ERROR : Can't open dsspfile "2acfB.bssp"
#ERROR : Can't open dsspfile "2acfD.bssp"
#ERROR : Can't open dsspfile "2acfA.bssp"
#ERROR : Can't open dsspfile "2dx6A.bssp"
#ERROR : Can't open dsspfile "2afcA.bssp"
#ERROR : Can't open dsspfile "3ejfA.bssp"
#ERROR : Can't open dsspfile "3ejgA.bssp"
#ERROR : Can't open dsspfile "2a90A.bssp"
#ERROR : Can't open dsspfile "1a26A.bssp"
#ERROR : Can't open dsspfile "2eeeA.bssp"
#ERROR : Can't open dsspfile "1efyA.bssp"
#ERROR : Can't open dsspfile "3bljB.bssp"
#ERROR : Can't open dsspfile "3bljA.bssp"
#ERROR : Can't open dsspfile "3c49A.bssp"
#ERROR : Can't open dsspfile "2bfqA.bssp"
#ERROR : Can't open dsspfile "2bfqA.bssp"
#ERROR : Can't open dsspfile "2acfC.bssp"
#ERROR : Can't open dsspfile "2acfC.bssp"
#ERROR : Can't open dsspfile "2acfB.bssp"
#ERROR : Can't open dsspfile "2acfB.bssp"
#ERROR : Can't open dsspfile "2acfD.bssp"
#ERROR : Can't open dsspfile "2acfD.bssp"
#ERROR : Can't open dsspfile "2acfA.bssp"
#ERROR : Can't open dsspfile "2acfA.bssp"
#ERROR : Can't open dsspfile "2dx6A.bssp"
#ERROR : Can't open dsspfile "2dx6A.bssp"
#ERROR : Can't open dsspfile "2afcA.bssp"
#ERROR : Can't open dsspfile "2afcA.bssp"
#ERROR : Can't open dsspfile "3ejfA.bssp"
#ERROR : Can't open dsspfile "3ejfA.bssp"
#ERROR : Can't open dsspfile "3ejgA.bssp"
#ERROR : Can't open dsspfile "3ejgA.bssp"
#ERROR : Can't open dsspfile "2eeeA.bssp"
#ERROR : Can't open dsspfile "2eeeA.bssp"

## Summary of PDB Search
:1023
    3e-31  27%  2bfqA  [c.50.1 (2bfrA)] HYPOTHETICAL PROTEIN AF1521
    6e-25  20%  2acfC  [x.x.x] REPLICASE POLYPROTEIN 1AB
    1e-24  20%  2acfB  [x.x.x] REPLICASE POLYPROTEIN 1AB
    5e-24  20%  2acfD  [x.x.x] REPLICASE POLYPROTEIN 1AB
    1e-23  21%  2acfA  [x.x.x] REPLICASE POLYPROTEIN 1AB
    1e-23  27%  2dx6A  [x.x.x] HYPOTHETICAL PROTEIN TTHA0132
    4e-21  13%  2afcA  [x.x.x] CONSERVED HYPOTHETICAL PROTEIN
    4e-21  21%  3ejfA  [x.x.x] NON-STRUCTURAL PROTEIN 3
    7e-21  14%  3ejgA  [x.x.x] NON-STRUCTURAL PROTEIN 3
    1e-16  14%  2a90A  [x.x.x] DELTEX PROTEIN
    6e-16  10%  1a26A  [x.x.x] POLY (ADP-RIBOSE) POLYMERASE
    2e-15  12%  2eeeA  [x.x.x] UNCHARACTERIZED PROTEIN C6ORF130
    4e-15  12%  1efyA  [a.41.1 - d.166.1] POLY (ADP-RIBOSE) POLYMERASE
    1e-12  34%  3bljB  [x.x.x] POLY(ADP-RIBOSE) POLYMERASE 15
    3e-12  34%  3bljA  [x.x.x] POLY(ADP-RIBOSE) POLYMERASE 15
    7e-09  15%  3c49A  [x.x.x] POLY(ADP-RIBOSE) POLYMERASE 3
    3e-29  28%  2bfqA  [c.50.1 (2bfrA)] HYPOTHETICAL PROTEIN AF1521(query 143->321)
    1e-21  20%  2bfqA  [c.50.1 (2bfrA)] HYPOTHETICAL PROTEIN AF1521(query 355->532)
    2e-21  17%  2acfC  [x.x.x] REPLICASE POLYPROTEIN 1AB(query 562->719)
    5e-16  19%  2acfC  [x.x.x] REPLICASE POLYPROTEIN 1AB(query 369->514)
    3e-20  17%  2acfB  [x.x.x] REPLICASE POLYPROTEIN 1AB(query 562->718)
    2e-17  19%  2acfB  [x.x.x] REPLICASE POLYPROTEIN 1AB(query 369->520)
    1e-21  17%  2acfD  [x.x.x] REPLICASE POLYPROTEIN 1AB(query 562->719)
    2e-12  21%  2acfD  [x.x.x] REPLICASE POLYPROTEIN 1AB(query 369->514)
    4e-23  17%  2acfA  [x.x.x] REPLICASE POLYPROTEIN 1AB(query 562->715)
    2e-16  22%  2acfA  [x.x.x] REPLICASE POLYPROTEIN 1AB(query 369->515)
    5e-22  27%  2dx6A  [x.x.x] HYPOTHETICAL PROTEIN TTHA0132(query 572->726)
    1e-16  28%  2dx6A  [x.x.x] HYPOTHETICAL PROTEIN TTHA0132(query 361->529)
    7e-18  16%  2afcA  [x.x.x] CONSERVED HYPOTHETICAL PROTEIN(query 366->484)
    3e-15  17%  2afcA  [x.x.x] CONSERVED HYPOTHETICAL PROTEIN(query 573->714)
    6e-18  17%  3ejfA  [x.x.x] NON-STRUCTURAL PROTEIN 3(query 558->722)
    4e-13  14%  3ejfA  [x.x.x] NON-STRUCTURAL PROTEIN 3(query 361->525)
    6e-20  20%  3ejgA  [x.x.x] NON-STRUCTURAL PROTEIN 3(query 144->318)
    9e-11  20%  3ejgA  [x.x.x] NON-STRUCTURAL PROTEIN 3(query 368->495)
    3e-15  19%  2eeeA  [x.x.x] UNCHARACTERIZED PROTEIN C6ORF130(query 577->714)
    2e-14  19%  2eeeA  [x.x.x] UNCHARACTERIZED PROTEIN C6ORF130(query 349->498)
:1023

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bfqA           ----------------------------------------------------------------------
2acfC           ----------------------------------------------------------------------
2acfB           ----------------------------------------------------------------------
2acfD           ----------------------------------------------------------------------
2acfA           ----------------------------------------------------------------------
2dx6A           ----------------------------------------------------------------------
2afcA           ----------------------------------------------------------------------
3ejfA           ----------------------------------------------------------------------
3ejgA           ----------------------------------------------------------------------
2a90A           ----------------------------------------------------------------------
1a26A           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------
1efyA           ----------------------------------------------------------------------
3bljB           ----------------------------------------------------------------------
3bljA           ----------------------------------------------------------------------
3c49A           ----------------------------------------------------------------------
2bfqA           ----------------------------------------------------------------------
2bfqA           ----------------------------------------------------------------------
2acfC           ----------------------------------------------------------------------
2acfC           ----------------------------------------------------------------------
2acfB           ----------------------------------------------------------------------
2acfB           ----------------------------------------------------------------------
2acfD           ----------------------------------------------------------------------
2acfD           ----------------------------------------------------------------------
2acfA           ----------------------------------------------------------------------
2acfA           ----------------------------------------------------------------------
2dx6A           ----------------------------------------------------------------------
2dx6A           ----------------------------------------------------------------------
2afcA           ----------------------------------------------------------------------
2afcA           ----------------------------------------------------------------------
3ejfA           ----------------------------------------------------------------------
3ejfA           ----------------------------------------------------------------------
3ejgA           ----------------------------------------------------------------------
3ejgA           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bfqA           ----------------------------------------------------------------------
2acfC           ----------------------------------------------------------------------
2acfB           ----------------------------------------------------------------------
2acfD           ----------------------------------------------------------------------
2acfA           ----------------------------------------------------------------------
2dx6A           ----------------------------------------------------------------------
2afcA           ----------------------------------------------------------------------
3ejfA           ----------------------------------------------------------------------
3ejgA           ----------------------------------------------------------------------
2a90A           ----------------------------------------------------------------------
1a26A           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------
1efyA           ----------------------------------------------------------------------
3bljB           ----------------------------------------------------------------------
3bljA           ----------------------------------------------------------------------
3c49A           ----------------------------------------------------------------------
2bfqA           ----------------------------------------------------------------------
2bfqA           ----------------------------------------------------------------------
2acfC           ----------------------------------------------------------------------
2acfC           ----------------------------------------------------------------------
2acfB           ----------------------------------------------------------------------
2acfB           ----------------------------------------------------------------------
2acfD           ----------------------------------------------------------------------
2acfD           ----------------------------------------------------------------------
2acfA           ----------------------------------------------------------------------
2acfA           ----------------------------------------------------------------------
2dx6A           ----------------------------------------------------------------------
2dx6A           ----------------------------------------------------------------------
2afcA           ----------------------------------------------------------------------
2afcA           ----------------------------------------------------------------------
3ejfA           ----------------------------------------------------------------------
3ejfA           ----------------------------------------------------------------------
3ejgA           ----------------------------------------------------------------------
3ejgA           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxPGVVLIVQQGDLARLPVDVVVNASNEDLKHYXXXXXXXXXXXXXXXQADCDQIVKREGRLLPGNATIS
2bfqA           ----------------------------------------------------------------------
2acfC           -----NVAIKCVDIVKEAPMVIVNAANIHLKHGGGVAGALNKATNGAMQKESDDYIKLNGPLTVGGSCLL
2acfB           -----NVAIKCVDIVKENPMVIVNAANIHLKHGGGVAGALNKATNGAMQKESDDYIKLNGPLTVGGSCLL
2acfD           -----NVAIKCVDIVKEAQSVIVNAANIHLKHGGGVAGALNKATNGAMQKESDDYIKLNGPLTVGGSCLL
2acfA           -----NVAIKCVDIVKEAQSVIVNAANIHLKHGGGVAGALNKATNGAMQKESDDYIKLNGPLTVGGSCLL
2dx6A           ------IRVVQGDITEFQGDAIVNAANNYLKLGAGVAGAILRKGGPSIQEEC----DRIGKIRVGEAAVT
2afcA           ------ILYIKGDATAPGVKVITHICNDIGGWGKGFVLALSKKWKPEEAYRQWYK-SQEEFTLGAVQFVN
3ejfA           ---GDLTVVIAKALDEFKEFCIVNAANEHMTHGSGVAKAIADFCGLDFVEYCEDYVKKHG---PQQRLVT
3ejgA           ----------------------------------------------------------------------
2a90A           ----------------------------------------------------------------------
1a26A           ----------------------------------------------------------------------
2eeeA           ------ITYVKGDLFACPTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLNQQKKSGEVAVLKRDGR--
1efyA           ----------------------------------------------------------------------
3bljB           ----------------------------------------------------------------------
3bljA           ----------------------------------------------------------------------
3c49A           ----------------------------------------------------------------------
2bfqA           --GDITLKLAQGDITQYPAKAIVNAANKRLEHGGGVAYAIAKACAGDAGLYTEISKKGRDYIDHGEVVVT
2bfqA           ----------------------------------------------------------------------
2acfC           ----------------------------------------------------------------------
2acfC           ----------------------------------------------------------------------
2acfB           ----------------------------------------------------------------------
2acfB           ----------------------------------------------------------------------
2acfD           ----------------------------------------------------------------------
2acfD           ----------------------------------------------------------------------
2acfA           ----------------------------------------------------------------------
2acfA           ----------------------------------------------------------------------
2dx6A           ----------------------------------------------------------------------
2dx6A           ----------------------------------------------------------------------
2afcA           ----------------------------------------------------------------------
2afcA           ----------------------------------------------------------------------
3ejfA           ----------------------------------------------------------------------
3ejfA           ----------------------------------------------------------------------
3ejgA           ---HDNVAFYQGDVDTVVNGVIVNAANENLAHGGGLAKALDVYTKGKLQRLSKEHIGLAGKVKVGTGVMV
3ejgA           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KAGKLPYHHVIHAVGPRWSGYEAPRCVYLLRRAVQLSLCLAEKYKYRSIAIPAISSGVFGFPLGRCVETI
2bfqA           ----------------------------------------------------------------------
2acfC           SGHNL-AKKCLHVVGPNLNAGEDI---------QLLKAAYENFNSQDILLAPLLSAGIFGAKPLQSLQVC
2acfB           SGHNL-AKKCLHVVGPNLNAGEDIQ---------LLKAAYENFNSQDILLAPLLSAGIFGAKPLQSLQVC
2acfD           SGHNLA-KKCLHVVGPNLNAGEDIQ---------LLKAAYENFNSQDILLAPLLSAGIFGAKPLQSLQVC
2acfA           SGHNL-AKKCLHVVGPNLNAGEDI---------QLLKAAYENFNSQDILLAPLLSAGIFGAKPLQSLQVC
2dx6A           GAGNLPVRYVIHAAVLGDEPASLE----TVRKATKSALEKAVELGLKTVAFPLLGTGVGGLPVEAVARVL
2afcA           VENKLYVANIGQHGIYKDSKGLPPIRYDAVRQCLKEVAL--FTIAHKASVHPRIGCGAGGKWELEQIIKE
3ejfA           PSFVKGIQCVNNVVGPRHGDNNLHEK---LVAAYKNVLVDG----VVNYVVPVLSLGIFGVDFKMSIDAM
3ejgA           ----------------------------------------------------------------------
2a90A           ----------------------------------------------------------------------
1a26A           ----------------------------------------------------------------------
2eeeA           --------YIYYLITKKRASHKP--TYENLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAMI
1efyA           ----------------------------------------------------------------------
3bljB           ----------------------------------------------------------------------
3bljA           ----------------------------------------------------------------------
3c49A           ----------------------------------------------------------------------
2bfqA           PAMNLEERYVFHTVGPICSGMWSEELKEKLYKAFLGPLEKAEEMGVESIAFPAVSAGIYGCDLEKVVETF
2bfqA           ----------------------------------------------------------------------
2acfC           ----------------------------------------------------------------------
2acfC           ----------------------------------------------------------------------
2acfB           ----------------------------------------------------------------------
2acfB           ----------------------------------------------------------------------
2acfD           ----------------------------------------------------------------------
2acfD           ----------------------------------------------------------------------
2acfA           ----------------------------------------------------------------------
2acfA           ----------------------------------------------------------------------
2dx6A           ----------------------------------------------------------------------
2dx6A           ----------------------------------------------------------------------
2afcA           ----------------------------------------------------------------------
2afcA           ----------------------------------------------------------------------
3ejfA           ----------------------------------------------------------------------
3ejfA           ----------------------------------------------------------------------
3ejgA           ECDSL---RIFNVVGPRKGK---------HERDLLIKAYNTINNEQGTPLTPILSCGIFGIKLETSLEVL
3ejgA           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VSAIKENFQFKKDGHCLKEIYLVDVSEKTVEAFAEAVKTVFxxxxxxxxxxxxxxxxxxxxxxxxxxxGS
2bfqA           ----------------------------------------------------------------------
2acfC           VQTVRTQVYIAVNDKALYEQVVMDYLDNLKP---------------------------------------
2acfB           VQTVRTQVYIAVNDKALYEQVVMDYLDN------------------------------------------
2acfD           VQTVRTQVYIAVNDKALYEQVVMDYLDNLKP---------------------------------------
2acfA           VQTVRTQVYIAVNDKALYEQVVMD----------------------------------------------
2dx6A           EEIKKAP--------DTLEVTLYGYREEDAEAIRRA----------------------------------
2afcA           ELITKE----------------------------------------------------------------
3ejfA           REAFEG---------CTIRVLLFSLSQEHIDYFDVT----------------------------------
3ejgA           ----------------------------------------------------------------------
2a90A           ----------------------------------------------------------------------
1a26A           ----------------------------------------------------------------------
2eeeA           EEVFEA----------------------------------------------------------------
1efyA           ----------------------------------------------------------------------
3bljB           ----------------------------------------------------------------------
3bljA           ----------------------------------------------------------------------
3c49A           ----------------------------------------------------------------------
2bfqA           LEAVKNF-----KGSAVKEVALVIYDRKSAEVALKVFERSL-----------------------------
2bfqA           ----------------------------------------------------------------------
2acfC           ----------------------------------------------------------------------
2acfC           ----------------------------------------------------------------------
2acfB           ----------------------------------------------------------------------
2acfB           ----------------------------------------------------------------------
2acfD           ----------------------------------------------------------------------
2acfD           ----------------------------------------------------------------------
2acfA           ----------------------------------------------------------------------
2acfA           ----------------------------------------------------------------------
2dx6A           ----------------------------------------------------------------------
2dx6A           ----------------------------------------------------------------------
2afcA           ----------------------------------------------------------------------
2afcA           ----------------------------------------------------------------------
3ejfA           ----------------------------------------------------------------------
3ejfA           ----------------------------------------------------------------------
3ejgA           LDVCNT-----------KEVKVFVYTDTEVCKVKDFVS--------------------------------
3ejgA           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------
2eeeA           --------------------------------------------------------------------GS


                         .         .         .         .         *         .         .:420
query           LVSPGGLQMLLVKEGVQNAKTDVVVNSVPLDLVLSRGPLSKSLLEKAGPELQEELDTVGQGVAVSMGTVL
2bfqA           ----------------------------------------------------------------------
2acfC           ----------------------------------------------------------------------
2acfB           ----------------------------------------------------------------------
2acfD           ----------------------------------------------------------------------
2acfA           ----------------------------------------------------------------------
2dx6A           ----------------------------------------------------------------------
2afcA           ----------------------------------------------------------------------
3ejfA           ----------------------------------------------------------------------
3ejgA           ----------------------------------------------------------------------
2a90A           ----------------------------------------------------------------------
1a26A           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------
1efyA           ----------------------------------------------------------------------
3bljB           ----------------------------------------------------------------------
3bljA           ----------------------------------------------------------------------
3c49A           ----------------------------------------------------------------------
2bfqA           ----------------------------------------------------------------------
2bfqA           ----GDITLKLAQGDITQYPAKAIVNAANKRLEHG-GGVAYAIAKACAGDAGKAMREQFGRDYIDHGEVV
2acfC           ----------------------------------------------------------------------
2acfC           ------------------ANPMVIVNAANIHLKH-GGGVAGALNKATNGAMQKESDDYIKLNGPLTVGGS
2acfB           ----------------------------------------------------------------------
2acfB           ------------------ANPMVIVNAANIHLKH-GGGVAGALNKATNGAMQKESDDYIKLNGPLTVGGS
2acfD           ----------------------------------------------------------------------
2acfD           ------------------ANPMVIVNAANIHLKHG-GGVAGALNKATNGAMQKESDDIKLNGPLTVGGSC
2acfA           ----------------------------------------------------------------------
2acfA           ------------------ANPMVIVNAANIHLKHGGG-VAGALNKATNGAMQKESDDIKLNGPLTVGGSC
2dx6A           ----------------------------------------------------------------------
2dx6A           ----------VVQGDITEFQGDAIVNAANNYLKLG-AGVAGAILRKGGPSIQEECDRIG---KIRVGEAA
2afcA           ---------------PIGSGVKVITHICNDIGGWG-KGFVLALSKKWKPEEAYRQWYKSQEEFTLGAVQF
2afcA           ----------------------------------------------------------------------
3ejfA           ----------------------------------------------------------------------
3ejfA           ----------VIAKALDEFKEFCIVNAANEHMTHGSGV-AKAIADFCGLDFVEYCEDYVKKHGP--QQRL
3ejgA           ----------------------------------------------------------------------
3ejgA           -----------------GVDFDFIVNAANENLAHG-GGLAKALDVYTKGKLQRLSKEIGLAGKVKVGTGV
2eeeA           ----------------------------------------------------------------------
2eeeA           SGSSGGSRITYVKDLFACPKTDSLAHCISEDCRMGAGIAV--LFKKKFGGVQELLNQQKSGEVAVLK---


                         .         .         +         .         .         .         .:490
query           KTSSWNLDCRYVLHVVAPEWRNGSTSSLKIMEDIIRECMEITESLSLKSIAFPAIGTGNLGFPKNIFAEL
2bfqA           ----------------------------------------------------------------------
2acfC           ----------------------------------------------------------------------
2acfB           ----------------------------------------------------------------------
2acfD           ----------------------------------------------------------------------
2acfA           ----------------------------------------------------------------------
2dx6A           ----------------------------------------------------------------------
2afcA           ----------------------------------------------------------------------
3ejfA           ----------------------------------------------------------------------
3ejgA           ----------------------------------------------------------------------
2a90A           ----------------------------------------------------------------------
1a26A           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------
1efyA           ----------------------------------------------------------------------
3bljB           ----------------------------------------------------------------------
3bljA           ----------------------------------------------------------------------
3c49A           ----------------------------------------------------------------------
2bfqA           ----------------------------------------------------------------------
2bfqA           VTPAMNLEERYVFHTVGPICSGMWSELKEKLYKAFLGPLEKAEEMGVESIAFPAVSAGIYGCDLEKVVET
2acfC           ----------------------------------------------------------------------
2acfC           CLLSGHNLAKKCLHVVGPNLNAGEDIQL--LKAAYENF------NSQDILLAPLLSAGIFGAKPLQSLQV
2acfB           ----------------------------------------------------------------------
2acfB           CLLSGHNLAKKCLHVVGPNLNAGEDIQLL------KAAYE--NFNSQDILLAPLLSAGIFGAKPLQSLQV
2acfD           ----------------------------------------------------------------------
2acfD           LLSGHNL-AKKCLHVVGPNLNAGEDIQL--LKAAYENF------NSQDILLAPLLSAGIFGAKPLQSLQV
2acfA           ----------------------------------------------------------------------
2acfA           LLSGHNL-AKKCLHVVGPNLNAGEDIQLL------KAAYE--NFNSQDILLAPLLSAGIFGAKPLQSLQV
2dx6A           ----------------------------------------------------------------------
2dx6A           VTGAGNLPVRYVIHAAVLGDEPASLETV---RKATKSALEKAVELGLKTVAFPLLGTGVGGLPVEAVAR-
2afcA           VNVENKLYVANIGQHGIYKDSKGLP---PIRYDAVRQCLKALFTIAHKASVHPRIGCGAGGKWE------
2afcA           ----------------------------------------------------------------------
3ejfA           ----------------------------------------------------------------------
3ejfA           VTPSFVKGIQCVNNVVGPRHGDNNLHEK------LVAAYKNVLVDGVVNYVVPVLSLGIFGVDFKMSIDA
3ejgA           ----------------------------------------------------------------------
3ejgA           MVECDSL---RIFNVVGPRKGKHE-------RDLLIKAYNTIN-NEQGTPLTPILSCGIFGIKLETSLEV
2eeeA           ----------------------------------------------------------------------
2eeeA           ------RDGRYIYYLITKKR-ASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAM


                         *         .         .         .         .         +         .:560
query           IISEVFKFSSKNQLKTLQEVHFLLHPSDHENIQAFSDEFARRxxxxxxxxxxxxxxxxxxxxxxxxxPDS
2bfqA           ----------------------------------------------------------------------
2acfC           ----------------------------------------------------------------------
2acfB           ----------------------------------------------------------------------
2acfD           ----------------------------------------------------------------------
2acfA           ----------------------------------------------------------------------
2dx6A           ----------------------------------------------------------------------
2afcA           ----------------------------------------------------------------------
3ejfA           ----------------------------------------------------------------------
3ejgA           ----------------------------------------------------------------------
2a90A           ----------------------------------------------------------------------
1a26A           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------
1efyA           ----------------------------------------------------------------------
3bljB           ----------------------------------------------------------------------
3bljA           ----------------------------------------------------------------------
3c49A           ----------------------------------------------------------------------
2bfqA           ----------------------------------------------------------------------
2bfqA           FLEAVKNF----KGSAVKEVALVIY--DRKSAEVALKVFERS----------------------------
2acfC           ----------------------------------------------------------------------
2acfC           CVQTVRTQVYIAVNKALYEQVVMD----------------------------------------------
2acfB           ----------------------------------------------------------------------
2acfB           CVQTVRTQVYIAVNKALYEQVVMDYLDNLK----------------------------------------
2acfD           ----------------------------------------------------------------------
2acfD           CVQTVRTQVYIAVNKALYEQVVMD----------------------------------------------
2acfA           ----------------------------------------------------------------------
2acfA           CVQTVRTQVYIAVDKALYEQVVMDY---------------------------------------------
2dx6A           ----------------------------------------------------------------------
2dx6A           VLEEIKKAPD------TLEVTLYGY--REEDAEAIRRAL-------------------------------
2afcA           ----------------------------------------------------------------------
2afcA           ----------------------------------------------------------------------
3ejfA           -------------------------------------------------------------------PKF
3ejfA           MREAFEGC--------TIRVLLFS--LSQEHIDYF-----------------------------------
3ejgA           ----------------------------------------------------------------------
3ejgA           LLDVC-----------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------
2eeeA           IEEVFEAT--------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           GVYEMKIGSIIFQVASGDITKEEADVIVNSTSNSFNLKAGVSKAILECAGQNVERECSQQAQQRKNDYII
2bfqA           -LFEAKVGDITLKLAQGDITQYPAKAIVNAANKRLEHGGGVAYAIAKACAGDAGLYTEISREQFGRDYIV
2acfC           ----------------------------------------------------------------------
2acfB           ----------------------------------------------------------------------
2acfD           ----------------------------------------------------------------------
2acfA           ----------------------------------------------------------------------
2dx6A           ----------------------------------------------------------------------
2afcA           ----------------------------------------------------------------------
3ejfA           ----------------------------------------------------------------------
3ejgA           KLNAFLVHDNV-AFYQGDVDTVVNGVIVNAANENLAHGGGLAKALDVYTKGKLQRLSKEHI--GLAGKVK
2a90A           ----------------------------------------------------------------------
1a26A           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------
1efyA           ----------------------------------------------------------------------
3bljB           ----------------------------------------------------------------------
3bljA           ----------------------------------------------------------------------
3c49A           ----------------------------------------------------------------------
2bfqA           ----------------------------------------------------------------------
2bfqA           ----------------------------------------------------------------------
2acfC           -TGYLKLTDNV-AIKCVDIVKEAQMVIVNAANIHLKHGGGVAGALNKATNGAMQKESDDYIKLNTVGGSC
2acfC           ----------------------------------------------------------------------
2acfB           -TGYLKLTDNV-AIKCVDIVKEAQMVIVNAANIHLKHGGGVAGALNKATNGAMQKESDDYIKLNTVGGSC
2acfB           ----------------------------------------------------------------------
2acfD           -TGYLKLTDNV-AIKCVDIVKEAQSVIVNAANIHLKHGGGVAGALNKATNGAMQKESDDYIKLNTVGGSC
2acfD           ----------------------------------------------------------------------
2acfA           -TGYLKLTDNV-AIKCVDIVKEAQSVIVNAANIHLKHGGGVAGALNKATNGAMQKESDDYIKLNGVGGSC
2acfA           ----------------------------------------------------------------------
2dx6A           -----------IRVVQGDITEFQGDAIVNAANNYLKLGAGVAGAILRKGGPSIQEECDRIGKIRVGEAAV
2dx6A           ----------------------------------------------------------------------
2afcA           ----------------------------------------------------------------------
2afcA           ------------LYIKGDATASGVKVITHICNDIGGWGKGFVLALSKKWKPEEAYRQWYKSQEEFAVQFV
3ejfA           LEYKTCVGDLT-VVIAKALDEFKEFCIVNAANEHMTHGSGVAKAIADFCGLDFVEYCEDVKKHGPQQRLV
3ejfA           ----------------------------------------------------------------------
3ejgA           ----------------------------------------------------------------------
3ejgA           ----------------------------------------------------------------------
2eeeA           ----------------GDLFACPKDSLAHCISEDCRMGAGIAVLFKKKFGG-VQELLNQQ--KKSGEVAV
2eeeA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           TGGGFLRCKNIIHVIGGNDVKSSVSSVLQECEKKNYSSICLPAIGTGNAKQHPDKVAEAIIDAIEDFVQK
2bfqA           TPAMNLGIKYVFHTVGPIKLYKAFLGPLEKAEEMGVESIAFPAVSAGIYGCDLEKVVETFLEAVKNFKG-
2acfC           ----------------------------------------------------------------------
2acfB           ----------------------------------------------------------------------
2acfD           ----------------------------------------------------------------------
2acfA           ----------------------------------------------------------------------
2dx6A           ----------------------------------------------------------------------
2afcA           ----------------------------------------------------------------------
3ejfA           ----------------------------------------------------------------------
3ejgA           VGTGVMVELRIFNVVGPRKHERDLLIKAYNTINNEQGTPLTPILSCGIFGIKLETSLEVLLDVCNTK---
2a90A           ----------------------------------------------------------------------
1a26A           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------
1efyA           ----------------------------------------------------------------------
3bljB           ----------------------------------------------------------------------
3bljA           ----------------------------------------------------------------------
3c49A           ----------------------------------------------------------------------
2bfqA           ----------------------------------------------------------------------
2bfqA           ----------------------------------------------------------------------
2acfC           LLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENSQDILLAPLLSAGIFGAKPLQSLQVCVQTVRTQVIA
2acfC           ----------------------------------------------------------------------
2acfB           LLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENSQDILLAPLLSAGIFGAKPLQSLQVCVQTVRTQVYI
2acfB           ----------------------------------------------------------------------
2acfD           LLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENSQDILLAPLLSAGIFGAKPLQSLQVCVQTVRTQVYI
2acfD           ----------------------------------------------------------------------
2acfA           LLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENSQDILLAPLLSAGIFGAKPLQSLQVCVQTVRTQVIA
2acfA           ----------------------------------------------------------------------
2dx6A           TGAGNLPVRYVIHAAVLGDEPASTKSALEKAVELGLKTVAFPLLGTGVGGLPVEAVAR-VLEEIK-----
2dx6A           ----------------------------------------------------------------------
2afcA           ----------------------------------------------------------------------
2afcA           NVENKLYVANIGQHGIYKDRYDAVRQCLKELFTIAHKASVHPRIGCGAGG----------KWELEQIIKE
3ejfA           TPSFVKGIQCVNNVVGDNNLHEKLVAAYKNVLVDGVVNYVVPVLSLGIFGVDFKMSIDAMREAFEGC---
3ejfA           ----------------------------------------------------------------------
3ejgA           ----------------------------------------------------------------------
3ejgA           ----------------------------------------------------------------------
2eeeA           LKRD---GRYIYYLITKKNLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAMIEEVFEAT---
2eeeA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           GSAQSVKKVKVVIFLPQVLDVFYANMKKRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bfqA           ---SAVKEVALVIYDRKSAEVALKVFERS-----------------------------------------
2acfC           ----------------------------------------------------------------------
2acfB           ----------------------------------------------------------------------
2acfD           ----------------------------------------------------------------------
2acfA           ----------------------------------------------------------------------
2dx6A           ----------------------------------------------------------------------
2afcA           ----------------------------------------------------------------------
3ejfA           ----------------------------------------------------------------------
3ejgA           -------EVKVFVYTDTEVCKVKDFVS-------------------------------------------
2a90A           ----------------------------------------------------------------------
1a26A           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------
1efyA           ----------------------------------------------------------------------
3bljB           ----------------------------------------------------------------------
3bljA           ----------------------------------------------------------------------
3c49A           ----------------------------------------------------------------------
2bfqA           ----------------------------------------------------------------------
2bfqA           ----------------------------------------------------------------------
2acfC           VNDKALYEQVVMDYLDNLK---------------------------------------------------
2acfC           ----------------------------------------------------------------------
2acfB           AVDKALYEQVVMDYLDNL----------------------------------------------------
2acfB           ----------------------------------------------------------------------
2acfD           AVDKALYEQVVMDYLDNLK---------------------------------------------------
2acfD           ----------------------------------------------------------------------
2acfA           VNDKALYEQVVMDYL-------------------------------------------------------
2acfA           ----------------------------------------------------------------------
2dx6A           -KAPDTLEVTLYGYREEDAEAIRRAL--------------------------------------------
2dx6A           ----------------------------------------------------------------------
2afcA           ----------------------------------------------------------------------
2afcA           --ELITKEIAVTVY--------------------------------------------------------
3ejfA           -----TIRVLLFSLSQEHIDYF------------------------------------------------
3ejfA           ----------------------------------------------------------------------
3ejgA           ----------------------------------------------------------------------
3ejgA           ----------------------------------------------------------------------
2eeeA           -------DIKITVY--------------------------------------------------------
2eeeA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxYTSEDECIKDFDEKEYQELNELQKKLNINISLDHKRPLIKV
2bfqA           ----------------------------------------------------------------------
2acfC           ----------------------------------------------------------------------
2acfB           ----------------------------------------------------------------------
2acfD           ----------------------------------------------------------------------
2acfA           ----------------------------------------------------------------------
2dx6A           ----------------------------------------------------------------------
2afcA           ----------------------------------------------------------------------
3ejfA           ----------------------------------------------------------------------
3ejgA           ----------------------------------------------------------------------
2a90A           -----------------------------EFESRGKWLPYSPAVSQHLERAHAK-KLTRVLSDADPSLEQ
1a26A           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------
1efyA           ----------------------------------------------------------------------
3bljB           ----------------------------------------------------------------------
3bljA           ----------------------------------------------------------------------
3c49A           ----------------------------------------------------------------------
2bfqA           ----------------------------------------------------------------------
2bfqA           ----------------------------------------------------------------------
2acfC           ----------------------------------------------------------------------
2acfC           ----------------------------------------------------------------------
2acfB           ----------------------------------------------------------------------
2acfB           ----------------------------------------------------------------------
2acfD           ----------------------------------------------------------------------
2acfD           ----------------------------------------------------------------------
2acfA           ----------------------------------------------------------------------
2acfA           ----------------------------------------------------------------------
2dx6A           ----------------------------------------------------------------------
2dx6A           ----------------------------------------------------------------------
2afcA           ----------------------------------------------------------------------
2afcA           ----------------------------------------------------------------------
3ejfA           ----------------------------------------------------------------------
3ejfA           ----------------------------------------------------------------------
3ejgA           ----------------------------------------------------------------------
3ejgA           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           LGISRDVMQARDEIEAMIKRVRLAKEQESRADCISEFIEWQYNDNNTSHCFNKMTNLKLEDARREKKKTV
2bfqA           ----------------------------------------------------------------------
2acfC           ----------------------------------------------------------------------
2acfB           ----------------------------------------------------------------------
2acfD           ----------------------------------------------------------------------
2acfA           ----------------------------------------------------------------------
2dx6A           ----------------------------------------------------------------------
2afcA           ----------------------------------------------------------------------
3ejfA           ----------------------------------------------------------------------
3ejgA           ----------------------------------------------------------------------
2a90A           YYV--NVRTTQESLTIGVRRFYAPSSPAGKGTKWEWS--GGSADSNNDWRPYNHVQSIIEDAWARGEQTL
1a26A           ------------EIDLQKMPLKLSKRQIQSAYSILNEVQQAVSDGGSESQILDLSNRFYTLIPHDFGMKK
2eeeA           ----------------------------------------------------------------------
1efyA           ------------EIDLQKMPLKLSKRQIQSAYSILNEVQQAVSDGSESQILDLSNRFYTLIPHDFGMKKP
3bljB           ----------------------------------------------------------------------
3bljA           ----------------------------------------------------------------------
3c49A           -------------------------------------------------------------GHSQPPPIN
2bfqA           ----------------------------------------------------------------------
2bfqA           ----------------------------------------------------------------------
2acfC           ----------------------------------------------------------------------
2acfC           ----------------------------------------------------------------------
2acfB           ----------------------------------------------------------------------
2acfB           ----------------------------------------------------------------------
2acfD           ----------------------------------------------------------------------
2acfD           ----------------------------------------------------------------------
2acfA           ----------------------------------------------------------------------
2acfA           ----------------------------------------------------------------------
2dx6A           ----------------------------------------------------------------------
2dx6A           ----------------------------------------------------------------------
2afcA           ----------------------------------------------------------------------
2afcA           ----------------------------------------------------------------------
3ejfA           ----------------------------------------------------------------------
3ejfA           ----------------------------------------------------------------------
3ejgA           ----------------------------------------------------------------------
3ejgA           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           DVKINHRHYTVNLNTYTATDTKGHSLSVQRLTKSKVDIPAHWSDMKQQNFCVVELLPSDPEYNTVASKFN
2bfqA           ----------------------------------------------------------------------
2acfC           ----------------------------------------------------------------------
2acfB           ----------------------------------------------------------------------
2acfD           ----------------------------------------------------------------------
2acfA           ----------------------------------------------------------------------
2dx6A           ----------------------------------------------------------------------
2afcA           ----------------------------------------------------------------------
3ejfA           ----------------------------------------------------------------------
3ejgA           ----------------------------------------------------------------------
2a90A           DLSHIGLPYTINFSNLTQLRQPSGPRSIRRTQQA------------------------------------
1a26A           PPLL-SNLEYIQAKVQMLDNLLDIEVAYSLLRGGNEDGDKDPIDYEKLRTDIKVVDKDSEEAKIIKQYVK
2eeeA           ----------------------------------------------------------------------
1efyA           PLLSNLEYIQAKVQMLDNLLDIEVAYSLLRGGNEDGDKDPIDINYEKLRTDIKVVDKDSEEAKIIKQYVK
3bljB           ------------------------------------NLPEHWTDMNHQLFCMVQLEPGQSEYNTIKDKFT
3bljA           -------------------------------------LPEHWTDMNHQLFCMVQLEPGQSEYNTIKDKFT
3c49A           SPELLQAKKDMLLVLADIELAQ-ALQAVSEQEKTVEEVPHPLDRDYQLLKCLQLLDSGAPEYKVIQTYLE
2bfqA           ----------------------------------------------------------------------
2bfqA           ----------------------------------------------------------------------
2acfC           ----------------------------------------------------------------------
2acfC           ----------------------------------------------------------------------
2acfB           ----------------------------------------------------------------------
2acfB           ----------------------------------------------------------------------
2acfD           ----------------------------------------------------------------------
2acfD           ----------------------------------------------------------------------
2acfA           ----------------------------------------------------------------------
2acfA           ----------------------------------------------------------------------
2dx6A           ----------------------------------------------------------------------
2dx6A           ----------------------------------------------------------------------
2afcA           ----------------------------------------------------------------------
2afcA           ----------------------------------------------------------------------
3ejfA           ----------------------------------------------------------------------
3ejfA           ----------------------------------------------------------------------
3ejgA           ----------------------------------------------------------------------
3ejgA           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           QTCSHFRIEKVSLLLECSFWMVEISSVMVLYKIHFHSLPITFF
2bfqA           -------------------------------------------
2acfC           -------------------------------------------
2acfB           -------------------------------------------
2acfD           -------------------------------------------
2acfA           -------------------------------------------
2dx6A           -------------------------------------------
2afcA           -------------------------------------------
3ejfA           -------------------------------------------
3ejgA           -------------------------------------------
2a90A           -------------------------------------------
1a26A           NTHAATHNAYDLKVVEI--------------------------
2eeeA           -------------------------------------------
1efyA           NTHAATH------------------------------------
3bljB           RTCSSYAIEKIERIQNAFLWQSYQVKKRQMDRLLFHGTDADSV
3bljA           RTCSSYAIEKIERIQNAFLWQSYQVKKRQMDRLLFHGTDADSV
3c49A           QTGSNHRCPTLQHIWK---------------------------
2bfqA           -------------------------------------------
2bfqA           -------------------------------------------
2acfC           -------------------------------------------
2acfC           -------------------------------------------
2acfB           -------------------------------------------
2acfB           -------------------------------------------
2acfD           -------------------------------------------
2acfD           -------------------------------------------
2acfA           -------------------------------------------
2acfA           -------------------------------------------
2dx6A           -------------------------------------------
2dx6A           -------------------------------------------
2afcA           -------------------------------------------
2afcA           -------------------------------------------
3ejfA           -------------------------------------------
3ejfA           -------------------------------------------
3ejgA           -------------------------------------------
3ejgA           -------------------------------------------
2eeeA           -------------------------------------------
2eeeA           -------------------------------------------