[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for huge0:KIAA1464

[Show Plain Result]

#ERROR : Can't open dsspfile "2e63A.bssp"
#ERROR : Can't open dsspfile "2afjA.bssp"

## Summary of PDB Search
:621
    5e-30  19%  2e63A  [x.x.x] KIAA1787 PROTEIN
    5e-23  17%  2afjA  [x.x.x] GENE RICH CLUSTER, C9 GENE
:621

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQELSRRLQRLYPAVNQQETPLPRSWSPKDKYNYIGLS
2e63A           ------------------------------------------------------------------VSLS
2afjA           ---------------------------------TPTSQALYSDFSPPEGLEELLSAVAQRHHGWNPKDCS


                         .         .         *         .         .         .         .:140
query           QGNLRVHYKGHGKNHKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPGWDKHS
2e63A           ACGRTARRQQPGQEFNHGL-VLSREPLRD-GRVFTVRIDRKVNSWSGSIEIGVTALDPSVLDFPSSKGGS
2afjA           ENIDVKEGGLCFERRPSTDGVRGKRGYS--RGLHAWEISWPLEQRGTHAVVGVATALAPLQALLGSNSES


                         +         .         .         .         .         *         .:210
query           YGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINGTCFYTKNGHSLGIAFTDLPANLYPTVGLQTP
2e63A           WVVSGC-SVLRDGRSVLEEYGQDLGEGDRVGVERTV-AGELRLWVNGRDCGVAATGLPPRVWAVVDLYGK
2afjA           WGWDIGRGSKGLEAPQYPAQGEQLVVPERLLVVLDMEEGTLGYSIGGTYLGPAFRGLKGTLYPSVSAVWG


                         .         .         .         +         .         .         .:280
query           GEIVDANFGQQPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2e63A           CTQI------------------------------------------------------------------
2afjA           QCQVRIRYMGER----------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2e63A           ----------------------------------------------------------------------
2afjA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2e63A           ----------------------------------------------------------------------
2afjA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2e63A           ----------------------------------------------------------------------
2afjA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2e63A           ----------------------------------------------------------------------
2afjA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2e63A           -------------------------------------------------------------
2afjA           -------------------------------------------------------------