[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for huge0:KIAA1520

[Show Plain Result]

#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "3dm5A.bssp"
#ERROR : Can't open dsspfile "3eiuA.bssp"
#ERROR : Can't open dsspfile "3dt2A.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "3dtbB.bssp"
#ERROR : Can't open dsspfile "1dkiA.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "2akaB.bssp"
#ERROR : Can't open dsspfile "1accA.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "2c61B.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "3cmvH.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "3dt4C.bssp"
#ERROR : Can't open dsspfile "3bb1A.bssp"
#ERROR : Can't open dsspfile "3dt7A.bssp"
#ERROR : Can't open dsspfile "4dcgA.bssp"
#ERROR : Can't open dsspfile "3dt4A.bssp"
#ERROR : Can't open dsspfile "3b2qA.bssp"
#ERROR : Can't open dsspfile "3cmvG.bssp"
#ERROR : Can't open dsspfile "2dwpA.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "2b8tA.bssp"
#ERROR : Can't open dsspfile "2c61A.bssp"
#ERROR : Can't open dsspfile "2cjwB.bssp"
#ERROR : Can't open dsspfile "3eiuB.bssp"
#ERROR : Can't open dsspfile "2ccjB.bssp"
#ERROR : Can't open dsspfile "3c95A.bssp"
#ERROR : Can't open dsspfile "2ccgA.bssp"
#ERROR : Can't open dsspfile "1d1cA.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "1e9fA.bssp"
#ERROR : Can't open dsspfile "3cmvA.bssp"
#ERROR : Can't open dsspfile "3cmvC.bssp"
#ERROR : Can't open dsspfile "2ahvA.bssp"
#ERROR : Can't open dsspfile "3cddF.bssp"
#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "1bifA.bssp"
#ERROR : Can't open dsspfile "3czpB.bssp"
#ERROR : Can't open dsspfile "2b8wA.bssp"
#ERROR : Can't open dsspfile "3b2qB.bssp"
#ERROR : Can't open dsspfile "3ec1A.bssp"
#ERROR : Can't open dsspfile "2c9yA.bssp"
#ERROR : Can't open dsspfile "2dr3A.bssp"
#ERROR : Can't open dsspfile "2c9oC.bssp"
#ERROR : Can't open dsspfile "2czvA.bssp"
#ERROR : Can't open dsspfile "1e9dA.bssp"
#ERROR : Can't open dsspfile "2bifA.bssp"
#ERROR : Can't open dsspfile "2bofX.bssp"
#ERROR : Can't open dsspfile "2ahwD.bssp"
#ERROR : Can't open dsspfile "2a5gA.bssp"
#ERROR : Can't open dsspfile "3da4A.bssp"
#ERROR : Can't open dsspfile "2dr3E.bssp"
#ERROR : Can't open dsspfile "3bb1B.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "2axzC.bssp"
#ERROR : Can't open dsspfile "3d7wA.bssp"
#ERROR : Can't open dsspfile "3di4A.bssp"
#ERROR : Can't open dsspfile "2cgtH.bssp"
#ERROR : Can't open dsspfile "1e9sG.bssp"
#ERROR : Can't open dsspfile "3a1wA.bssp"
#ERROR : Can't open dsspfile "3bgwA.bssp"
#ERROR : Can't open dsspfile "1e1qB.bssp"
#ERROR : Can't open dsspfile "1dg3A.bssp"
#ERROR : Can't open dsspfile "1e9sF.bssp"
#ERROR : Can't open dsspfile "3b85A.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "3bb1E.bssp"
#ERROR : Can't open dsspfile "3ed8A.bssp"
#ERROR : Can't open dsspfile "2c4rL.bssp"
#ERROR : Can't open dsspfile "3bb1H.bssp"
#ERROR : Can't open dsspfile "3bh0A.bssp"
#ERROR : Can't open dsspfile "1cr4A.bssp"
#ERROR : Can't open dsspfile "1e4yA.bssp"
#ERROR : Can't open dsspfile "2axpA.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "1e3mB.bssp"
#ERROR : Can't open dsspfile "2ctsA.bssp"
#ERROR : Can't open dsspfile "2b92B.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "1e3mA.bssp"
#ERROR : Can't open dsspfile "2bkhA.bssp"
#ERROR : Can't open dsspfile "3cr7C.bssp"
#ERROR : Can't open dsspfile "2eg5G.bssp"
#ERROR : Can't open dsspfile "3bb1F.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "2a2zA.bssp"
#ERROR : Can't open dsspfile "1aroP.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "2bc9A.bssp"
#ERROR : Can't open dsspfile "3czpA.bssp"
#ERROR : Can't open dsspfile "1e9sD.bssp"
#ERROR : Can't open dsspfile "2dr3B.bssp"
#ERROR : Can't open dsspfile "421pA.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "3bpbA.bssp"
#ERROR : Can't open dsspfile "2ck3C.bssp"
#ERROR : Can't open dsspfile "1e0jB.bssp"
#ERROR : Can't open dsspfile "2d0kA.bssp"
#ERROR : Can't open dsspfile "3bb1C.bssp"
#ERROR : Can't open dsspfile "2b8tB.bssp"
#ERROR : Can't open dsspfile "3dm5B.bssp"
#ERROR : Can't open dsspfile "3cddD.bssp"
#ERROR : Can't open dsspfile "3dm9B.bssp"
#ERROR : Can't open dsspfile "3bm2B.bssp"
#ERROR : Can't open dsspfile "1dhjA.bssp"
#ERROR : Can't open dsspfile "2d4hA.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "3cddC.bssp"
#ERROR : Can't open dsspfile "2akaA.bssp"
#ERROR : Can't open dsspfile "3bb1D.bssp"
#ERROR : Can't open dsspfile "1e0jA.bssp"
#ERROR : Can't open dsspfile "2dr3C.bssp"
#ERROR : Can't open dsspfile "3bjdB.bssp"
#ERROR : Can't open dsspfile "2aumA.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "3d3kA.bssp"
#ERROR : Can't open dsspfile "1bmfC.bssp"
#ERROR : Can't open dsspfile "2d4hB.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1dvrA.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "3bb1G.bssp"
#ERROR : Can't open dsspfile "3cbnA.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "3bgwD.bssp"
#ERROR : Can't open dsspfile "3adkA.bssp"
#ERROR : Can't open dsspfile "2ausC.bssp"
#ERROR : Can't open dsspfile "1e2gA.bssp"
#ERROR : Can't open dsspfile "2a30A.bssp"
#ERROR : Can't open dsspfile "2a5jA.bssp"
#ERROR : Can't open dsspfile "2b8wB.bssp"
#ERROR : Can't open dsspfile "3ch4B.bssp"
#ERROR : Can't open dsspfile "3c8uA.bssp"
#ERROR : Can't open dsspfile "2a30D.bssp"
#ERROR : Can't open dsspfile "1e9sJ.bssp"
#ERROR : Can't open dsspfile "1bg0A.bssp"
#ERROR : Can't open dsspfile "1d2zD.bssp"
#ERROR : Can't open dsspfile "3cioD.bssp"
#ERROR : Can't open dsspfile "2dflA.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "3dffA.bssp"
#ERROR : Can't open dsspfile "2c0bL.bssp"
#ERROR : Can't open dsspfile "1e2kA.bssp"
#ERROR : Can't open dsspfile "2bx2L.bssp"
#ERROR : Can't open dsspfile "1ai4B.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "3cr7D.bssp"
#ERROR : Can't open dsspfile "2bkeA.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1cr1A.bssp"
#ERROR : Can't open dsspfile "3cr7A.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "2b8tC.bssp"
#ERROR : Can't open dsspfile "3bo6B.bssp"
#ERROR : Can't open dsspfile "2dr3F.bssp"
#ERROR : Can't open dsspfile "2bnlB.bssp"
#ERROR : Can't open dsspfile "3a00A.bssp"
#ERROR : Can't open dsspfile "3d3qA.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "1e9rE.bssp"
#ERROR : Can't open dsspfile "3ecpA.bssp"
#ERROR : Can't open dsspfile "2dr3D.bssp"
#ERROR : Can't open dsspfile "3bczC.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "1ak2A.bssp"
#ERROR : Can't open dsspfile "3cmxA.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "5dfrA.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "1e2iA.bssp"
#ERROR : Can't open dsspfile "3b9qA.bssp"
#ERROR : Can't open dsspfile "2a30B.bssp"
#ERROR : Can't open dsspfile "1e9rG.bssp"
#ERROR : Can't open dsspfile "3dauA.bssp"
#ERROR : Can't open dsspfile "1d6jB.bssp"
#ERROR : Can't open dsspfile "1dhiA.bssp"
#ERROR : Can't open dsspfile "3cmvB.bssp"
#ERROR : Can't open dsspfile "1cr2A.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "2d4uA.bssp"
#ERROR : Can't open dsspfile "3dfnC.bssp"
#ERROR : Can't open dsspfile "3cmvE.bssp"
#ERROR : Can't open dsspfile "3cd9A.bssp"
#ERROR : Can't open dsspfile "3clvA.bssp"
#ERROR : Can't open dsspfile "1e9sB.bssp"
#ERROR : Can't open dsspfile "2bdtA.bssp"
#ERROR : Can't open dsspfile "2a1fF.bssp"
#ERROR : Can't open dsspfile "1av6A.bssp"
#ERROR : Can't open dsspfile "1bglA.bssp"
#ERROR : Can't open dsspfile "1e59A.bssp"
#ERROR : Can't open dsspfile "3dfdA.bssp"
#ERROR : Can't open dsspfile "2dpyB.bssp"
#ERROR : Can't open dsspfile "3d3qB.bssp"
#ERROR : Can't open dsspfile "2bkiA.bssp"
#ERROR : Can't open dsspfile "3b55A.bssp"
#ERROR : Can't open dsspfile "1eilA.bssp"
#ERROR : Can't open dsspfile "2aunA.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "3cr7B.bssp"
#ERROR : Can't open dsspfile "2aunB.bssp"
#ERROR : Can't open dsspfile "1e2hB.bssp"
#ERROR : Can't open dsspfile "3c85A.bssp"
#ERROR : Can't open dsspfile "3dfqA.bssp"
#ERROR : Can't open dsspfile "2bnlA.bssp"
#ERROR : Can't open dsspfile "3d1mA.bssp"
#ERROR : Can't open dsspfile "2drcA.bssp"
#ERROR : Can't open dsspfile "2cvfA.bssp"
#ERROR : Can't open dsspfile "3dfoD.bssp"
#ERROR : Can't open dsspfile "2a2zB.bssp"
#ERROR : Can't open dsspfile "3dftD.bssp"
#ERROR : Can't open dsspfile "3dfpD.bssp"
#ERROR : Can't open dsspfile "1ek0A.bssp"
#ERROR : Can't open dsspfile "3cnlA.bssp"
#ERROR : Can't open dsspfile "2bhvD.bssp"
#ERROR : Can't open dsspfile "2bhvA.bssp"
#ERROR : Can't open dsspfile "2c7cH.bssp"
#ERROR : Can't open dsspfile "1e9sL.bssp"
#ERROR : Can't open dsspfile "6aldA.bssp"
#ERROR : Can't open dsspfile "3d1mB.bssp"
#ERROR : Can't open dsspfile "3dlbB.bssp"
#ERROR : Can't open dsspfile "1cjaA.bssp"
#ERROR : Can't open dsspfile "1culC.bssp"
#ERROR : Can't open dsspfile "1aldA.bssp"
#ERROR : Can't open dsspfile "2bnlC.bssp"
#ERROR : Can't open dsspfile "3dfnA.bssp"
#ERROR : Can't open dsspfile "2aumB.bssp"
#ERROR : Can't open dsspfile "2bwjA.bssp"
#ERROR : Can't open dsspfile "1e9sE.bssp"
#ERROR : Can't open dsspfile "3dfnD.bssp"
#ERROR : Can't open dsspfile "3dfpC.bssp"
#ERROR : Can't open dsspfile "3dftC.bssp"
#ERROR : Can't open dsspfile "3czjA.bssp"
#ERROR : Can't open dsspfile "1adoA.bssp"
#ERROR : Can't open dsspfile "1e9rF.bssp"
#ERROR : Can't open dsspfile "1e2iB.bssp"
#ERROR : Can't open dsspfile "1e9rD.bssp"
#ERROR : Can't open dsspfile "2dftA.bssp"
#ERROR : Can't open dsspfile "3dfqD.bssp"
#ERROR : Can't open dsspfile "3cqcA.bssp"
#ERROR : Can't open dsspfile "1eamA.bssp"
#ERROR : Can't open dsspfile "1draA.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "2bhjA.bssp"
#ERROR : Can't open dsspfile "3cmtD.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "2dpyA.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "2bjbA.bssp"
#ERROR : Can't open dsspfile "1e9sI.bssp"
#ERROR : Can't open dsspfile "1e4vA.bssp"
#ERROR : Can't open dsspfile "2a1fD.bssp"
#ERROR : Can't open dsspfile "1akeA.bssp"
#ERROR : Can't open dsspfile "2b0lC.bssp"
#ERROR : Can't open dsspfile "3dymA.bssp"
#ERROR : Can't open dsspfile "1cs4C.bssp"
#ERROR : Can't open dsspfile "1dyhA.bssp"
#ERROR : Can't open dsspfile "3dfoC.bssp"
#ERROR : Can't open dsspfile "2ancF.bssp"
#ERROR : Can't open dsspfile "3be4A.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "2dftC.bssp"
#ERROR : Can't open dsspfile "1d6aA.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "3dyoA.bssp"
#ERROR : Can't open dsspfile "3bv4A.bssp"
#ERROR : Can't open dsspfile "3brwA.bssp"
#ERROR : Can't open dsspfile "1drbA.bssp"
#ERROR : Can't open dsspfile "2bv7A.bssp"
#ERROR : Can't open dsspfile "2e85A.bssp"
#ERROR : Can't open dsspfile "3cnnA.bssp"
#ERROR : Can't open dsspfile "3a00B.bssp"
#ERROR : Can't open dsspfile "2anbA.bssp"
#ERROR : Can't open dsspfile "1e9sM.bssp"
#ERROR : Can't open dsspfile "3dfqC.bssp"
#ERROR : Can't open dsspfile "4dfrA.bssp"
#ERROR : Can't open dsspfile "4atjA.bssp"
#ERROR : Can't open dsspfile "2e85B.bssp"
#ERROR : Can't open dsspfile "2czvB.bssp"
#ERROR : Can't open dsspfile "3cmwC.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "3crmA.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "3cueF.bssp"
#ERROR : Can't open dsspfile "2a1fE.bssp"
#ERROR : Can't open dsspfile "1cfrA.bssp"
#ERROR : Can't open dsspfile "2ccjA.bssp"
#ERROR : Can't open dsspfile "1dekB.bssp"
#ERROR : Can't open dsspfile "1e9sH.bssp"
#ERROR : Can't open dsspfile "2b8tD.bssp"
#ERROR : Can't open dsspfile "3cm0A.bssp"
#ERROR : Can't open dsspfile "1e2lA.bssp"
#ERROR : Can't open dsspfile "2boeX.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "1cjtC.bssp"
#ERROR : Can't open dsspfile "1e2jA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "2d7vA.bssp"
#ERROR : Can't open dsspfile "1c9kC.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"
#ERROR : Can't open dsspfile "2ancD.bssp"
#ERROR : Can't open dsspfile "1e2mB.bssp"
#ERROR : Can't open dsspfile "2d7vB.bssp"
#ERROR : Can't open dsspfile "1dp0A.bssp"
#ERROR : Can't open dsspfile "1e2nA.bssp"
#ERROR : Can't open dsspfile "3c15C.bssp"
#ERROR : Can't open dsspfile "2an9A.bssp"
#ERROR : Can't open dsspfile "2a1fC.bssp"
#ERROR : Can't open dsspfile "2d4uB.bssp"
#ERROR : Can't open dsspfile "1e2nB.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "1e2kB.bssp"
#ERROR : Can't open dsspfile "3cmuA.bssp"
#ERROR : Can't open dsspfile "3bwdD.bssp"
#ERROR : Can't open dsspfile "3e70C.bssp"
#ERROR : Can't open dsspfile "1e9sA.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "3dmdA.bssp"
#ERROR : Can't open dsspfile "2ancB.bssp"
#ERROR : Can't open dsspfile "1chdA.bssp"
#ERROR : Can't open dsspfile "3b85B.bssp"
#ERROR : Can't open dsspfile "3bjqB.bssp"
#ERROR : Can't open dsspfile "3cphA.bssp"
#ERROR : Can't open dsspfile "2b0lB.bssp"
#ERROR : Can't open dsspfile "3c14C.bssp"
#ERROR : Can't open dsspfile "1e9rB.bssp"
#ERROR : Can't open dsspfile "2c5mD.bssp"
#ERROR : Can't open dsspfile "2ax4A.bssp"
#ERROR : Can't open dsspfile "1cjvC.bssp"
#ERROR : Can't open dsspfile "2cdnA.bssp"
#ERROR : Can't open dsspfile "2bhvC.bssp"
#ERROR : Can't open dsspfile "1azsC.bssp"
#ERROR : Can't open dsspfile "2c95B.bssp"
#ERROR : Can't open dsspfile "2ax4B.bssp"
#ERROR : Can't open dsspfile "2c9gA.bssp"
#ERROR : Can't open dsspfile "1e2mA.bssp"
#ERROR : Can't open dsspfile "3e8aC.bssp"
#ERROR : Can't open dsspfile "1cjuC.bssp"
#ERROR : Can't open dsspfile "1delA.bssp"
#ERROR : Can't open dsspfile "2c9oA.bssp"
#ERROR : Can't open dsspfile "1e2lB.bssp"
#ERROR : Can't open dsspfile "2aexA.bssp"
#ERROR : Can't open dsspfile "3c7kA.bssp"
#ERROR : Can't open dsspfile "3cbqA.bssp"
#ERROR : Can't open dsspfile "2bwjB.bssp"
#ERROR : Can't open dsspfile "2a5vA.bssp"
#ERROR : Can't open dsspfile "3bs4A.bssp"
#ERROR : Can't open dsspfile "2bwjD.bssp"
#ERROR : Can't open dsspfile "3cr8B.bssp"
#ERROR : Can't open dsspfile "2bwjF.bssp"
#ERROR : Can't open dsspfile "3cddB.bssp"
#ERROR : Can't open dsspfile "3c94A.bssp"
#ERROR : Can't open dsspfile "2a5vB.bssp"
#ERROR : Can't open dsspfile "1delB.bssp"
#ERROR : Can't open dsspfile "1e2jB.bssp"
#ERROR : Can't open dsspfile "2dx7A.bssp"
#ERROR : Can't open dsspfile "1e6vC.bssp"
#ERROR : Can't open dsspfile "2bwjC.bssp"
#ERROR : Can't open dsspfile "3dkvA.bssp"
#ERROR : Can't open dsspfile "2bwjE.bssp"
#ERROR : Can't open dsspfile "2c9oB.bssp"
#ERROR : Can't open dsspfile "2a78A.bssp"
#ERROR : Can't open dsspfile "1dmaB.bssp"
#ERROR : Can't open dsspfile "1e9sK.bssp"
#ERROR : Can't open dsspfile "1dapA.bssp"
#ERROR : Can't open dsspfile "3cddE.bssp"
#ERROR : Can't open dsspfile "2axnA.bssp"
#ERROR : Can't open dsspfile "3dvlD.bssp"
#ERROR : Can't open dsspfile "2axzA.bssp"

## Summary of PDB Search
:810
    2e-91  27%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN
    8e-67  48%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    3e-54  12%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    1e-49  12%  3dm5A  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    9e-48   9%  3eiuA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    2e-47   9%  3dt2A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    4e-47  17%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    2e-46   9%  3dtbB  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    5e-46  11%  1dkiA  [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN
    9e-46  12%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    5e-45  13%  2akaB  [x.x.x] DYNAMIN-1
    4e-44  11%  1accA  [x.x.x] ANTHRAX PROTECTIVE ANTIGEN
    6e-44  20%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    8e-44  10%  2c61B  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    9e-44  19%  1e69A  [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN
    9e-44   6%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    7e-43  11%  3cmvH  [x.x.x] PROTEIN RECA
    1e-42  16%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    1e-41  10%  1e9cA  [c.37.1] THYMIDYLATE KINASE
    2e-41  12%  3dt4C  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    2e-41  14%  3bb1A  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-41  10%  3dt7A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    8e-41  10%  4dcgA  [x.x.x] VP39
    8e-41  10%  3dt4A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    2e-40   9%  3b2qA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    4e-40  10%  3cmvG  [x.x.x] PROTEIN RECA
    3e-39   6%  2dwpA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    3e-39  17%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    4e-39   8%  2b8tA  [x.x.x] THYMIDINE KINASE
    6e-39   8%  2c61A  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    1e-38  16%  2cjwB  [x.x.x] GTP-BINDING PROTEIN GEM
    2e-38   9%  3eiuB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    8e-38  10%  2ccjB  [x.x.x] THYMIDYLATE KINASE
    1e-37  11%  3c95A  [x.x.x] EXODEOXYRIBONUCLEASE I
    1e-37  12%  2ccgA  [x.x.x] THYMIDYLATE KINASE
    8e-37   9%  1d1cA  [c.37.1 - b.34.3] MYOSIN
    1e-36  10%  2ccgB  [x.x.x] THYMIDYLATE KINASE
    1e-36  12%  1e98A  [c.37.1] THYMIDYLATE KINASE
    2e-36  15%  1e9fA  [c.37.1] THYMIDYLATE KINASE
    3e-36  11%  3cmvA  [x.x.x] PROTEIN RECA
    4e-36  10%  3cmvC  [x.x.x] PROTEIN RECA
    5e-35   8%  2ahvA  [x.x.x] PUTATIVE ENZYME YDIF
    1e-34  12%  3cddF  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    5e-34  13%  1e2dA  [c.37.1] THYMIDYLATE KINASE
    6e-34  19%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-33   8%  1bifA  [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/
    1e-33  10%  3czpB  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    2e-33  11%  2b8wA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    2e-33   9%  3b2qB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    4e-33  11%  3ec1A  [x.x.x] YQEH GTPASE
    4e-32  11%  2c9yA  [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL
    4e-32  10%  2dr3A  [x.x.x] UPF0273 PROTEIN PH0284
    1e-31  10%  2c9oC  [x.x.x] RUVB-LIKE 1
    2e-31   5%  2czvA  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    3e-31  12%  1e9dA  [c.37.1] THYMIDYLATE KINASE
    3e-31   8%  2bifA  [c.37.1 - c.60.1] PROTEIN
    1e-30  14%  2bofX  [x.x.x] ENDOGLUCANASE E-2
    2e-30   9%  2ahwD  [x.x.x] PUTATIVE ENZYME YDIF
    3e-30  11%  2a5gA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    4e-30   9%  3da4A  [x.x.x] COLICIN-M
    5e-30  11%  2dr3E  [x.x.x] UPF0273 PROTEIN PH0284
    6e-30  12%  3bb1B  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    8e-30  23%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-29   9%  2axzC  [x.x.x] PRGX
    2e-29  11%  3d7wA  [x.x.x] BETA-GALACTOSIDE-SPECIFIC LECTIN 1
    2e-29  10%  3di4A  [x.x.x] UNCHARACTERIZED PROTEIN DUF1989
    3e-29  10%  2cgtH  [x.x.x] 60 KDA GROEL
    3e-29  10%  1e9sG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-29  13%  3a1wA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    4e-29   9%  3bgwA  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    4e-29   8%  1e1qB  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    7e-29  14%  1dg3A  [c.37.1 - a.114.1] PROTEIN (INTERFERON-INDUCED
    9e-29  12%  1e9sF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-28  13%  3b85A  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    2e-28  13%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-28  13%  3bb1E  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-28  14%  3ed8A  [x.x.x] YELLOW FLUORESCENCE PROTEIN
    2e-28   8%  2c4rL  [x.x.x] RIBONUCLEASE E
    2e-28  13%  3bb1H  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-28   9%  3bh0A  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    4e-28  12%  1cr4A  [c.37.1] DNA PRIMASE/HELICASE
    5e-28  10%  1e4yA  [c.37.1 - g.41.2] ADENYLATE KINASE
    5e-28  12%  2axpA  [x.x.x] HYPOTHETICAL PROTEIN BSU20280
    1e-27   9%  2cckA  [x.x.x] THYMIDYLATE KINASE
    2e-27  20%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    3e-27  16%  1e3mB  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    4e-27   8%  2ctsA  [x.x.x] CITRATE SYNTHASE
    4e-27  12%  2b92B  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    4e-27  15%  1e2fA  [c.37.1] THYMIDYLATE KINASE
    6e-27  10%  1e3mA  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    9e-27   8%  2bkhA  [x.x.x] UNCONVENTIONAL MYOSIN
    9e-27  14%  3cr7C  [x.x.x] ADENYLYL-SULFATE KINASE
    2e-26  10%  2eg5G  [x.x.x] XANTHOSINE METHYLTRANSFERASE
    2e-26  13%  3bb1F  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-26  13%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE
    3e-26   9%  2a2zA  [x.x.x] DEOXYCYTIDINE KINASE
    4e-26   8%  1aroP  [e.8.1] T7 RNA POLYMERASE
    4e-26  11%  1e9rA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-26   9%  2bc9A  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-25  11%  3czpA  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    2e-25  12%  1e9sD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-25  10%  2dr3B  [x.x.x] UPF0273 PROTEIN PH0284
    2e-25  10%  421pA  [x.x.x] H-RAS P21 PROTEIN
    3e-25  19%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    5e-25   9%  3bpbA  [x.x.x] DIMETHYLARGININE DIMETHYLAMINOHYDROLASE
    5e-25   9%  2ck3C  [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM
    6e-25  10%  1e0jB  [c.37.1] DNA HELICASE
    7e-25  11%  2d0kA  [x.x.x] DIHYDROFOLATE REDUCTASE
    9e-25  13%  3bb1C  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-24   8%  2b8tB  [x.x.x] THYMIDINE KINASE
    1e-24  12%  3dm5B  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    1e-24  12%  3cddD  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    1e-24  15%  3dm9B  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    2e-24  14%  3bm2B  [x.x.x] PROTEIN YDJA
    3e-24  10%  1dhjA  [c.71.1] DIHYDROFOLATE REDUCTASE
    4e-24  12%  2d4hA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    4e-24  27%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-24   7%  3cddC  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    5e-24   9%  2akaA  [x.x.x] MYOSIN II HEAVY CHAIN
    6e-24  13%  3bb1D  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    6e-24   9%  1e0jA  [c.37.1] DNA HELICASE
    6e-24   9%  2dr3C  [x.x.x] UPF0273 PROTEIN PH0284
    8e-24  11%  3bjdB  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
    1e-23  10%  2aumA  [x.x.x] HYPOTHETICAL PROTEIN
    1e-23  17%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-23  12%  3d3kA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
    2e-23   9%  1bmfC  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    2e-23  11%  2d4hB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    3e-23  11%  1e6cA  [c.37.1] SHIKIMATE KINASE
    4e-23  11%  1dvrA  [c.37.1 - g.41.2] ADENYLATE KINASE
    5e-23  23%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    7e-23  19%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    7e-23  13%  3bb1G  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-22  14%  3cbnA  [x.x.x] CONSERVED PROTEIN MTH639
    1e-22  26%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    2e-22   8%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT
    2e-22   8%  3bgwD  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    4e-22  12%  3adkA  [x.x.x] ADENYLATE KINASE
    5e-22   8%  2ausC  [x.x.x] PSEUDOURIDINE SYNTHASE
    5e-22  14%  1e2gA  [c.37.1] THYMIDYLATE KINASE
    6e-22  11%  2a30A  [x.x.x] DEOXYCYTIDINE KINASE
    6e-22  10%  2a5jA  [x.x.x] RAS-RELATED PROTEIN RAB-2B
    7e-22  10%  2b8wB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    9e-22  11%  3ch4B  [x.x.x] PHOSPHOMEVALONATE KINASE
    9e-22  13%  3c8uA  [x.x.x] FRUCTOKINASE
    1e-21  11%  2a30D  [x.x.x] DEOXYCYTIDINE KINASE
    1e-21  11%  1e9sJ  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-21  11%  1bg0A  [a.83.1 - d.128.1 (1m15A)] ARGININE KINASE
    2e-21   7%  1d2zD  [a.77.1] DEATH DOMAIN OF TUBE
    2e-21  10%  3cioD  [x.x.x] TYROSINE-PROTEIN KINASE ETK
    3e-21  11%  2dflA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    4e-21  17%  2d2eA  [x.x.x] SUFC PROTEIN
    4e-21   9%  3dffA  [x.x.x] TEICOPLANIN PSEUDOAGLYCONE DEACETYLASES ORF2
    5e-21   8%  2c0bL  [x.x.x] RIBONUCLEASE E
    7e-21  12%  1e2kA  [c.37.1] THYMIDINE KINASE
    7e-21   8%  2bx2L  [x.x.x] RIBONUCLEASE E
    7e-21   8%  1ai4B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    9e-21  18%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-20  14%  3cr7D  [x.x.x] ADENYLYL-SULFATE KINASE
    1e-20  10%  2bkeA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    1e-20  12%  1cr0A  [c.37.1] DNA PRIMASE/HELICASE
    2e-20  12%  1cr1A  [c.37.1] DNA PRIMASE/HELICASE
    2e-20  13%  3cr7A  [x.x.x] ADENYLYL-SULFATE KINASE
    2e-20  10%  1afrA  [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    3e-20   7%  2b8tC  [x.x.x] THYMIDINE KINASE
    3e-20  10%  3bo6B  [x.x.x] HYDROPHILIC PROTEIN, VIRA PROTEIN
    3e-20  11%  2dr3F  [x.x.x] UPF0273 PROTEIN PH0284
    5e-20   7%  2bnlB  [x.x.x] MODULATOR PROTEIN RSBR
    5e-20  15%  3a00A  [x.x.x] GUANYLATE KINASE
    6e-20   9%  3d3qA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    6e-20  11%  1d6jA  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    8e-20  12%  1e9rE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-19  13%  3ecpA  [x.x.x] TN5 TRANSPOSASE
    1e-19   9%  2dr3D  [x.x.x] UPF0273 PROTEIN PH0284
    1e-19  10%  3bczC  [x.x.x] PROTEIN MEMO1
    1e-19  24%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-19  19%  2d2fA  [x.x.x] SUFC PROTEIN
    2e-19  11%  1ak2A  [x.x.x] ADENYLATE KINASE ISOENZYME-2
    2e-19  12%  3cmxA  [x.x.x] PROTEIN RECA
    2e-19  13%  2cckB  [x.x.x] THYMIDYLATE KINASE
    2e-19   9%  5dfrA  [x.x.x] DIHYDROFOLATE REDUCTASE
    2e-19  22%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-19   9%  1e2iA  [c.37.1] THYMIDINE KINASE
    3e-19  10%  3b9qA  [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT
    3e-19  12%  2a30B  [x.x.x] DEOXYCYTIDINE KINASE
    4e-19  10%  1e9rG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-19   9%  3dauA  [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE
    6e-19  18%  1d6jB  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    8e-19  10%  1dhiA  [c.71.1] DIHYDROFOLATE REDUCTASE
    8e-19  10%  3cmvB  [x.x.x] PROTEIN RECA
    9e-19  11%  1cr2A  [c.37.1] DNA PRIMASE/HELICASE
    9e-19  28%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    9e-19  12%  2d4uA  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    1e-18   9%  3dfnC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-18  10%  3cmvE  [x.x.x] PROTEIN RECA
    1e-18  10%  3cd9A  [x.x.x] GREEN FLUORESCENT PROTEIN
    2e-18  15%  3clvA  [x.x.x] RAB5 PROTEIN, PUTATIVE
    2e-18  11%  1e9sB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-18  15%  2bdtA  [x.x.x] BH3686
    2e-18   7%  2a1fF  [x.x.x] URIDYLATE KINASE
    2e-18  10%  1av6A  [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))
    3e-18   8%  1bglA  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    3e-18   9%  1e59A  [c.60.1] PHOSPHOGLYCERATE MUTASE
    3e-18  12%  3dfdA  [x.x.x] PROTEIN YQBN
    3e-18  12%  2dpyB  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    3e-18  11%  3d3qB  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    3e-18   7%  2bkiA  [x.x.x] UNCONVENTIONAL MYOSIN
    7e-18  11%  3b55A  [x.x.x] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN
    9e-18  10%  1eilA  [d.32.1 - d.32.1] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE
    1e-17  11%  2aunA  [x.x.x] HYPOTHETICAL PROTEIN
    1e-17  10%  1dekA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    1e-17  12%  3cr7B  [x.x.x] ADENYLYL-SULFATE KINASE
    1e-17  11%  2aunB  [x.x.x] HYPOTHETICAL PROTEIN
    1e-17  13%  1e2hB  [c.37.1] THYMIDINE KINASE
    2e-17  12%  3c85A  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    2e-17  16%  3dfqA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-17   6%  2bnlA  [x.x.x] MODULATOR PROTEIN RSBR
    2e-17  14%  3d1mA  [x.x.x] SONIC HEDGEHOG PROTEIN
    2e-17  11%  2drcA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-17   9%  2cvfA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB
    3e-17  12%  3dfoD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-17  11%  2a2zB  [x.x.x] DEOXYCYTIDINE KINASE
    3e-17  12%  3dftD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-17  12%  3dfpD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-17  14%  1ek0A  [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)
    4e-17   9%  3cnlA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    5e-17  14%  2bhvD  [x.x.x] COMB10
    6e-17  15%  2bhvA  [x.x.x] COMB10
    7e-17  12%  2c7cH  [x.x.x] 60 KDA CHAPERONIN
    7e-17  10%  1e9sL  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-17  15%  6aldA  [c.1.10] FRUCTOSE-1,6-BIS(PHOSPHATE) ALDOLASE
    8e-17  16%  3d1mB  [x.x.x] SONIC HEDGEHOG PROTEIN
    9e-17   8%  3dlbB  [x.x.x] ARGONAUTE
    9e-17  10%  1cjaA  [d.144.1] PROTEIN (ACTIN-FRAGMIN KINASE)
    1e-16  14%  1culC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    1e-16  14%  1aldA  [c.1.10 (2aldA)] ALDOLASE A
    1e-16   8%  2bnlC  [x.x.x] MODULATOR PROTEIN RSBR
    2e-16  13%  3dfnA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-16  13%  2aumB  [x.x.x] HYPOTHETICAL PROTEIN
    2e-16  14%  2bwjA  [x.x.x] ADENYLATE KINASE 5
    2e-16  11%  1e9sE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-16  13%  3dfnD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-16   9%  3dfpC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-16  12%  3dftC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-16  10%  3czjA  [x.x.x] BETA-GALACTOSIDASE
    3e-16  14%  1adoA  [c.1.10] ALDOLASE
    3e-16  14%  1e9rF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-16  12%  1e2iB  [c.37.1] THYMIDINE KINASE
    4e-16  12%  1e9rD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-16  15%  2dftA  [x.x.x] SHIKIMATE KINASE
    5e-16  12%  3dfqD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-16   8%  3cqcA  [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP107
    5e-16  11%  1eamA  [c.66.1] PROTEIN (VP39)
    6e-16  10%  1draA  [c.71.1] DIHYDROFOLATE REDUCTASE
    8e-16   3%  1ckvA  [x.x.x] PROTEIN (PROTEIN B)
    8e-16   9%  2bhjA  [x.x.x] NITRIC OXIDE SYNTHASE
    8e-16  13%  3cmtD  [x.x.x] PROTEIN RECA
    8e-16  22%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    9e-16  14%  2dpyA  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    1e-15  16%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-15   9%  2bjbA  [x.x.x] 3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE
    2e-15  14%  1e9sI  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-15   6%  1e4vA  [c.37.1 - g.41.2] ADENYLATE KINASE
    3e-15   8%  2a1fD  [x.x.x] URIDYLATE KINASE
    3e-15   7%  1akeA  [c.37.1 - g.41.2] ADENYLATE KINASE
    3e-15  16%  2b0lC  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    3e-15   9%  3dymA  [x.x.x] BETA-GALACTOSIDASE
    4e-15  18%  1cs4C  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    4e-15   9%  1dyhA  [c.71.1] DIHYDROFOLATE REDUCTASE
    5e-15  14%  3dfoC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-15  15%  2ancF  [x.x.x] GUANYLATE KINASE
    6e-15  12%  3be4A  [x.x.x] ADENYLATE KINASE
    6e-15  19%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-15  15%  1d8jA  [a.4.5] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    7e-15  12%  2dftC  [x.x.x] SHIKIMATE KINASE
    8e-15   9%  1d6aA  [d.165.1] POKEWEED ANTIVIRAL PROTEIN
    1e-14  21%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-14   9%  3dyoA  [x.x.x] BETA-GALACTOSIDASE
    2e-14  14%  3bv4A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-14   7%  3brwA  [x.x.x] RAP1 GTPASE-ACTIVATING PROTEIN 1
    2e-14   7%  1drbA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-14  15%  2bv7A  [x.x.x] GLYCOLIPID TRANSFER PROTEIN
    3e-14  12%  2e85A  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    3e-14  11%  3cnnA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    3e-14  15%  3a00B  [x.x.x] GUANYLATE KINASE
    4e-14  15%  2anbA  [x.x.x] GUANYLATE KINASE
    5e-14  11%  1e9sM  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-14  14%  3dfqC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    6e-14   9%  4dfrA  [c.71.1] DIHYDROFOLATE REDUCTASE
    6e-14  10%  4atjA  [a.93.1] PROTEIN (PEROXIDASE C1A)
    7e-14  14%  2e85B  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    1e-13   6%  2czvB  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    1e-13  11%  3cmwC  [x.x.x] PROTEIN RECA
    1e-13  17%  1ckeA  [c.37.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    2e-13  10%  3crmA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    2e-13  13%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-13  17%  3cueF  [x.x.x] GTP-BINDING PROTEIN YPT1
    2e-13   9%  2a1fE  [x.x.x] URIDYLATE KINASE
    2e-13  15%  1cfrA  [x.x.x] RESTRICTION ENDONUCLEASE
    5e-13  11%  2ccjA  [x.x.x] THYMIDYLATE KINASE
    5e-13  10%  1dekB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    5e-13  11%  1e9sH  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-13   9%  2b8tD  [x.x.x] THYMIDINE KINASE
    7e-13  13%  3cm0A  [x.x.x] ADENYLATE KINASE
    8e-13  11%  1e2lA  [c.37.1] THYMIDINE KINASE
    9e-13  11%  2boeX  [x.x.x] ENDOGLUCANASE E-2
    1e-12  17%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    2e-12  16%  1cjtC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    3e-12  13%  1e2jA  [c.37.1] THYMIDINE KINASE
    4e-12  13%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-12   8%  2d7vA  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    6e-12  13%  1c9kC  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    8e-12  10%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
    9e-12  15%  2ancD  [x.x.x] GUANYLATE KINASE
    1e-11  14%  1e2mB  [c.37.1] THYMIDINE KINASE
    1e-11   9%  2d7vB  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    2e-11   9%  1dp0A  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    3e-11  11%  1e2nA  [c.37.1] THYMIDINE KINASE
    6e-11  14%  3c15C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    7e-11  15%  2an9A  [x.x.x] GUANYLATE KINASE
    1e-10   9%  2a1fC  [x.x.x] URIDYLATE KINASE
    2e-10   8%  2d4uB  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    2e-10  12%  1e2nB  [c.37.1] THYMIDINE KINASE
    2e-10   8%  1bccF  [f.27.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    3e-10  12%  1e2kB  [c.37.1] THYMIDINE KINASE
    4e-10  11%  3cmuA  [x.x.x] PROTEIN RECA
    4e-10  13%  3bwdD  [x.x.x] RAC-LIKE GTP-BINDING PROTEIN ARAC6
    5e-10  11%  3e70C  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    9e-10  13%  1e9sA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-09  10%  1e2hA  [c.37.1] THYMIDINE KINASE
    1e-09  13%  3dmdA  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    4e-09  15%  2ancB  [x.x.x] GUANYLATE KINASE
    4e-09  16%  1chdA  [x.x.x] CHEB METHYLESTERASE
    4e-09  10%  3b85B  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    5e-09   8%  3bjqB  [x.x.x] PHAGE-RELATED PROTEIN
    5e-09  10%  3cphA  [x.x.x] RAS-RELATED PROTEIN SEC4
    6e-09  16%  2b0lB  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    6e-09  12%  3c14C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    6e-09  15%  1e9rB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-09  16%  2c5mD  [x.x.x] CTP SYNTHASE
    1e-08  18%  2ax4A  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    1e-08  13%  1cjvC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    2e-08  10%  2cdnA  [x.x.x] ADENYLATE KINASE
    2e-08  15%  2bhvC  [x.x.x] COMB10
    2e-08  11%  1azsC  [c.37.1 - a.66.1] GS-ALPHA
    2e-08  17%  2c95B  [x.x.x] ADENYLATE KINASE 1
    2e-08  12%  2ax4B  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    4e-08   8%  2c9gA  [x.x.x] PENTON PROTEIN
    4e-08  12%  1e2mA  [c.37.1] THYMIDINE KINASE
    4e-08  14%  3e8aC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    5e-08  12%  1cjuC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    6e-08  12%  1delA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    7e-08  10%  2c9oA  [x.x.x] RUVB-LIKE 1
    9e-08  10%  1e2lB  [c.37.1] THYMIDINE KINASE
    1e-07   9%  2aexA  [x.x.x] COPROPORPHYRINOGEN III OXIDASE, MITOCHONDRIAL
    3e-07  15%  3c7kA  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    7e-07  11%  3cbqA  [x.x.x] GTP-BINDING PROTEIN REM 2
    8e-07  24%  2bwjB  [x.x.x] ADENYLATE KINASE 5
    8e-07  13%  2a5vA  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    8e-07   7%  3bs4A  [x.x.x] UNCHARACTERIZED PROTEIN PH0321
    1e-06  26%  2bwjD  [x.x.x] ADENYLATE KINASE 5
    2e-06  11%  3cr8B  [x.x.x] SULFATE ADENYLYLTRANFERASE, ADENYLYLSULFATE
    3e-06  26%  2bwjF  [x.x.x] ADENYLATE KINASE 5
    4e-06   9%  3cddB  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    5e-06  11%  3c94A  [x.x.x] EXODEOXYRIBONUCLEASE I
    9e-06  13%  2a5vB  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    1e-05  14%  1delB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    2e-05  15%  1e2jB  [c.37.1] THYMIDINE KINASE
    2e-05   7%  2dx7A  [x.x.x] ASPARTATE RACEMASE
    2e-05   6%  1e6vC  [d.58.31] METHYL-COENZYME M REDUCTASE I GAMMA SUBUNIT
    3e-05  26%  2bwjC  [x.x.x] ADENYLATE KINASE 5
    3e-05  12%  3dkvA  [x.x.x] ADENYLATE KINASE
    4e-05  26%  2bwjE  [x.x.x] ADENYLATE KINASE 5
    4e-05  15%  2c9oB  [x.x.x] RUVB-LIKE 1
    9e-05  14%  2a78A  [x.x.x] RAS-RELATED PROTEIN RAL-A
    9e-05  10%  1dmaB  [d.166.1] EXOTOXIN A
    1e-04  16%  1e9sK  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-04   6%  1dapA  [c.2.1 - d.81.1] DIAMINOPIMELIC ACID DEHYDROGENASE
    2e-04  10%  3cddE  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    2e-04  17%  2axnA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    5e-04  15%  3dvlD  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    7e-04   9%  2axzA  [x.x.x] PRGX
:810

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3b60A           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
2bnlB           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2bnlA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2bnlC           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
3cr8B           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
2dx7A           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
1dmaB           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
3cddE           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
2axzA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3b60A           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
2bnlB           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2bnlA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2bnlC           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
3cr8B           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
2dx7A           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
1dmaB           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
3cddE           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
2axzA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3b60A           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
2bnlB           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2bnlA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2bnlC           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
3cr8B           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
2dx7A           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
1dmaB           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
3cddE           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
2axzA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxATLQKLLSYTKPDVAFLVAASFFLIVAALGETFLPYYTGRAIDGIVIQKSMDQFSTAVVIVCLLA
3b60A           -----QTFRRLWPTIAPFKAGXXXXXXXXXXXXXXXXXXXXXXXPLLDDGFGKTXXXXXXXXXXXXXXXX
3b5jA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
2bnlB           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2bnlA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2bnlC           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
3cr8B           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
2dx7A           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
1dmaB           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
3cddE           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
2axzA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IGSSFAAGIRGGIFTLIFARLNIRLRNCLFRSLVSQETSFFDENRTGDLISRLTSDTTMVSDLVSQNINV
3b60A           XXXXXXXYISSYCISWVSGKVVMTMRRRLFGHMMGMPVAFFDKQSTGTLLSRITYDSEQVASXXXXXXXX
3b5jA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
3dt2A           -------------------------------------------HNGLDFSAKVIQGPQEVRKFVEGNAQL
2c03B           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------GSMPPQLHNGLDFSA-KVIQGLPQ
4dcgA           ----------------------------------------------------------------------
3dt4A           -------------------------------------------NGLDFSAKVIQGSLDEVRKFVEGNAQL
3b2qA           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
2bnlB           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2bnlA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2bnlC           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
3cr8B           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
2dx7A           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
1dmaB           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
3cddE           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
2axzA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           FLRNTVKVTGVVVFMFSLSWQLSLVTFMGFPIIMMVSNIYGKYYKRLSKEVQNALARASNTAEETISAMK
3b60A           XXXXXXXXXXXXXXXFYYSXXXXXXXXXXXXXXXXXXXXXXKRFRSISKNMQNTMGQVTTSAEQMLKGHK
3b5jA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
3dt2A           CQPEYIHICDGSEEEYGRLLAHMQEEGVIRKLKKYDNCWLALTDPRDVARIESKTVIITQEQRDTVPIPK
2c03B           ----------------------------------------------------------------------
3dtbB           -----------------------MQEEGVIRKLKKYDNCWALTDPRDVARIESKTVIITQEQRDTVPIPK
1dkiA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
1accA           --------------------KVTGRIDKNVSPEARHPLVAAYPIVHVDME-NIILSKNETISKNTSTSRT
2d3wB           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
3dt4C           -----------------------LLAHMQEEGVIRKLKKYDNTDPRDVARIESKTVIITQEQRDTVPIPK
3bb1A           ----------------------------------------------------------------------
3dt7A           EVRKFVEGNAQLCQPEYIHICDGMQEEGVIRKLKKYDNCWALTDPRDVARIESKTVIITQEQRDTVPIPK
4dcgA           ----------------------------------------------------------------------
3dt4A           CQPEYIHICDGS-EEEYGRLLAHMQEEGVIRKLKKYDNCLALTDPRDVARIESKTVIITQEQRDTVPIPK
3b2qA           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3bgwA           -------------------------------------------------YAEQAVLGSILTEPELIKECP
1e1qB           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
2bnlB           --------------------------------------------QTVYQFIAENQNELLQLWTDTLKELS
3a00A           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2bnlA           --------------------------------------------QTVYQFIAENQNELLQLWTDTLKELS
3d1mA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2bnlC           -------------------------------------------NQTVYQFIAENQNELLQLWTDTLKELS
3dfnA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
1d6aA           --------------------------------------------------------------VGSTTISK
3bk7A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
3cr8B           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
2dx7A           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
1dmaB           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
3cddE           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
2axzA           -------------------------------LKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAV


                         .         .         +         .         .         .         .:490
query           TVRSFANEEEEAEVYLRKLQQVYKLNRKEAAAYMYYVWGSGLTLLVVQVSILYYGGHLVISGQMTSGNLI
3b60A           EVLIFGGQEVETKRFDKVSNKMRLQGMKMVSASSISXXXXXXXXXXXXXXXXXXXXXXXVMDXXXXXXXX
3b5jA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
3dm5A           --------------------------------------------------------------NTLKKIAR
3eiuA           ---------------------------------------AGPLIFVEKTEPVGYNEIVNIKMGDGTVRRG
3dt2A           SGQSQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLAKIGIELTDSPYVVASMRIMTRMG
2c03B           ----------------------------------------------------------------------
3dtbB           SGQSQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLAKIGIELTDSPYVVASMRIMTRMG
1dkiA           ---------------------------------------------------------VNLGGELSGSNMY
3dmdB           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
1accA           HTSEVVSAGFSNSNSSTVAIDHSLSLAGGLNTADTARLNANIRYVNT-GTAPIYNVLPTTSLVLGKNQTL
2d3wB           ----------------------------------------------------------------------
2c61B           --------------------------------------------KTEPVGYNEIVNIKMGDGTVRRGQVL
1e69A           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
2c03A           -------------------------------------------------------------QEAIGRLRG
1e9cA           ----------------------------------------------------------------------
3dt4C           SGQSQLGRWMSEEDFEKAFNARFPCMKGRTMYVIPFSMGPLGSPLAKIGIELTDSPYVVASMRMGTSVLE
3bb1A           ----------------------------------------------------------------------
3dt7A           SGQSQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLAKIGIELTDSPYVVLEALGDGEFI
4dcgA           ----------------------------------------------------------------------
3dt4A           SGQSQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLAKIGIELTDSPYVVASMRIMTRMG
3b2qA           ---------------------------------------AGPLIFVEKTEPVGYNEIVNIKDGTVRRGQV
3cmvG           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
2c61A           --------------------------------------------KTEPVGYNEIVNIKMGDGTVR---RG
2cjwB           ----------------------------------------------------------------------
3eiuB           --------------------------------------------KTEPVGYNEIVNIKMGDGTV--RRGQ
2ccjB           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
3cddF           ---------------------------------------------------------------LKAGGKI
1e2dA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
3b2qB           --------------------------------------------PVGYNEIVNIKMGDGTVRRGQVLDSS
3ec1A           --------------------------------------------------------SMLHRI-GESKALV
2c9yA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
3da4A           --------------------------------------------------PSYGNGAFSLSAPHVPGAGP
2dr3E           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3bgwA           LTPEHFSPGKHFNIY-FTMQDLDRKGQSVDFTSIAARVGEKLPQLGGFGYLTELAASVASTTTFKQHCQT
1e1qB           -------------------------------------------LRNVQAEEMVEFSSGLKGMSLNLEPDN
1dg3A           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
3ed8A           -----------------------------------------------------TIGKLTLKFICTTGKLV
2c4rL           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
2bkhA           ---------------------------------------------------------QVFPAEEDSKKDV
3cr7C           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
2ck3C           --------------------------------------------EMVEFSSGLKGMSLNLEPDN--VGVV
1e0jB           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
3dm5B           -------------------------------------------------------------ANTLKKIAR
3cddD           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1bmfC           -----ADTSVDLEET----GRVLSIGDGIARVHGLRNVQAEEMVEF---SSGLKGMSLNLEPDNVG--VV
2d4hB           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
1e3aB           ----------------------------HGAGYDVTGNTPFAYPGLVFGHNGVISWGSTAGFGDDVDLSA
3bgwD           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
1d2zD           --------------------------------------------------------------------LS
3cioD           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------GISQTV
2d2eA           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------IESPEQKKANIY
1e2kA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
2bkeA           ---------------------------------------------------------------PGISQTV
1cr0A           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
2bnlB           EQESYQLTDQVYENISKEYIDILLLSVKDENAAESQ-ISELALRAVQIGLSKFLATALAEFWKRLYTKND
3a00A           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3b9qA           -------------------------------------------------------------ENLAVIDEL
2a30B           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
3cd9A           --------------------------FTGVVPILVELDGDGHKFSVSGEGEDATYGKLTLKFISTTGKLP
3clvA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2bnlA           EQESYQLTDQVYENISKEYIDILLLSVK-DENAAESQISELALRAVQIGLSKFLATALAEFWKRLYTKND
3d1mA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
3cnlA           ---------------------------------------------------------------------L
2bhvD           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2bnlC           EQESYQLTDQVYENISKEYIDILLLSVKDENAALRAVQIGLSKFLATALAEFWKRLYTKNDKRLPDQEST
3dfnA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2dpyA           ---------------------------------------------LTRAT----GLVLEATGLQLPGATC
2awnA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
1d6aA           YATFLNDLRNEAKDPSLKCYGIPMLPNTNTNPVELQGSNKKTITLMLRRNNLY------VMGYSDPFETN
3bk7A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
3cnnA           ---------------------------------------------------------------------L
3a00B           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
3cr8B           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
2dx7A           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
1dmaB           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
1dapA           ----NHRDIPRHRQVMNEAATAAGNVALVSTGWDPGMFSINRVYAAAVLAEHQQHTFWGPGLSQGHSDAL
3cddE           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
2axzA           NIINIFGKEDIHRSLVEELTKISKEKFTPPKEVTYY----------------------------------


                         *         .         .         .         .         +         .:560
query           AFIIYEFVLGDCMESVGSVYSGLMQGVGAAEKVFEFIDRQPTMVHDGSLAPDHLEGRVDFENVTFTYRTR
3b60A           XXXXXXXXXXXXXXXLTNVNAQFQRGMAACQTLFAILDSEQEK-DEGKRVIDRATGDLEFRNVTFTYPGR
3b5jA           -------------------------------------------------------HDITFRNIRFRYKPD
3dmdC           -----------------------------VDALREKIKQKLVGKKVIGTDKGKIIEEAVKEAVSEILE-T
3dm5A           ASSVDEALI---KELVRDIQRALIQADVNVRLVLQLTREIQ-RRALEEKPPAGISKKEHIIKIVYEELTK
3eiuA           QVLDSSADIVVVQVFFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQGAAMNPYARLPPKDFIQTG
3dt2A           TSVLEALGDGEFIKPLVNNWACNPELTLIAHLPDRREIISFGSGYGGNSLLGKKCFALRIASRLAKEEGW
2c03B           ------------------IRRALMDADVNLEVTRDFVERVREEALGKQVLESLTPAEVILATVYEAL---
3dtbB           TSVLEALGDGEFVGCPLPLKKPLVNNWACNPELTLIAHLPDRREIISFGSGYGGNSLLGKKCFALRIASR
1dkiA           VYNGF-VIVSGDKRSPEILGYSTSGSFDVNGKENIASFMESYVEQIKENKKPVVKSLLDSKGIHYNQGNP
3dmdB           -----------------------------VDALREKIKQKLVGKKVIGTDKGKIIEEAVKEAVSEILE-T
2akaB           ------------------------------------------------------------EDLIPLVNRL
1accA           ATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKVYGNIATYNFENGRVRV
2d3wB           ---------------------------------------------------------LSIKDLHVSVEDK
2c61B           DSSAD-IVVVQVFIFTGETLK-LPASVDLLGRILSGSGEPRDGGPRIVDINGAAMNPYARLPPKDFIQTG
1e69A           ----------------------------------------------------------------------
2dwoA           ------------------------------------------------------LTQSRVQKIWVPVDHR
3cmvH           -------------------------------------------------------GEDRSMDVETISTGS
2c03A           RGRITEEDLKATLREI---RRALMDADVNLEVTRDFVERVREEALGKQVLESLTPAEVILATVYEALKEA
1e9cA           ----------------------------------------------------------------------
3dt4C           ALGDGEFIK--CLHSVGCPLPLKKPCNPELTLIAHLPDRREIISFGSGYGGNSLLFALRIASRLAKEEGL
3bb1A           ---------------------------------------------------QTVRGWSGINTFAPATQTK
3dt7A           KCLHSVGCPLPLKKPLVNNWACNPELTLIAHLPDRREIISFGSGYGGNSLLGKKCFALRIASRLAKEEGW
4dcgA           -----------------------MDVV-SLDKPFMYFEEID---------NELDYEPESANEVAKKLPYQ
3dt4A           TSVLEALGDGEFIKCLHSPLVNNWACNPELTLIAHLPDRREIISFGSGYGGGKKCFALRIASRLAKEEGW
3b2qA           LDSSADIVVVQVFEIFTGETLKLPASVDLLGRILSGSGEPRDGIVPDQLLDINGAAMNPYARLPPKDF-I
3cmvG           ------------------------------------------------------------ETISTGSLSL
2dwpA           ----------------------------------------------------------------------
2c04A           RGRITEEDLKATLREI---RRALMDADVNLEVARDFVERVREEALGKQVLESLTPAEVILATVYEALKEA
2b8tA           ----------------------------------------------------------------------
2c61A           QVLDSSADIVVVQVFFTGETLKLPASVDLLGRILSGSGEPRDRIVPDQLLDINGAAMNPYARLPPKDF-I
2cjwB           ----------------------------------------------------------------------
3eiuB           VLDSSADIVVVQVFIFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVDINGAAMNPYARLPPKDFIQTG
2ccjB           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------VAPLAWHPENRNAVIM-V
2ccgA           ----------------------------------------------------------------------
1d1cA           --------------------------------------------------MVDIFKGRRRNEVAPHIF--
2ccgB           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------GSIMRLGEDRSMDVETISTGSLSL
3cmvC           ------------------------------------------------------LGEDRSMDVETIS-TG
2ahvA           ------------------------------------------------------------KPPRINGRVP
3cddF           YQGWTKIGITRSLEASGAFDLETYKFNDAQYKAFIEPIKQGQACTVD--IGGERVITGYVDDWVPSYDES
1e2dA           ----------------------------------------------------------------------
2bbsA           ------------------------------------------------------TTEVVMENVTAFWEEG
1bifA           ----------------------------------------------------------------------
3czpB           -----------------------------------------------------------DAYKEQLAAEQ
2b8wA           ---------------------------------------------------------CLIENTNGRLMAN
3b2qB           ADIVV--VQVFEGVIFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAARLPPKDFIQTG
3ec1A           VNIVDIFDFNGSFIPGLPRFAADNPILLVGNKADLLPRSVKYPKLLRWMRRMAELGLCPVDVCLVSAAKG
2c9yA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2c9oC           -------------------------------KSTTKTQRIASHSHVKGLGLDESGLAQAASGLVGQENAE
2czvA           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
2ahwD           ------------------------------------------------------------KPPRINGRVP
2a5gA           ----------------------------------------------------------------------
3da4A           LLVQV---VYSFFQSPNMCLQALTQLEDYIKKHGASNPLTLQIISTNIGYFCNADNLVLHPGISVYDAYH
2dr3E           ---------------------------------------------------------------TRRVKTG
3bb1B           -----------------------------------------------------VRGWSGINTFAPATQTK
2awnB           -------------------------------------------------------ASVQLQNVTKAWGEV
2axzC           ----------------------------------------------------------------------
3d7wA           ------------------------------------------------------LLRDYVSSGSFSN---
3di4A           ----------------------------------------ICYPNDSLPRPDLALYRAARASARKTGE--
2cgtH           ----------------------VKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITK--
1e9sG           -----------------------------------------------------IVSGGKLKRMTREKAKQ
3a1wA           ----------------------------------------------------------------------
3bgwA           VSEYFQRKAISIAQQIIENVNVKPIQEAVSELMEIEASGTDDDDGSIDEALVTVYEEIESADGNITGV-P
1e1qB           VGVVVFIKEGDIVKRTGAIVD-VPVGEELLGRVVDALGNAIDGIGSKARRRVGLKAPGIIPRISVREPMQ
1dg3A           ---------------------------------------------------------CLIENTNGRLMAN
1e9sF           -------------------------------------------VGQGEFGGAPFKRFLRLKRMTREKAKQ
3b85A           ---------------------------------------------------------------------R
2awnD           -------------------------------------------------------ASVQLQNVTKAWGEV
3bb1E           -----------------------------------------------------VRGWSGINTFAPATQTK
3ed8A           PWPTLVTTLLQCFARYPDHMKQHMPEGYVQERTISFKDGKYKTRAVVKFEGDTLVNRIELKGTDFKE---
2c4rL           ---------------------------------------VQIDKEERGNKGAALTTFISLAGSYLVLMPN
3bb1H           -----------------------------------------------------VRGWSGINTFAPATQTK
3bh0A           ----------------------------------DDGSIDEAL------VTVYEEIESADGNITGVPSGF
1cr4A           ---------------------------------------------------------SSEESVGLLFSGC
1e4yA           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2d62A           -------------------------------------------------------AEVKLINIWKRFGDV
1e3mB           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2b92B           ---------------------------------------------------------CLIENTNGRLMAN
1e2fA           ----------------------------------------------------------------------
1e3mA           -----------------------------------------------------------VLTSKGKALAL
2bkhA           EDNCS-LMYLNEATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSETIKYQGKSLGTMPPHVFA
3cr7C           ----------------------------------------------------------------------
2eg5G           ------------------------------------------------------NSAYNQLVLAKVKLEQ
3bb1F           -----------------------------------------------------VRGWSGINTFAPATQTK
2a2zD           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
1e9rA           ------------------------------------QGEFGGAPFKRFLRGTRIVSGGKLKRMTREKAKQ
2bc9A           -------------------------------------------------EIHMTGPMCLIENTNGRLMAN
3czpA           -----------------------------------------------------------DAYKEQLAAEQ
1e9sD           -----------------------------------------------------IVSGGKLKRMTREKAKQ
2dr3B           ---------------------------------------------------------------TRRVKTG
421pA           ----------------------------------------------------------------------
2d3wC           ---------------------------------------------------------LSIKDLHVSVEDK
3bpbA           --------------------------------------------------------HIIARTPARSLVDG
2ck3C           VFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAKGPIGSKARRRVGLKAPIPRISVREPMQTG
1e0jB           ----------------------------------------PDGVVSALSLRERIEHLSSEESVGLLFSGC
2d0kA           ----------------------------------------------------------------------
3bb1C           -----------------------------------------------------VRGWSGINTFAPATQTK
2b8tB           ----------------------------------------------------------------------
3dm5B           ASSVDEALI---KELVRDIQRALIQADVNVRLVLQLTREIQRRA-LEEKPPAGISKKEHIIKIVYEELTK
3cddD           --------------------------------------------------------------IVLKAGGK
3dm9B           -----------------------------VDALREKIKQKLVGKKRIGTDKGKIIEEAVKEAVSEILE--
3bm2B           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
2d4hA           ---------------------------------------------------------CLIENTNGRLMAN
2awnC           ---------------------------------------------------------------SVQL---
3cddC           ----------------------------------------------------------------------
2akaA           ---------------------------------------------------------RRRNEVAPHIF--
3bb1D           -----------------------------------------------------VRGWSGINTFAPATQTK
1e0jA           -------------------------------------------------------REHLSSSVGLLFSGC
2dr3C           ---------------------------------------------------------------TRRVKTG
3bjdB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2bbsB           ------------------------------------------------------------EVVMENVTAF
3d3kA           -------------------------------------------------SKEFCTD-SGLVVPSISYEL-
1bmfC           VFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDPIGSKARRRVGLKAPIPRISVREPMQTG
2d4hB           ---------------------------------------------------------CLIENTNGRLMAN
1e6cA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2awoC           ---------------------------------------------------------------SVQLQNV
2d3wD           ---------------------------------------------------------LSIKDLHVSVEDK
3bb1G           -----------------------------------------------------VRGWSGINTFAPATQTK
3cbnA           ----------------------------------------------------------------------
3dhwC           ---------------------------------------------------------IKLSNITKVFHQG
1e3aB           EKPGYYLHNGKWVKMLSREETITVKNGQAETFTVWRTVHGNILQTDQTTQTAYAKSRAWDGKEVASLQEW
3bgwD           -----------------------------------------------------------ESADGNITGVP
3adkA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
2b8wB           ---------------------------------------------------------CLIENTNGRLMAN
3ch4B           ----------------------------------------------------------------------
3c8uA           ---------------------------------------------------------------TLAALCQ
2a30D           ----------------------------------------------------------------------
1e9sJ           ---------------------------------------------------------GKLKRMTREKAKQ
1bg0A           -----------------------------QATLDKLEAGFKKLQEAKSLLKKHLTKDV-FDSIKNKKTGM
1d2zD           SKYSRNTELRRVEDND---IYRLAKILDENSCWRKLMSIIPKGMDVQACSGAGCLNFPAEIKKGFKYTAQ
3cioD           ---------------------------------------------------RLQRHRTKNIPFLAVEAVR
2dflA           INKLIEAGYSSLETLAVASPQDLSVAAGIPLSTAQKIIKEARDALDIR--FKTALEVKKERMNVKKISTG
2d2eA           ---------------------------------------------------------LEIRDLWASIDGE
3dffA           ----------------------------------------------------------------------
2c0bL           KGKI-TRIEAAFVD-YGAERHGFLPLKEIAREYFPRPNIKDVLREGQEVIVQIDKEERGNKGAALTTFIS
1e2kA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
2bbtB           ------------------------------------------------------GFGELFEKAKQNNNNT
3cr7D           ----------------------------------------------------------------------
2bkeA           INKLIEAGYSSLET----LAVASPQDLSVAAGIPLSTAQKIIKEARDALDIRFALEVKKERNVKKIS---
1cr0A           ------------------------------------------------------------ESVGLLFSGC
1cr1A           ---------------------------------------------------ERIREHLSEESVGLLFSGC
3cr7A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3bo6B           -----------------------------------------------SATNEDLKTNFSLHNQMRQM---
2dr3F           ----------------------------------------------------------------------
2bnlB           ESTELIWQIDRFFSPINTEIFNQYSI--------------------------------------------
3a00A           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1e9rE           ------------------------------------QGEFGGAPFKRFLRGTRIVSGGKLKRMTREKAKQ
3ecpA           ----------------------------------------------------------------------
2dr3D           ---------------------------------------------------------------TRRVKTG
3bczC           --------------------------------------------------------------------CR
2awoA           -------------------------------------------------------ASVQLQNVTKAWGEV
2d2fA           ---------------------------------------------------------LEIRDLWASIDGE
1ak2A           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
2d3wA           ---------------------------------------------------------LSIKDLHVSVEDK
1e2iA           ----------------------------------------------------------------------
3b9qA           LLFWNLAET---DRVLDELEEALLVSDFGPKITVRIVERLREDIMSGKLKSG--SEIKDALKESVLEMLA
2a30B           ----------------------------------------------------------------------
1e9rG           ---------------------------------------------------------GKLKRMTREKAKQ
3dauA           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
3cmvB           ---------------------------------------------------------DRSMDVETISTGS
1cr2A           ------------------------------------------------------------ESVGLLFSGC
3d31A           ---------------------------------------------------------IEIESLSRKWKNF
2d4uA           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
3cmvE           ------------------------------------------------------------ETISTGSL--
3cd9A           TTLVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRAVKFEGDTLVNRIELKGIDFKED-G
3clvA           ----------------------------------------------------------------------
1e9sB           ---------------------------------------------------------GKLKRMTREKAKQ
2bdtA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
1av6A           --------------------------VVSLDKPFMYFEEID----------NELDYEPESANEVAKKLPY
1bglA           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
3dfdA           --------------------------------------------------SFFPGQTIDAEEVEVPISKR
2dpyB           ---------------------------------------------DGLPAPDITPPFNPLQRTPIEHVL-
3d3qB           ----------------------------------------------------------------------
2bkiA           ---------------------------------NILIAVNPYFDIPKIYSSETIKYQGKSLGTMPPHVFA
3b55A           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2bnlA           KESTEIWQIDRFFSPINTEIFNQYS---------------------------------------------
3d1mA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
3cnlA           RLVNTVVEVRDARAPFATSAYGVDFSRKETIILLNKVDIADEKT------TKKWVEFFKKQGKRVITTHK
2bhvD           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
1e9sL           ---------------------------------------------------------GKLKRMTREKAKQ
6aldA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2bnlC           ELIWQIDRFFSPINTEIFNQ--------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1e9sE           ---------------------------------------------------------GKLKRMTREKAKQ
3dfnD           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1e9rF           ---------------------------------------------------------GKLKRMTREKAKQ
1e2iB           ----------------------------------------------------------------------
1e9rD           ------------------------------------------------------VSGGKLKRMTREKAKQ
2dftA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3cqcA           ------------------------------RLKIDVIDWLVF------DPAQRAEALKQGNAIMRKFLAS
1eamA           -----------------------MDVV-SLDKPFMY--------------FEEIDNELDYPAKKLPYQGQ
1draA           ----------------------------------------------------------------------
1ckvA           -------------------------------------------------------------GIMGLKGKD
2bhjA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
1b0uA           ---------------------------------------------------------LHVIDLHKRYGGH
2dpyA           IIEVESEVVGFNGQRLFLMPLEEVEGILPGARV---YARKQLPLGPALLAPDITPPFNPLQRTPIEHVLD
2awnA           -------------------------------------------------------ASVQLQNVTKAWGEV
2bjbA           -----------------------------------------------------------LQTLGLRVDGV
1e9sI           -------------------------------------------VGQGEFGGAPFKRFLKLKRMTREKAKQ
1e4vA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
2bbtA           ---------------------------------------------------------VVMENVTAFWEEG
1d8jA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
1d6aA           KCRYHIFNDISGTERQD-----------VETTLCPNANSRVSKNINFDSRYPTLEGVKSRSQVQLGIQLD
3bk7A           ----------------------------------------------------------------PRLVKD
3dyoA           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
3brwA           ---------------------------------------------------------LECNPTARIYRKH
1drbA           ----------------------------------------------------------------------
2bv7A           ------------------------------------------------------DKQIETGPFLEAVSHL
2e85A           ----------------------------------------------------------------------
3cnnA           RLVNTVVEVRDARAPFATSAYGVDFS-----RKETIILLNKVDIADEK-TTKKWVEFFKKQGKRVITTHK
3a00B           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
1e9sM           ---------------------------------------------------------GKLKRMTREKAKQ
3dfqC           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
2czvB           --------------------------------------------------------------VKFIEM--
3cmwC           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
2awoD           -------------------------------------------------------ASVQLQNVTKAWGEV
3cueF           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
1e9sH           ---------------------------------------------------------GKLKRMTREKAKQ
2b8tD           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2cbzA           ---------------------------------------------------------ITVRNATFTWARS
1cjtC           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
2bboA           -------------------------------------------------------TEVVMENVTAFWEEG
2d7vA           ------------DSEAFTDNQYSRAHTWEFDGSKILASASPHVVVEANVDPEEAFV-AALSSCHLVF---
1c9kC           ----------------------------------------------------------------------
3do6A           ---------------------------------------------------ELKDDILYPYGHYIAKIDH
2ancD           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
2d7vB           --------------------------WEFDGGSKILASASPHVVVEANVDPEEAFV-AALSSCHLVF---
1dp0A           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3e70C           -----------------------------VDALREKIKQKLVGKKVRGGKIIEEAVKEAVSEILETSRRI
1e9sA           ---------------------------------------------------------GKLKRMTREKAKQ
1e2hA           ----------------------------------------------------------------------
3dmdA           -----------------------------VDALREKIKQKLVGKKVIGTDKGKIIEEAVKEAVSEILE-T
2ancB           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
3b85B           ---------------------------------------------------------------------R
3bjqB           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------RGTRIVSGGKLKRMTREK
2c5mD           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
2c9gA           -----------------------DDRSHWGGDLKTILHTNMPNVNEFMFTNKFKARVMVSRSLTKDKQVE
1e2mA           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
2c9oA           ----------------------------------TKTQRIASHSHVKGLGLDESGAKQAASGLVGQENAR
1e2lB           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
3cr8B           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3cddB           ------------------------------------------------------------EEIVLKAGGK
3c94A           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
2dx7A           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
2c9oB           ------------------------------------TQRIASHSHVKGLGLDESGLAQAASGLVGQENAE
2a78A           ----------------------------------------------------------------------
1dmaB           ----------------------------------------------------------------------
1e9sK           ---------------------------------------------------------GKLKRMTREKAKQ
1dapA           RRIPGVQKAVQYTLPSEDALEKARRGEAGDLTGKQTHKRQCFVVADAADHERIENDIRTMPDYFVGYEVE
3cddE           ----------------------------------------------------------------------
2axnA           ---------------------------------------------------------SRVQKIWVPVDHR
3dvlD           ----------------------------------------------------------------------
2axzA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           PHTQVLQNVSFSLSPGKVTALVGPSGSGKSSCVNILENFYPLEGGRVLLDGKPISAYDHKYLHRVISLVS
3b60A           EVP-ALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREYTLASLRNQVALVS
3b5jA           SP-VILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVL
3dmdC           SRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGAIEQLEEHAKRI
3dm5A           FLGT-EAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWRPGAYHQLRQLLDRY
3eiuA           I---STIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGITNEEAQYMSDFE
3dt2A           LEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDAQGNLRAINPENG
2c03B           KEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPAAREQLRLLGEKV
3dtbB           AEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDAQGNLRAINPENG
1dkiA           YNLLTPVIEKVKPGEQSFVGQHAATGSVATATAQIMKYHNYPNKGLKDYTYTLSSNNPYFNHPKNL----
3dmdB           SRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGAIEQLEEHAKRI
2akaB           Q--DAFSAIGQNADDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNSTTEYAEFLH
1accA           DTGSNWSEVLPQIQETTARIIVNPSTTKPDMTLKIAFGFNE-PNGNLQYQGKDIT---------------
2d3wB           A---ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLAEDRAGEGIFMAF
2c61B           I---STIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGITNEEAQYMSDFE
1e69A           ---KSFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPPAGSAYVELVFEENG
2dwoA           ----PSLPRSCGPNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVKQYSSYNFFR
3cmvH           L-SLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYA-RKLGVDID
2c03A           L---GGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPAAREQLRLLGEKV
1e9cA           --------------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKK
3dt4C           AEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDAQGNLRAINPENG
3bb1A           LL-ELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRSRAGFTLNIID
3dt7A           LEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDAQGNLRAINPENG
4dcgA           GQLKLLLGELFFLSKILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLV
3dt4A           LEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDAQGNLRAINPENG
3b2qA           QTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGITNEEAQYFMSDF
3cmvG           DIA----LGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIY--ARKLGVDI
2dwpA           ---SRVQKIWVPVDHRTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVKQYSSYNFFR
2c04A           L---GGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPAAREQLRLLGEKV
2b8tA           ---------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDTRSIRNIQSRTGTSL
2c61A           QTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGITNEEAQYFMSDF
2cjwB           ----------FGMTYYRV-VLIGEQGVGKSTLANIFAGVEDTYERTLMVDGESATIILLDMWENHDHMQV
3eiuB           I---STIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGITNEEAQYMSDFE
2ccjB           ----------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGND
3c95A           DLAGDISPLLELDSDTLRAVPVKLVHINKCPVLAQANTLRPEDADRLGINRQHCLDNENPQVREKVVAIF
2ccgA           ----------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIR-KIVLEGN
1d1cA           AISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQAGVLEQQILQANPILEAFGNAK
2ccgB           ---------------SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGND
1e98A           --------------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKK
1e9fA           --------------RGALIVLEGVDGAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIG--KLLSSYLQ
3cmvA           D----IALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYA-RKLGVDID
3cmvC           SLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYA-RKLGVDID
2ahvA           VLS--AQEAVNYIPDEATLCVLGAILEATTLITALADKYKQTQTLGDRADRGISPLAQEGLVKWALCGHW
3cddF           TITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDVGEPFQRIPHELLARLAK
1e2dA           --------------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKK
2bbsA           KGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQNSWIMPGTIKEN
1bifA           ---------------PTLIVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQYRRDMVKTYKSFEFFL
3czpB           ARLAGLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAPTEEERAQPYLWRFWRHI
2b8wA           --PEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIWMWCPKKPGHILVL
3b2qB           I---STIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGITNEEAQYFMSDF
3ec1A           IGMAKVMEAINRYREGGDVYVVGCTNVGKSTFINRIIEEATGKGNVITTSYFPGTTLDMIEIPLESGATL
2c9yA           ---------------GIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMD
2dr3A           --PGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQVRQNMAQFGWDV
2c9oC           ACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFR
2czvA           --GGGVKFIEMDIRDKEAYELAKEWFDEVVVSIKFNEEVDKEKLREARKEYGKVAILLSNPKPSLVRDTV
1e9dA           --------------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLL-------
2bifA           ---------------PTLIVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQYRRDMVKTYKSFEFFL
2bofX           --------------------------------------YVNPNMSSAEWVRNNPNDPRTPVIRDRIASVP
2ahwD           VLS--AQEAVNYIPDEATLCVLGAILEATTLITALADKYKQTQTPRNLSDRGISPLAQEGLVKWALCGHW
2a5gA           -------------------LMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGL
3da4A           ------FAKPAPSQYDYRSMNMKQMSGNVTTPIVALAHYLWGNGAERSVNIANIGLKISPMKINVVGTFP
2dr3E           IPG-VDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQVRQNMAQFGWDV
3bb1B           LL-ELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSGPRPVMVSRSRAGFTLNIIDT
2awnB           V---VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQS
2axzC           ---------------------------------------------------------------------S
3d7wA           -NIPLLRQSTVPVSEGQRFVLVELTNAGGDTITAAIDVTNLYVVAYEAGNQSYFLSDAPAGAETQDFSGT
3di4A           VLVPPREGRCFEVKAGQFFRISSVEG-----PQVGDLNLHNLHDLTERFFSGKTRALHGTHVTTGERLWS
2cgtH           DGVSVAREIELDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDSKAIAQV
1e9sG           V---TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNP
3a1wA           -------------------ALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVFTYKGYTINLIDL
3bgwA           SGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEM--GKKENIKRLIVTAG
1e1qB           TGI-KAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQL
1dg3A           PE--ALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKHTKGIWMWCVPHPKKPGHILVLLDTEGLGD
1e9sF           V---TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNP
3b85A           PKTLGQKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIILTRPAVEAGEKLGFLPGDPYL
2awnD           V---VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVEPS
3bb1E           LL-ELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRSRAGFTLNIID
3ed8A           -DGNILGHKLEYNFNSHNVYITATRGTQKNGIKANFTVRHNVEDGSVQLADHYQQNT---PIGDGPVLLP
2c4rL           NPRAGGISRRIELKEALASLELPEGMGLIVRTAGVGKSAEALQWDLSFRLKHWEAIKKAAESRPAPFLIH
3bb1H           LL-ELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRSRAGFTLNIID
3bh0A           T---ELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGKKENIKRLIVTAGSI
1cr4A           T---GINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNR
1e4yA           -------------------ILLGALVAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMD
2axpA           -----------------LIILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSGNEKLFEHFDEDNVI
2cckA           ----------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKI------
2d62A           T---AVKDLSLEIKDGEFLVLLGPSGCGKTTTLRIAGLEEPTRGQIYIEDNLVAEKGVFVPPKERDVAVF
1e3mB           ---QLYEELFDLLLPHLEALQQSASALAELDVVNLAERAYTLNYTCPTFIDKPGIRIT-EGRHPVVEQVL
2ctsA           --KDILADLIPKEQAKTFRQQHGNTAVGQITVDMMYGGMRGMKGLVYETSVLDPDEGFRGYSIPECQKML
2b92B           --PEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKMWCVPHPKKPGHILVL
1e2fA           --------------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQ--
1e3mA           -EKQLYEELFDLLLPHSASALAELDLVNLAERAYTLNYTCPTFIDKPGIRITEGRH-PVVEQVLNEPFIA
2bkhA           -IADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEANPLLEAFGNA---
3cr7C           --------------RGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGF--SE
2eg5G           CVRELLRANLPNINKCIKVADLGCASGPNTLLTQSIDKVGQLERPTIQIFLNDLFPNDFNSFKLLPSFYR
3bb1F           LL-ELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRSRAGFTLNIID
2a2zD           ---------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLPERWSFTF
2a2zA           ---------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMY----
1aroP           ----------------------------------------------------------------------
1e9rA           V---TVAGVPMPRDAERHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNP
2bc9A           --PEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIWMWCVPHPKKPGHI
3czpA           ARLAGLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAPTEEERAQPYLWRFWRHI
1e9sD           V---TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNP
2dr3B           IPG-VDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQVRQNMA------
421pA           -------------------VVVGARGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILD
2d3wC           A---ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLALSPEDRAGEGIF
3bpbA           LTSSHLGKPDYAKALEQHNAYIRALQVDITLLPPDEDSVFVEDPVLCTSRCAIITRPGAESRRGETEIIE
2ck3C           I---KAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQL
1e0jB           T---GINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEE-TAEDLIGLHN
2d0kA           ----------------------------------------------------------------------
3bb1C           LL-ELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRSRAGFTLNIID
2b8tB           ---------------GWIEFITGPMFAGKTAELIRLHRLEYADVKYLVFKPKILPSVEVESAPEILNYIM
3dm5B           FL-GTEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWRPGAYHQLRQLLDRY
3cddD           IYQGW---TKIGI-----TRSLEASGAFDL----ETYKFNDAQYKAFIEPIKQGQA-CTVDIGGERVITG
3dm9B           TSRRIDLIEEIRKAEKPYVIFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDT---------FRAGAIE
3bm2B           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
2d4hA           PE--ALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQKGIWMWCVPHPKKPGHILVL
2awnC           QNVTVSKDINLDIHEGEFVVFVGPSGCGKSTL------------------------LRMIAGLGVGMVFQ
3cddC           -------------------KAGGKIYQGWTKIGITRSLEASGAFYKAFIEPIKQGQACTVDIGGERVITG
2akaA           AISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQANGSGVLEQQILQANPILEAFG
3bb1D           L-LELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRSRAGFTLNIID
1e0jA           T---GINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETA-EDLIGLHN
2dr3C           IPG-VDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQVRQNMAQFGWDV
3bjdB           --------------------------------------LQNLPIEEARIVADALAV--HATSRQIDSAAS
2aumA           --------------------------------------------------------------------SS
2bbsB           W---VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQNSWIMPGTIKEN
3d3kA           HKKLLSVAEKHGLTLERRLEMTGVCASQMALTLLGGPQRPTLLCGPHVKGAQGISCGRHLHDVQVILFLP
1bmfC           I---KAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQL
2d4hB           PEAKILSAITQ---PMVVVAIVGLYRTGKSYLMNWMWCVPHPKKPGHILVLLDTEGLGWIFALAVLLSST
1e6cA           ----------------EPIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHTSGMTVADVVAAFRRRE
1dvrA           -------------SESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMD
2awoC           T---VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVALY
2d3wD           A---ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLALSPEDRAGEGIF
3bb1G           LL-ELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRSRAGFTLNIID
3cbnA           -------------------------------------------RYTLRARGHPNV----TAGHRTTFEVT
3dhwC           TRIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSESELTKARRQIG
1e3aB           TQQAAKQALTINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKWDWKGLLPFEMNPKVYNPQSGY
3bgwD           SGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGKKENIKRLIVT----
3adkA           ---------EEKLKKSKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSARGKMLSEIME
2ausC           ----------------------------------------------------------------------
1e2gA           --------------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSY--LQ
2a30A           ---------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYEKPE
2a5jA           -------------------IIIGDTGVGKSCLLLQFTDKRFQPIGVEFGARMVNIDGKQIKLQIWDTAGQ
2b8wB           --PEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIWMWCVPHPKKPGHI
3ch4B           -------MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQYKE
3c8uA           G---VLERLDPRQPGRQLVALSGAPGSGKSTLSNPLAAALSAQGLPAEVVPDGF--HLDNRLLEPRGLLP
2a30D           ---------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYEKPE
1e9sJ           V---TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDI--IL
1bg0A           GATLLDVIQSGVENLDSGVGIYAPDAESYRTFGPLFDPIIDDYHGGFKLTDKHPPKQWGDINTLVGLDPA
1d2zD           DV-FQIDEAANRLPPMIDEWKTSGKLNERPTVGVLLQLLVQASAADFVALDFLNES---------TPARP
3cioD           ALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYSHNLFTVSNEHG
2dflA           SQA-LDGLLAGGIETRTMTEFFGEFGSGKTQLCHQLSVNVQLPPEKGGLSGKAVYIDTEG----------
2d2eA           T---ILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLDGENILELSPDERARKGLF
3dffA           -----------------------------------------------------------------VLVYT
2c0bL           LAGSYLVLMPNNPRAGGISRRIELKEALASLELPLIVRTAGVGQWDLSFRLKHWEAIKKAAESRPAPFLI
1e2kA           ------------MPTLLRVYIDGPHGMGKTTTTQLLVADDIVYVPEPMTYWRVLGASETIANIYTTQHRL
2bx2L           ---------------------------------------------------------KKAAESRPAPFLI
1ai4B           ------QALTINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKWDWKGLLPFEVYNPQSGYIANW
2bbtB           P---VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQNSWIMPGTIKEN
3cr7D           --------------RGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKD--LGFSE
2bkeA           TGSQALDGLLAGGIETRTTEFFGEFGSGKTQLCHQLSVNVQLPPEKGGLSGKAVYIDTEGTFRWERIENA
1cr0A           T---GINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNR
1cr1A           T---GINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLE-ESVEETAEDLIGLHN
3cr7A           ---------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGF--SE
1afrA           PPREVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPASDGFDEQVRDETGASPT
2b8tC           ---------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDSRTGTSLPSVEVEAP
3bo6B           PMSHFREALDAPDYSGMRQSGFFAMSQGFQLESHGGDVFMHAHRENPQCKGDFAGDKFHISVQREQVPQA
2dr3F           --PGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQVRQNMAQFGWD-
2bnlB           ----------------------------------------------------------------------
3a00A           ----------------RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVN-GKDYNFVS
3d3qA           ---------------PFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQGDIGTAKVTTEEEGIPH
1d6jA           -ALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDL------
1e9rE           V---TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNP
3ecpA           -----------------------------------------------------------------AKSVF
2dr3D           IPG-VDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQVRQNMAQFGWDV
3bczC           E---ASHAGSWY-----TASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSI
2awoA           V---VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQS
2d2fA           T---ILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLDGENILELSPDERARKGLF
1ak2A           ---------------GVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASGSELGKKLKATMD
3cmxA           ----------GGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHA--LDPIYARKLGVDI
2cckB           ----------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIVLEGDMDIR
5dfrA           ----------------------------------------------------------------------
2d3wA           A---ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTKDLLALSPEDRAGEGIFMAFQYPVE
1e2iA           ------------MPTLLRVYIDGPHGMGKTDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEVVMT
3b9qA           K---SKTELQLGFRKPAVIMIVGVNGGGKTTSLGKLAHRLK----------NEGTKVLMAAGDTFRAAAS
2a30B           ---------------IKKISIEGNIAAGKSTFVNILKWEVVPEPVARWCNVQSTNVLQMMYEKPERWSFT
1e9rG           V---TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNP
3dauA           ----------------------------------------------------------------------
1d6jB           -ALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRAYRLDGDNIRFGLNKDLGF----SE
1dhiA           ----------------------------------------------------------------------
3cmvB           LSLD-IALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEH--ALDPIYARKLGVDI
1cr2A           T---GINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDL------
3d31A           ----SLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGKDV--TDLSPEKHDIAFVY
2d4uA           --------------------PLGSGGLFFNALKNCKENFTVLQTIRQQQSTLNGSQTRNTLNRAGIRYMM
3dfnC           ----------------------------------------------------------------------
3cmvE           ----SLDIALGAGGMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDN
3cd9A           NILGHKLEYNYNCESNVYIMADKQKNGIKANFKTRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLST
3clvA           -----------EKKSSYKTVLLGESSVGKSSIVLRLTKDTFHENTNTTIGASFCTNYNENLIKFDIWDTA
1e9sB           V---TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNP
2bdtA           ----------------KLYIITGPAGVGKSTTCKRLAAQLDNSAYIEGDIINHVVGGYRPPWESITDLTV
2a1fF           ----------------------------------------------------------------------
1av6A           QQLKLLLGELFFLSKILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLV
1bglA           ----------------------------------------------------------------------
1e59A           ----------VLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLNVLDEL
3dfdA           FVDKEGNVVPFIFKATDRIDELEKENTTKELDSQRFYARIA-------VETTVYPTFKAKELREAYKTED
2dpyB           DTGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGERGREVKDFIENILGPDGR
3d3qB           ---------------PFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQGDIGTAKVTTEEEGIPH
2bkiA           IA-DKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEANPLLEAFGNAKTV
3b55A           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2aunA           --------------------------------------------------------------------SS
1dekA           ----------------KLIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALAYAWGVFAANTDYPL
3cr7B           ---------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEAD
2aunB           ---------------------------------------------------------------------S
1e2hB           ------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGTTQHRLDQGEI
3c85A           --------------------------------------LINPGHAQVLILGGRIGTGAYDELRARYGKIS
3dfqA           ----------------------------------------------------------------------
2bnlA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
2cvfA           -TKSLDSLLGGGFAPGVLTQVYGPYASGKTTLALQTGLLSGKKVAYVDTEGGFSP--ERLVQMAETRGLN
3dfoD           ----------------------------------------------------------------------
2a2zB           ---------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYEKPE
3dftD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1ek0A           -------------------VLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTVKFEIW
3cnlA           GEPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAKGIQWFSLENGVKILDGILYKNIFSEDLA
2bhvD           --------------------------------------------------LRTITADKMIPAFLITPISS
2bhvA           -----------------------------------------------------ITADKMIPAFLITPISS
2c7cH           ----VAREIELEDKFENMGAMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGI--
1e9sL           V---TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNP
6aldA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
3dlbB           -----------WVEGLAVYRREHARGPGWRVLGGAVLDL-----------WVSDSGAFLLEVDPAYRILC
1cjaA           ----------------------------TTSAPEVLTKSTMQQLGSLMALDVIVNNSDRLPIAWLDNIML
1culC           ---------------THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKEAIETIVAAMSNLV
1aldA           ----------------------------------------------------------------------
2bnlC           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2aumB           ---------------------------------------------------------------------S
2bwjA           --------FMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTLLREELASESERS---KLIRDIM
1e9sE           ---VTVAGVPMPRDAERHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNP
3dfnD           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1e9rF           V---TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNP
1e2iB           ------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPE--PMTYWRVLGASETIANIY
1e9rD           V---TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNP
2dftA           ----------------PKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDRRIE
3dfqD           ----------------------------------------------------------------------
3cqcA           KKHEAAKEVFVKIPQDSIAEIYLPAEDDNAIREHLCIRAYLEAHETFNEWFKHMNSVPQKPALIPQPTFT
1eamA           --LKLLLGELFFLSGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLV
1draA           ----------------------------------------------------------------------
1ckvA           FADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPWIKANGKIEVDCDEISELLGRQF
2bhjA           ---------------------------------------KNWGSGEILHDTLHHKATSCLSLTRGPRDKP
3cmtD           ---------AGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPI-YARKLGVDID
1b0uA           E---VLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNINLVRDKDGQLKVADKN
2dpyA           TGVRAI-NALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGERGREVKDFIENILGPDGR
2awnA           V---VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQS
2bjbA           GSELTVSGRIEPGPGARV--DCGLAGTV----LRFVPPLAALGSVPVTFDGDQARGRPIAPLLDALRELG
1e9sI           V---TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNP
1e4vA           -------------------ILLGAPVAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMD
2a1fD           ----------------------------------------------------------------------
1akeA           -------------------ILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMD
2b0lC           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
1cs4C           ---------------THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKEAIETIVAAMSNLV
1dyhA           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
2ancF           -------------AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQVLATGVDVFLDIDWQGAQQ
3be4A           ------------NSKKHNLILIGAPGSGKGTQCEFIKKEYGLAHLSTGDMLREAIKNGIGLEAKSIIESG
2bbtA           KGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQNSWIMPGTIKEN
1d8jA           ----------------------------------------------------------------------
2dftC           ----------------PKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQE
1d6aA           SNIGKISGVMSFTEKTEAEFLLVAIQMVSEAARFKYIENQV-KTNFNRAFNPNPKVLN---LQETWGKIS
3bk7A           YGSFKLEVEPGEIRKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKVEWDLTVAYKPQYIKAE-------
3dyoA           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
3brwA           FLGKEHFNYSLDTALGHLVFSLKYDVIGDQEHL-----------------------RLLLRTKCRTYHDV
1drbA           ----------------------------------------------------------------------
2bv7A           PFFDCLGSPVFTPIKAKIKAVYDTNPTKFRTLQNILEVEKEMYGAEWPKVGATLALMWLKRGLR------
2e85A           ----------------------------------------------------------------------
3cnnA           GEPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAGIQWFSLENGVKILDTPGILYKNIFSEDL
3a00B           ----------------RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVN-GKDYNFVS
2anbA           -------------AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVN
1e9sM           V---TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNP
3dfqC           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
4atjA           ----------------------------DNSCPNVSNIVRDTIVNELRSDPRIAASILRLHFEDCSILLD
2e85B           ----------------------------------------------------------------------
2czvB           -DIRDKEAYELAKEWFEVVVSIKFNEEVDKEKLREARKEYGKVAILLSNPKPSLVRDTVQKFKSYLIYVE
3cmwC           -------LGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHA--LDPIYARKLGVDI
1ckeA           -------------AIAPVITIDGPSGAGKGTLCKAMAEALQWH---------LLDSGA---IYRVLALVA
3crmA           -------------SLPPAIFLMGPTAAGKTDLAMALADALPCELISVDSALIYRGMDIGTAKPSRELLAR
2awoD           V---VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNRGVGMVEPSVFLLDE
3cueF           --------------YLFKLLLIGNSGVGKSCLLLRFSDDYISTIGVDFKIKTVELDGKTVKLQIWDT-AG
2a1fE           ----------------------------------------------------------------------
1cfrA           -------------------DIISKSGEGNKYTINFSKVLSGLRDEAIRLGGKISDGSFNKCNGDWY----
2ccjA           ----------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGND
1dekB           ----------------KLIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGP-----------IKDALAYAW
1e9sH           V---TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNP
2b8tD           ---------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVKPKSIRNIQSRTGTSLPSVEV
3cm0A           ---------------GQAVIFLGPPGAGKGTQASRLAQELGFKKLSTGDILRDHVARGTPL-GERVRPIM
1e2lA           ------------MPTLLRVYIDGPHGMGKTTTTQLLDIVYVPEPMTYWRVLGASETIANIFQHRLDQGEI
2boeX           ----------------------------------------------------------------------
2cbzA           DPP-TLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMD-----------KVEGHVAIKGSVAYVPQQ
1cjtC           ---------------THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKEAIETIVSNLVPPV
1e2jA           ------------MPTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMVLGASETIANIYTTQHRLDQGEI
2bboA           LGTPVLKDINFKIERGQLLAVAGSTGAGK-TSLLMMIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKE
2d7vA           LSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTLQQLEKHHLAHENCFIANSV
1c9kC           -----------------MILVTGGARSGKSRHAEALIGDAPQVLYIATSQILHHKDGRPAHWRTARHLDT
3do6A           R---FLKSLENHEDGKLTAVTPTPAGEGKTTTSIGLSSLNRIGKKSIVTLREPS----------------
2ancD           ---------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEH-----
1e2mB           ------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVLGASETIANIYTTQHRLDQGEI
2d7vB           LSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTLQQLEKHH---LAHENCFIA
1dp0A           ----------------------------------------------------------------------
1e2nA           ------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPE--PMTYWRVLGASETIANIY
3c15C           --------------ATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLKEAIETIVAAMSNL
2an9A           -------------AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVN
2a1fC           ----------------------------------------------------------------------
2d4uB           -----------------------------------------------------------------IRYMM
1e2nB           ------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEASETIANIYTTQHRLDQGEI
1bccF           ---------------------------------------------------------------YYNAAGF
1e2kB           ------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPE--PMTYWRVLGASETIANIY
3cmuA           -----LDIALGALPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPI--YARKLGVDI
3bwdD           ---------------FIKCVTVGDGAVGKTCLLISYTSNTFPFSANVVLGLWDTAGEDYNRLRPLSYRGA
3e70C           ----DLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGAIEQLEEHAKRI
1e9sA           ---VTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNP
1e2hA           ------------MPTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLD
3dmdA           SRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTT--------------------------------------
2ancB           -------------AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVN
1chdA           ----------------------------------------------------------------------
3b85B           PKTLGQKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIILTRPAVEAGEKLGFLPDPYLR
3bjqB           ----------------------------------------------------------------------
3cphA           -------------------LLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLW
2b0lB           ----------------------------------------------------------------------
3c14C           ---------------THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLKEAI--ETIVAAMS
1e9rB           AKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNP
2c5mD           ----------------------------------------------------------------------
2ax4A           --------------RGCTVWLTGLSGAGKTTISFALEELVSHAIPCYSLDGDNVRHGLNRNLGENIRRIA
1cjvC           ---------------THRLLLLGAGESGKSTIVKQMRILHVEKATKVQDIKNNL----KEAIETIVAAMS
2cdnA           ---------------HMRVLLLGPPGAGKGTQAVKLAEKLGIPQIST-GELFRRNIEEGTKLGVEAKRYL
2bhvC           -----------------------------------------------------------------TPISS
1azsC           --------------ATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLKEAIETIVAA--MS
2c95B           ------------LKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHGDLLRSEV----SSGSARGKKLSEIM
2ax4B           --------------RGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLNRNLGFSPGDREENIRRIAE
2c9gA           L---KYEWVEFTLPEGNYSETMTIDLMNNAIVEHYLKVGRQ-----------------------------
1e2mA           ------------MPTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMVLGASETIANIYTTQHRLDQGEI
3e8aC           ---------------THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKN--NLKEAIETIVAAMS
1cjuC           ---------------THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLKEA--IETIVAAMS
1delA           ----------------KLIFLSGVKRSGKDTTADFIMSNY---SAVKYQLAGPIK----DALAYAWGVFA
2c9oA           EACGIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFR
1e2lB           ------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVY--VPEPMTYWRVLGASETIANIF
2aexA           ----------------------------------------------------------------------
3c7kA           -------------------LLLGAGESGKSTIVKQMKIIFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTL
3cbqA           -------------------MLVGESGVGKSTLAGTFGGLQGDSAHEPENPEDTYERRIMVDKEEVTLVVY
2bwjB           ---------MEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLST-----------------------
2a5vA           -------EYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYVRDVVER--------VAPSVLLGR
3bs4A           --------------HSLILIHEEDASSRGKDLFYILSRKLK-SDNLVGMFSISYPLQLIIRILSRFGVDV
2bwjD           ------------LRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLST-----------------------
3cr8B           ----------------------------------------------------------------------
2bwjF           ------------LRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLST-----------------------
3cddB           IYQGWT--------KIGITRSLEASGAFDLETYKFLGNDAQYKAFIEPIKQGQACTVDIGGERVITGYVD
3c94A           ----------------------------------------------------------------------
2a5vB           -------EYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYVRDVVER--------VAPSVLLGR
1delB           ----------------KLIFLSGVKRSGKDTTADFIMSNY---SAVKYQLAGPIKDALAYAWGVFAANTD
1e2jB           ------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEP-------------------
2dx7A           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
2bwjC           ------------LRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLST-----------------------
3dkvA           -------------------VLMGLPGAGKGTQAERIVEKYG--IPHISTGDMFRAMKEETPLGLEAKSYI
2bwjE           ------------LRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLST-----------------------
2c9oB           ACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELG-----------------------------
2a78A           -------------------IMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILD
1dmaB           ----------------------------------------------------------------------
1e9sK           ---VTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDI----
1dapA           IDEATFDSEHTGMPHGGHVITTGDTGGFNHTILKLDRN--------------------------------
3cddE           -HSEEIVLKAGGKIYQGWTKIGITRSLEASGAFDLEFLGNDAQYKAFIEPIKQGQACTVDIGGERV-ITG
2axnA           ----PSLPRSCGPNSPTVIVMVGLPARGKTYI--------------------------------------
3dvlD           ------------LPIGRSTLVSGTSGTGKTLSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDL
2axzA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           QEPVLFARSITDNISYGLPTVPFEMVVEAAQKANAHGFIMELQDGYSTETGEKGAQLSGGQKQRVAMARA
3b60A           QNVHLFNDTVANNIAYARTEESREQIEEAARMAYAMDFINKMDNGLDTIIGENGVLLSGGQRQRIAIARA
3b5jA           QDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARA
3dmdC           GVKVIKHSYGADPAAV---------------------AYDAIQHAKARGIDVVLIDTAGRSETNRNLMDE
3dm5A           HIEVFGNPQEKDA--------------IKLAKEGVDYFKSKGVDIIIVDTAGRHKEDKALIEEMKQISNV
3eiuA           KTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAYEHGMHVTDLATLYERAGIVKGAKGSVTQIPIL
3dt2A           FFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPL--APGVTITSWKNKEWRPQDEEPC
2c03B           GVPVLEVMDGES---------------------PESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGE
3dtbB           FFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPL--APGVTITSWKNKEWRPQDEEPC
1dkiA           -----FAAISTRQYNWNNILPTYSGRESNVQKMAISELMADVGISVDMDYGPSSGSAGSSRVQRALKENF
3dmdB           GVKVIK--------------HSYGADPAAVAYDAIQHAKARGIDVV-------LIDTAGRSETNRNLMDE
2akaB           CKGKKFTDFEEETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQ
1accA           EFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRDKRFH--------YDRNNIAVGADES
2d3wB           QYPVEIPGVSQFFLQTALNAVRSETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQM
2c61B           KTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAYYPGYMYTDLATLYERAGIVKGAKGSVTQIPIL
1e69A           EEITVARELKRTGENTYYLNGSPVRLKDIRDRFAGTGGRLEISIRKPGRRDQKLSLLSGGEKALVGLALL
2dwoA           PDNEEAMKVRKQCA--------------------LAALRDVKSYLAKEGGQIAVFDATNTTRERRHMILH
3cmvH           NLLCSQPDTGEQALEICDALAR-SGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLARMMSQAMRKLAGNL
2c03A           GVPVLEVMDGES---------------------PESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGE
1e9cA           SDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYT-------GAKENFSLDWCKQPDVG
3dt4C           FFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPL--APGVTITSWKNKEWRPQDEEPC
3bb1A           TPGLIEGGYINDMALNIIKSFLLKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHA
3dt7A           FFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPL--APGVTITSWKNKEWRPQDEEPC
4dcgA           TLRSIKKQLHPSKIILISDVRSPSTADLLSISILNPVASSLKWRCPFPAQWIKDFYIPHGNKMLQPFAPS
3dt4A           FFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWE--GIDEPLAPGVTITSWKNKEWRPQDEEPC
3b2qA           EKTGALER---AVVFLNLADDPAVERIVTPRMALTAAEYLAYEHGMHVLVILTDITNYAEALRQMGAAR-
3cmvG           DNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLARMMSQAMRKLAGNL
2dwpA           PDNEEAMKVRKQCA--------------------LAALRDVKSYLAKEGGQIAVFDATNTTRERRHMILH
2c04A           GVPVLEVMDGESPESI---------------------RRRVEEKARLEARDLILVDTAGRLQIDEPLMGE
2b8tA           PSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEFVVIISGLDKNFKGEPFGPIAKLFTYADK
2c61A           EKTGALERAVVFLNLAD---DPAVERIVTPRMALTAAEYLAYEHGMHVLVILTDITNYAEALRQMGAARN
2cjwB           GDAYLIVYSITDRASFE----KASELRIQLRRARQTEDIPIILVGNKSDLVRREVSVSEGRAAVVFDCKF
3eiuB           KTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAYEHGYMYTDLATLYERAGIVKGAKGSVTQIPIL
2ccjB           MDIRTEAMLFAASRREHL-----VLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAIN
3c95A           AESDNVDAQLYNGFFSDADRAAMKIVLETEPRNLPALDITFVDKLFNYRARNFPGTLDYAEQQRWLEHRR
2ccgA           DMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSS-----------LAYQGYARGIGVEEVRA
1d1cA           TTRNNNSSRFGKFIEIQFN--NAGFISGASIQSYLLEKSRVVFQSETERNYHIFYQLLAGATAEEKKALH
2ccgB           MDIRTE------------AMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRA
1e98A           SDVE-------DHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVG
1e9fA           KKSDVEDHSVHLLFSANRW-----EQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVG
3cmvA           NLLCSQPDTGEQALEIC---------DALARSGAVDVIVVDSVAALTPKAEIGLAARMMSQAMRKLAGNL
3cmvC           NLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAA------LTPKAEIEGLAARMMSQAMRKLAGNLKQ
2ahvA           GQSPRISDLAEQNKIIAYN-YPQGVLTQTLRAAAAHQPGIISDIGIGTFVDPRQQGGKLNEVTKEDLIKL
3cddF           QRGVLLTSDTFGNLVITRASKTKAGVSLILGDNVKAARGRFSWRQR----FSKFTIKAAGIKADVTDSEI
1e2dA           SDVEDHSVHLLFSA-------NRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVG
2bbsA           IIGVSYDEYRYRSV---------------IKACQLEEDISKFAEKDN----IVLITLSGGQRARISLARA
1bifA           PDNEEGLKIRKQCA--------------------LAALNDVRKFLSEEGGHVAVFDATNTTRERRAMIFN
3czpB           PARFTIFDRSWYGRVLVERIEGFCAPADWLRAYGEINDFEEQLSEYGIIVVKFWLAIDKQTQERF-KERE
2b8wA           LDTEGLGDVEKGDNQNDSWIFTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSVSFFPDFVWTLRDFSLD
3b2qB           EKTGALERVVFLNLADDPAVERIVTPRMALTAAEYLAYEHGYMYTDLATLYERAGIVKGAKGSVTQIPIL
3ec1A           YDTPGIINHHQMAH---FVDARDLKIITPKREIHPRVYQLNEGQTLFFGGLARLDYIKGGRRSFVCYMAN
2c9yA           AGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRI
2dr3A           KPYEEKGM-------------------------FAMVDAFTAGIGKEYEKYIVHDLTDIREFIEVLRQAI
2c9oC           RAIGLRIKETKKKEIIQ-DVTLHDLDVAGEINKVVNKYIDQGIAELVPGVLFVDEVHMLDIECFTYLHRA
2czvA           QKIRYSIEKGVDAIISPWVNRKDPGIDHVLAKLMVKKNVALGFSLRPLLYSNPYERANLLRFMMKAWKLV
1e9dA           SSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKENFSLDWCKQPDVG
2bifA           PDNEEGLKIRKQCAL--------------------AALNDVRKFLSEEGGHVAVFDATNTTRERRAMIFN
2bofX           QGTWF------AHHNPGQITGQVDALMSAAQAAGKIPILV----VSNAPGRDCGAPSHSAYRSWIDEFAA
2ahwD           GQSPRISDLAEQNKIIAYNY-PQGVLTQTLRAAAAHQPGIISDIGIGTFVDPRQQGGKLNEVTKEDLIKL
2a5gA           DKIRPLWRHYYTGTQGLIFCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLG
3da4A           VSTKFTHATGDYNVITGATLKTEGTLTISANGSWTYNGVSTHRGIIGESLTRLGAMFSGKEYQILLPGEI
2dr3E           KPYEEKGMFAMVDAFTAGIGKEYEKYIVHDLT-------------------------DIREFIEVLRQAI
3bb1B           PGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHA
2awnB           YALYPHLSVAENMSFG------LKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRT
2axzC           IYLGYISIAHHYNIEVPTFNKTITSD-LKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPYPIVDS
3d7wA           TSSSQPFNGSYPDLER-----------YAGHRDQIPLGIDQL--------IQSVTALRFPGGQTKTQAR-
3di4A           NLPYLRPATIIEDTLGWYGIDQYGGSVHDVIGTRCDPYTGNLLAGNLTRALADHTGLPLHEAELVHDVLN
2cgtH           GTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGM----QFDRGYLSPYFINKPETGAV
1e9sG           YDQRTKGWSFFNEIRND--YDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKIGTPSMRELFHWTTIA
3a1wA           PGTYSLGYSSIDEKIARDY-LLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTAIDEAKKIDR
3bgwA           SINAQKIKAARRDFASE-------------DWGKLSMAIGEISNSNINIFDKAGQSVNYIWSKTRQTKRK
1e1qB           VKRLDADAMKYTIVVSATASDAAPLQYLAPYSGCSYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLH
1dg3A           VEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSDSDFVSFFPDFVWTLRD
1e9sF           YDQRTKGWSFFNEIRNDYD------------------WQRYALS-------VVPRGKTDEAEEWASYGRL
3b85A           RPLHDALRDVEPEVIPKLEVAPLAYRGRTLNDAFVILDEAQNTTPAQKFLTRLGFGSKVVTGDGLRLVRH
2awnD           VFLLDEPLSNLDAALRVQMRIEISR---LHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLE
3bb1E           TPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHA
3ed8A           DNHYLSYQTVLSKDPNEKRD--HMVLLEFVTAAG------------------------------------
2c4rL           QESNVIVRAFRDYLRQDIG-EILIDNPKVLELARQHIAALGR-PDFSSKIKLYTGEIPLFSHYQIESQIE
3bb1H           TPGLIEGGYINDMALNIIKSFLLDKTIDVLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHA
3bh0A           NA---------QKIKAARRDFASEDWGKLSMAIGEISNSNINIFDKAGQSVNYIWSKTRQTKRKNPGKRV
1cr4A           VRLRQ----------------SDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMR
1e4yA           AGKLVTDELVIA-------------------------LVKERIAQEDCRNGFLLDGFPRTIPQADAMKEA
2axpA           IDRFVYSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYLHADPSVIRVRGDEYIEGKDIDSILELYR
2cckA           ------------VLEDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVE
2d62A           QSYALYPHTVYDNIAFPLKLRKVPK------QEIDKRVREVAELGLTELLNRKPRELSGGQRQRVALGRA
1e3mB           NEPFIANLSPQRRLIITGPNGGKSTYRQTALIALAYIGSYVPAQKVEIGPIDRIFTRVGTFVETETANIL
2ctsA           PKAKGGEEPLPEGLFWLLVTGQIPTEEQVSWLSKEWAKRAALPSHVVTMLDNFPTNLHPMSQLSAAITAL
2b92B           LDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYHRIRSKSSFVSFFPDFVWTLRD
1e2fA           -----KKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVG
1e3mA           NPLNLSPQRRLIITGPNGGKSTYRQTALIALAY----IGSYVPAQKVEIGPIDRIFTRVGFVETETANIL
2bkhA           KTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGASEDIRERLHL
3cr7C           ADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTGLPFGLYKKAREGVIKEFTGISAP
2eg5G           KLEKENGRKIGSCLIGAMPGSFYEESMHFLHSCYCLQWLSQVPSGLVTEIGTNKGSIYSSKASRLPVQKA
3bb1F           TPGLIEGGYINDMALNIIKSFLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHA
2a2zD           QTYACLSRIRAQLASLNEKPVLFFERSVYSDRYIFASNLYESECMN----ETEWTIYQDWHDWMNNQFGQ
2a2zA           EKPERWSFTFQTYACLSRIRAQLASLNGKEKPVLFFERSVYSDRYIFA---SNLYESECMNETEWTIYQD
1aroP           -------KNDFSDIELAAIPFN-----TLADHYGERLAREQL--ALEHESYEMGERFRKMFERQLLITTL
1e9rA           YDQRTKGWSFFNEIRND----YDWQRYALSVVPRGKTDEA--EEWASYGRLLLRETAKKLALIGTPSMRE
2bc9A           LVLLDTEGLGDVEKGD------------------NQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYY
3czpA           PARRQFTIFDRYGRVLVERIEGFCAPADWLRAYGEINDFEEQLSEYGIIVVKFWLAIDKQTQERF-KERE
1e9sD           YDQRTKGWSFFNEIRNDYDWQRYALSVVPRGK-------------------------TDEAEEWASYGRL
2dr3B           ----------------------QFGWDVKPYEEKGMFAMVDAFTAGIGEKYIVHDLTDIREFIEVLRQAI
421pA           TAGQEEYSAMRDQYMRTFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQA
2d3wC           MAFQYPVEIPGVSNQFFLQTALNAVRSYRGQEDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQM
3bpbA           ETVQRFYPGKVER----------IEAPGTVEAGDIMMVGDHFYIGESARTNAEGARQMIAILEKHGLSGS
2ck3C           VKRLTDADAMKYTIVVSATASDAAPLQYL----------------------------APYSGCSMGEYFR
1e0jB           RVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAET--------DRLLAKLAYMRSGLGCDV
2d0kA           -------------------------LAVDRVIGNENALPWNLPADLAWFKNTLNKPVIYGRHTWESIGRP
3bb1C           TPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHA
2b8tB           SNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNF-------KGEPFGPIAKLFTYADK
3dm5B           HIEVFGNPQEKDA----------------------IKLAKEGVDYFKSKGVDIIIVDTAGRHKEDKALIE
3cddD           YVDDWVPSYDESTITISLVDCSIDYPSGQFNNQTLTQIADIIKVIVNTDVGEPFIQIEQGETPHELLAR-
3dm9B           QLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLID-------TAGRSETNRNLDEKKIARV
3bm2B           LELLINRRSASRLAEPAPTG---EQLQNILRAGRAPDWFVIEGEGRERFSAEQGAIAAGSDDKAIDKARN
1dhjA           ---------------------------VDRVIGMENAMPWNLASLAWFKRNTLDKPVIMGRHTWESIGRP
2d4hA           LDTEGLGDVENQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLVTELTHRIRSKSSPDESADFVSFFPD
2awnC           SYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVL-----QLAHLLDRKPKALSGGQRQRVAIGRT
3cddC           YVDDWVPSYDESTITISVSGRDKTADLVDCNNQTLTQIADIVCKPFGIKVIFQRIQIEQGETPHELLARL
2akaA           NAKTTNNSSRFGKFIEIQFNSAGFISGASIQSYLLEKSRVVFQSETERNYHIFYQLLAGATAEEKKALHL
3bb1D           TPGLIEGGYINDMALNIIKSFLLDKTIDVLLYLTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKD
1e0jA           RVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEA--------ETDRLLAKLAYMRSGLGCDV
2dr3C           KPYEEKGMFAMVDAFTAGIGEYEKY--------------------------IVHDLTDIREFIEVLRQAI
3bjdB           KLAALAAYAAYQQLLYVLSLSDDVATRRWLARAIYRVEERFPAADLSR--ALSEEDFQKRLEQEIAAQSR
2aumA           DQTWQPIDGRVALIAPASAIAT-----EVLEATLRQLEVHGVDYHLGRHVEARYRYLAGTVEQRLEDLHN
2bbsB           IIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGGITLS-----------------GGQRARISLARA
3d3kA           NFVKMLESITNELS-------LFSKTQGQQVSSLKDLPTSPVDLVINCLDCPENVFLRDQPWYKAAVAWA
1bmfC           VKRLTDADAMKYTIVVSATASDAAPLQYLAP----------------------------YSGCSMGEYFR
2d4hB           FVYNSIGTINQQAMDQLYYVTELTHRIRSKSSDSADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTY
1e6cA           SEALQAVATPNRVVATGGGMVLLEQNRQFMRAHGTVVYLFAPAEELLQASLQAHQRPTLTGRPIAEEMEA
1dvrA           QGGLVSDDIMVNMIKDELTNNPAKNGFILVGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELLVARI
2awoC           PHLSVAENMSFGLK----------LAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRT
2d3wD           MAFVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQM
3bb1G           TPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDARVDNLDKLVAKAITDSFGKGIWNKAIVALTHA
3cbnA           VDPEIGET---ADCIIGVSSSDSISEKRAIARESLVRVILRTENGYDEIRGYGHPELTLDHPTDIVCRKS
3dhwC           MIFQHFNLLSSRTVFGNVA-LPLELDNTPKDEVKRRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARA
1e3aB           IANWNNSPQRVTEIDRLLEQKPRLTADQAWDVIRQTSRQDLNLRLFLPTLQAATSGLTQSDPRRQLVETL
3bgwD           -----AGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNINIFDKAGQSVNYIWSKTRQTKRKNPGKRV
3adkA           KGQLVPLETVLDMLRDAMV---AKVDTSKGFLIDGYPREVKQGEEFERKIGQPTLLLYVDAGPETMTKRL
2ausC           -------EVIVKDDKAETNPKWGFPPDKRPIELHIQYGVINL--------DKPPGPTSHEVVAWIKRILN
1e2gA           KKSDVEDHSVHLLFSAN-----RWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVG
2a30A           RWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESTIYQDWHDWMNNQFGQ
2a5jA           ESFRSITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQ-HSSSNMVIMLIGNKSDLESRRDVKREEG
2b8wB           LVLLDTEGLGDVEKGDNQNDSWIFA------LAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKS
3ch4B           AFRKDMIRWGEEKRIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFPGVDDAESECGLD
3c8uA           RKGAPETFDFEGFQ-RLCHALKHQERVIYPLFDRARDIAI------------------AGAAEVGPECRV
2a30D           RWSFTFQTYACLSRIRAQLASLNGKPVLFFERSVYSDRYASNLYESECMNETEWTIYQDWHDWMNNQFGQ
1e9sJ           NPYDQRTKGW-----------------------SFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRL
1bg0A           GQFIISTR---VRCGRSLQGYPFNPCLTAEQYKEMEEKVSSTLSSMEDELYYPLTGMSKATQQQLIDDHF
1d2zD           VDGPGALISL------------------------------------------------------------
3cioD           LSEYLAKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDDLVIVDTPPMLAVSDAAV
2dflA           ----------TFRWERIENMAKALGLDIDNVMNNIYYIRAINTDHQIAIVDDLQELVSKDPSIKLIVVDS
2d2eA           LAFQ-YPVVPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALELLDWDESYLSRYLNEGEKKRNEILQL
3dffA           VFAGAYSPAAQRHTIWGLA---PDDDAVLYRRKEDI-AALDHLRVAHRHGRFLDSIYRKLPDGRWLTAHV
2c0bL           HQESNVIVRAFRDYLRQDIGEILIDNPKVLELARQHIAALG-RPDFSSKIKLYTGEIPLFSHYQIESQIE
1e2kA           DQGEIS-AGDAAVVMTSA------QITMGMPYAVTDAVLA--------------PHIGGEAGPPPALTLI
2bx2L           HQESNVIVRAFRDYLRQDIGEILIDNPKVLELARQHIAALGRPDFSSK-IKLYTGEIPLFSHYQIESQIE
1ai4B           NNSPQKDYPASDLFAFLWGGADRVTEIDRLLEQKPRLTADLNLRLFLPTLQAATSGLTQSDPRRQLVETL
2bbtB           IIG------------------VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGITLSGGQRARISLARA
3cr7D           ADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVAEETKGLYKKAREGVIKEFTGISAP
2bkeA           KALGLDIDNVNNIYYIRAINTDHQIAIVDDLQELVSKDPS----------------------IKLIVVDS
1cr0A           VRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAE----------------AETDRLLAKLAYMR
1cr1A           RVRLRQSD---------------SLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMR
3cr7A           ADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTGLPFGLYKKAREGVIKEFTGISAP
1afrA           SWAIWTRAWTAEENRHGDLLNKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSPYLGFIYTSFQERATF
2b8tC           EILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFGPIAKLFTYADK
3bo6B           FQALSGLLFSVDSPIDKWKVTDMERVDQQSRVAVGAQFTLY--VKPDQENSQYSASSLHNTRQFIECLES
2dr3F           ----------------------VKPYEEKGMFAMVDAFTAGIGKSKEYEKYIVHDLTDIREFIEVLRQAI
2bnlB           ----------------------------------------------------------------------
3a00A           VDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQVSKSGKT---------------CILDIDMQGVKSVKA
3d3qA           YIDILFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNY-AFEISEDKKQVKLKEYLASFDKE
1d6jA           -------GFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVATPGEETGLPFVEV
1e9rE           YDQRTKGWSFFNEIRNDYDWQRYALSVVPRGK-------------------------TDEAEEWASYGRL
3ecpA           SSAALGDPRRTARLVNVAAQLAYSGKSITISSEGSKAAQEGAYRFIRNPNVSAEAIRKAGAMQTVKLAQE
2dr3D           KPYEEKGMFAMVDA-----------------------FTAGIGKSKEYEKYIVHDLTDIREFIEVLRQAI
3bczC           TRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGFERSLQTDEDEHSIEHLPYTAKA
2awoA           YALYPHLSVAENMSFG------LKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRT
2d2fA           LAFQYPVEVPGVFLRLALQAKLGREVGVAEFWTKVKKALELLDWDESYLSRYLNEGFSGGEKKRNEILQL
1ak2A           AGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRI
3cmxA           DNLLCSQPTGEQALEICDALARSGAVTPKAEARMMSQAMRKLAGNLKQSNTLFINQIRNPETTTGGNALK
2cckB           TEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIY
5dfrA           -------------------------MISLIAALAVDRVIGPWADLAWFKRNTLDKPVIMGRHTWESIGRP
2d3wA           IPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQM
1e2iA           SAQITMGMPYAVTDAVLAPHIGGEAGPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPP
3b9qA           DQLEIWAERTGCEIVVAEKAKAATVLSKAVKRGKEEGYDVVLCDTSGRLHTNYSLMEELIACKKAVGKIV
2a30B           FQTYACLSRIRAQLASLNDAEKPVLFFERSVYSDRYIFASNLYESECMN-ETEWTIYQDWHDWMNNQFGQ
1e9rG           YDQRTKGWSFFNEIRN--DYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHW
3dauA           ---MISLIALAVDRVIGMENAMPWNLPADLAWFKRN---------------TLNKPVIMGRHTWESIGRP
1d6jB           ADRNENIRRIAEVAKLFSNSIAITSFISPYRKDRDTARQLHEVATPGEETGLPFVEVYVDVPVEVAEQRA
1dhiA           ---MISLIALAVDRVIGME----NAMPWNLPASLAWFKRNT-----------LDKPVIMGRHTWESIGRP
3cmvB           DNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEI-------GLAARMMSQAMRKLAGNLK
1cr2A           -------IGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFH----LYDSFEAETDRLLAKLAYMR
3d31A           QNYSLFPHMNVKKNLEFGMRMKKIKDPKRV-------LDTARDLKIEHLLDRNPLTLSGGEQQRVALARA
2d4uA           DQNIGSGSTVAELMESASISLKQAEKNWADYEALPRDPRQST--AAAAEIKRNYDIYHNALAELIQLLGA
3dfnC           ------------------------------------------------------ALTPEQKKELSDIAHR
3cmvE           LLCS-QPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEISHMGLAARMMSQAMRKLAGNLKQ
3cd9A           CS--ALSKDPNEKR----------DHMVLLEFVTAA----------------------------------
3clvA           GQERYASIVPLYYRGATCAIVVFDI---SNSNTLDRAKTWVNQLKISSNYIIILVANKIDKNFQVDILEV
1e9sB           YDQRTKGWSF-------FNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGLLLRETAKKLALIGTPSMRE
2bdtA           NFLLAQNDVVLDYIAFPDEAEALAQTVQAKVDDVEIRFIILWTNRE-----ELLRRDALRKKGERCLELV
2a1fF           ---------------------------------------------------------SQPIYKRILLKLS
1av6A           TRFVDEEYLRSIKKQLHPSKIILIS-----DVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQ
1bglA           ----------------------------------------------------NDIGVSEATRIDPNAWVE
1e59A           DQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA----VTPPELTKDDERYPGHDPRY
3dfdA           PVEVAKRLSVGGEY---------ANWLNKAIEINGF----------------------------------
2dpyB           ARSVVIAAPADVSPLLRM-QGAAYATRIAEDFRDRGQHVLLIMDSLTAMAQREIALAIGEPPATKGYPPS
3d3qB           YIDILPPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNAFEDKKQVKLKKELEHLNNN
2bkiA           RNNNSSRF---GKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGASEDIRERLHL
3b55A           -----------------------------------------AKWLEAHAKPLKTTNPTASLNDLKPLKNV
1eilA           ---------------------------RLGYLGFAVKDVPAWDHFLTKSVGL----MAAGSAGDAALYRA
2aunA           DQTWQPIDGRVALIAPASAIAT-----EVLEATLRQLEVHGVDYHLGRHVEARYRYLAGTVEQRLEDLHN
1dekA           TRKEFEGIDYDRETNLNLTKLEVITIMEQAFCYLNGKSPIKDEGKESVNFVAFNKITDVINNIEDQWSVR
3cr7B           RNENRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVETGLPFVEVYPVEVAEQRDPKGLYKKARE
2aunB           DQTWQPIDGRVALIAPASAIAT-----EVLEATLRQLEVHGVDYHLGRHVEARYRYLAGTVEQRLEDLHN
1e2hB           SAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQ
3c85A           LREEAAQQHRSEGRNVISGDATDPDFWERILDTGHVKLVLLAPHHQGNQTALEQLQRRNYKGQIAAIAEY
3dfqA           ------------------------------------------------------ALTPEQKKELSDIAHR
2bnlA           ----------------------------------------------------------------------
3d1mA           -------------------------------------YKQFIPNVAEKTLGASG-RYEGKITRNSERFKE
2drcA           ---MISLIALAVDRVIGME----NAMPFNLPADLAWFKRNTL-----------DKPVIMGRHTWESIGRP
2cvfA           PEEALSRFILFTPSDFKEQRRVIGSLKKTVDSNFALVVVDSITAHYRASRQLQVLLWIARKHNIPVIVIN
3dfoD           ------------------------------------------------------ALTPEQKKELSDIAHR
2a2zB           RWSFTFQTYACLSR----IRAQLASLNGEKPVLFFERSVYSDRYIFASNLYESETIYQDWHDWMNNQFGQ
3dftD           ------------------------------------------------------ALTPEQKKELSDIAHR
3dfpD           ------------------------------------------------------ALTPEQKKELSDIAHR
1ek0A           DTAGQERFASLAPYYRNAQAALVVYDVFIKARHWVKELHEQASKDIIIALVGNKIDLQEGGERKVARGEK
3cnlA           AKLLLVGSLPVERI-----EDQRIFERAFEIFARSIGIESSFSEFFEDFARKRGLLKKGGVPDIERALML
2bhvD           QIAGKVIAQVESDIFA-------------------HMGKAVLIPKGSKVIGYYSNNNKMGYRLDIVWSRI
2bhvA           QIAGKVIAQVESDIFAHM-------------------GKAVLIPKGSKVIGYYSNNNKMGEYRDIVWSRI
2c7cH           DKAVTAAVEELKALSVPCSDSKAIAQVGTISITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAV
1e9sL           YDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLREKKLALIGTPSMRELFHWTTIA
6aldA           ------------------------------------------------------ALTPEQKKELSDIAHR
3d1mB           ------------------------------------AYKQFIPNVAEKTLGASG-RYEGKITRNSERFKE
3dlbB           EMSLEAWLAQGHPLPKRVRNAYDRRTWELLRLGEEDPKELPLPGGLSLL--DYHASKGRLQGREGGRVAW
1cjaA           SERGATVVPIDSKIIPLDASHPHGERVRELLRT-----LIAHPGHESSQFHSIRDIITLYTGYDVGTEGS
1culC           PPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDV
1aldA           ------------------------------------------------------ALTPEQKKELSDIAHR
2bnlC           ----------------------------------------------------------------------
3dfnA           ------------------------------------------------------ALTPEQKKELSDIAHR
2aumB           DQTWQPIDGRVALIAPASAIAT-EVLEATLRQLEVHGVDYHLGRHV----EARYRYLAGTVEQRLEDLHN
2bwjA           ERGDLVSGIVLELLKEAMVASLGDT---RGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRL
1e9sE           YDQRTKGWSFFNEI---------RNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPS
3dfnD           ------------------------------------------------------ALTPEQKKELSDIAHR
3dfpC           ------------------------------------------------------ALTPEQKKELSDIAHR
3dftC           ------------------------------------------------------ALTPEQKKELSDIAHR
3czjA           -------------------------------IGDKKQLLTPLRDQFTRAPLDNDIGVSEATRIDPNAWVE
1adoA           ------------------------------------------------------ALTPEQKKELSDIAHR
1e9rF           YDQRTKGWSFFNEIRN------DYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRE
1e2iB           TTQHRLDQGEIS---------AGDAAVVMTSAQITMGMPYAVTD-------AVLAPHIGGEAHAPPPALT
1e9rD           YDQRTKGWSF-------------------------FNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRL
2dftA           EDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGN--DRAEKYRALMAKRAP
3dfqD           ------------------------------------------------------ALTPEQKKELSDIAHR
3cqcA           EKVAHEHKEKKYEM-------------------DFGIWKGHLDALTADVKEKMYNVLLFVDGGWMVD---
1eamA           TRFVDEEYLRSIKKQL----------HPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRC
1draA           ---MISLIALAVDRVIGME--------NAMPWN------LP-AELAWFKRNTLDKPVIMGRHTWESIGRP
1ckvA           NVYDFLVDVSSTIGRAY---TLGNKFTITSELMGLDRKLEDY----------------------------
2bhjA           TPLEE---LLPHAIEFINQYYGSFKEAKIEEHLARLEAVTKEI-ETTGTYQLTLDELIFATKMAWRNAPR
3cmtD           NLLCSQPDTGEQALEICDRSGAVDVIVEMGLAARMMSQAMRKLAGNLKQLLIFINQIRMKNPETTTGGNA
1b0uA           QLRLLRTRLTMVFQHFNMEAPIQVLGLSKHDARERALKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARA
2dpyA           ARSVVIAAPADVSPLLRMQGAAYATIAEDFRDRGQHVLLIMDSLTRYAMAQREIALAIGEPPATKGYPPS
2awnA           YALEVINQRVNQVAEVLAIGRTLVAEPSVFLLDEPLSNLDAALRVQ------------------------
2bjbA           VAVDGTGLPFRVRGNGSLAGGTVAIDASASSQFVSGLLLS--------------AASFTDGLTVQHTGSS
1e9sI           YDQRTKGWSFFNEI------RNDYDWQRYALSVVPRGKTD-------------------EAEEWASYGRL
1e4vA           AGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLE-----FDVPDELIVDR
2a1fD           ---------------------------------------------------------------QPIYKRI
1akeA           AGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVL----EFDVPDELIVDRI
2b0lC           ---------------------------------------------------------------------H
3dymA           --------------------------------------------RDQFTRAPLDNDIGVSEATRIDPNAW
1cs4C           PPVELANPENQFRVDYI-----------------------------------------------------
1dyhA           ---MISLIALAVDRVIGMENAMPWNLPADLAWFKRN---------------TLDKPVIMGRHTWESIGRP
3dfoC           ------------------------------------------------------ALTPEQKKELSDIAHR
2ancF           IRQKMPHARSIIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAER
3be4A           NFVGDEIVLGLVKFDLGVCVNGFVLDGFPRTIPQAEGLAKILSEIGDSLTSVIYFEIDSGRCTHPASGRI
2bbtA           IIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGGITLSGG-----------------QRARISLARA
1d8jA           -----LSGSSGYKFG------VLAKIVNYMKTRHQ--RGDTHPLTLDEI-LDETQHLDIGLKQKQWLMEA
2dftC           FRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGVVYLEISAAEGVRRTGGDRAEKYRALMAKRAP
1d6aA           TAIHDAKNGVLPKPLELVDASGAKWIVLRVDEIKPDVALLNYVGG-------------------------
3bk7A           -----YEGTVYELLSKIDS---------SKLNSNFYKTELLKPLGIIDLYDRNVEDLSGGELQRVAIAAT
3dyoA           ----------------------QSGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGVSEATRIDPNAWVE
3bv4A           ------------------------------------------------------ALTPEQKKELSDIAHR
3brwA           IPISCLTEFPNVVQMAKLVCEDVNVDRFYPVLYPKASRLIVTFDEHVISNNFKFGVIYQKLGATSEEELF
1drbA           ------------------LIAALAVDRVIGMENAMPWNLPAC--LAWFKRNTLDKPVIMGRHTWESIGRP
2bv7A           ---------------------FIQVFLQSICDGERDENHPNLIRVNATKAYEMALKKYHGWIVQKIFQAA
2e85A           --------SAVTDVLLCV----------GNSMMGDDGAGPLLAEKCAAAPKGNWVVIDGGSAPENDIVAI
3cnnA           AAKLLLVGSLPVERIEDQRIFERAFEIFARSIGIESSF----SEFFEDFARKRGLLKKGGVPDIERALML
3a00B           VDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQVSKSGKT---------------CILDIDMQGVKSVKA
2anbA           HDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLD-------IDWQGAQQIRQKMPHARSI
1e9sM           YDQRTKG----WSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRL--LLRETAKKLALIGTPSMRE
3dfqC           ------------------------------------------------------ALTPEQKKELSDIAHR
4dfrA           ---MISLIALAVDRVIGMENAMPWNLPADLAWFKRN---------------TLDKPVIMGRHTWESIGRP
4atjA           NTTSFRTEDAFGNANSARG---FPVIDRMKAAVESACPRTVSCADLLTIAAQQSVTLAGGPSWRVPLGRR
2e85B           --------------------------------------------------------IDGGSAPENDIVAR
2czvB           SNDRVIRYSIEKGVDAIISPWVNRKDPGIDHVLAKL---MVKKNVALGFSLRPLLYSNPYERANLAWKLV
3cmwC           DNLCSQPDTGEQALEICDALAR-SGAVDVIVVDSVAALTPKAEIEGEIGDS----HMGLAARMMSQAMRK
1ckeA           SEDALVPLASHLDVRFVSTNGNLEVIL------EGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRA
3crmA           YPHRLIDRDPAESYSAAEFRADALAAMAKATARGRIPLLVGGTMLYYKA--------LLEGLPYTVAQLA
2awoD           PLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAG
3cueF           QERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVA
2a1fE           ---------------------------------------------------------------QPIYKRI
1cfrA           --EWLIGRAIEFFLESETNFIVVKMPVMSIYKSCLSEFIYDLRSKLSL---NNVNLITSNPDFSIIDIRG
2ccjA           MDIRTEAMLFAASRREHLVLKVIPA------------LKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRA
1dekB           GVFAANTDPLTRKEFEGI--DYDRETNLNLTKLEVITIME-----------QAFCYLNGKSPIKGVFVFD
1e9sH           YDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASRLLLRETAKKLALIGTPSMRELFHWTTIA
2b8tD           ESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAEVIISGLDKNFKGEPFGPIAKLFTYADK
3cm0A           ERGDLVPDDIREELAERVIFDGFPRTLAQAEALDRSETGTRLLGVVLVEVPEE-------ELVRRILRRA
1e2lA           SAGDAAVVMTSAQITMGMPYAVTDPHIGGEAGSPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLA
2boeX           -----------DSPFYVNPNMSSAEWVRNNPNDPRTPVIRDRIASVPQGTWHNPGQITGQVDALMSAAQA
2cbzA           AWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYS
1cjtC           ELANPENQFRVDYILSVMNVPDFDF---------------------------------------------
1e2jA           SAGDAAVVMTSANITMGMPYAVTDAVLAPHIGGEAGALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLA
2bboA           NIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSEGQQAKISLARAVYKDADLYLLDSP
2d7vA           ETEVVT----------------------------------------------------------------
1c9kC           LIT---ADLAPDDAILLECITTMVTNLLFALGDPEQWDYA--------------AMERAIDDEIQILIAA
3do6A           ----------------------------------------------------------------------
2ancD           --YFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARSI
1e2mB           SAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRHP-IAALLCYPAARYLMGSMTPQ
2d7vB           N-------SVETEVVTEI----------------------------------------------------
1dp0A           -----------------------------------KQLLTPLRDQFTRAPLDNDIGVSEATRIDPNAWVE
1e2nA           TTQHRLDQGEAAVVMTS-AQITMGMPYAVTDAVLAPHIGGEAGS----PPALTLIFDRHPIAALLCYPAA
3c15C           VPPVELANPENQFRVDYILSVMNVP---------------------------------------------
2an9A           HDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQI-------RQKMPHARSI
2a1fC           ---------------------------------------------------------SQPIYKRILLK--
2d4uB           DQNNIGSGTVAELMESASISLKQAEKNWADYEALPRDPRQST--AAAAEIKRNYDIYHNALAELIQLLGA
1e2nB           SAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLI---FDRHPIAALLCYPAARYLMGSMT
1bccF           NKYGLMRDTIYENDDVKEAIRRLPEN-LYDDRMFRIKRALDLNM-------RQQILPKEQWTKYEEDVPY
1e2kB           TTQHRLDQGEIS---------AGDAAVVMTSAQITMGMPYAVTD-------AVLAPHIGGEAHAPPPALT
3cmuA           DNLCSQPDTGEQALEICDALAR-SGAVDVI-VVDSVAALTPKAEIE-------GEIGDSHMGLAARMMSQ
3bwdD           DVFILAFSLISKASYENVSKKWIPE-----LKHYAPGVPIVLVGTKLDLRDDKQFFIDHAVPITTVQGEE
3e70C           GVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMD------------------EMKK
1e9sA           YDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRE------TAKKLALIGTPSMRE
1e2hA           QGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIYPAARYLMGSMTPQAVLAFVA
3dmdA           ----------------------------------------------------------------------
2ancB           HDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDID-------WQGAQQIRQKMPHARSI
1chdA           ----------------------------------------------------------------------
3b85B           PLHDALRDVEPEVIPKLEAGIVEVAPLAYRGRTLNDAFVILDEA--------------QNTTPAQKFLTR
3bjqB           -------------------------------------------------------------QARVV----
3cphA           DTAGQERFRTITTAYYRGAILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDMETRVVTADQG
2b0lB           ----------------------------------------------------------------------
3c14C           NLVPPVELANPENQFRVDYILSVMN---------------------------------------------
1e9rB           YDQRTKGWSFFNE---------------------------------------------------------
2c5mD           -------------------------------------------------------------KSCGLHVTS
2ax4A           EVAKLFADAGLVCISFISPFAKDRENARKIHESAGLPFFEIFVDAPLNICESRDKGLYKRARAGEIKGFT
1cjvC           NLVPPVELANPENQFRVDYILSVMN---------------------------------------------
2cdnA           DAGDLVPSDLTELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDID-AVLEFRVSEEVLLER
2bhvC           QIAGKVIAQVESDIFAHMGKA-------------------VLIPKGSKVIGYYSNNNKMEYRLDIVWSRI
1azsC           NLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGV----------------------
2c95B           EKGQLV----PLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRQPTLLLYVDAGPETMTQRL
2ax4B           VAKLFADAGLVCITSFISPFAKDRENARKIHESAGLPFFEIFVDAPLNICESRDKGLYKRARAGEIKGFT
2c9gA           ----------------------------------------------------------------------
1e2mA           SAGDAAVVMTSAQITMGMPYAVTDAVLAP----------------------HIGGEAGSPPALTLIFDRH
3e8aC           NLVPPV----------------------------------------------------------------
1cjuC           NLVPPVELANPENQFRVDYILSVMN---------------------------------------------
1delA           ANTDYPCLTRFEGIDYDRETNLNLTKLEVITIEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNKITDV
2c9oA           RAIGLRIKETKEVYEGEVTELTPCHVIIGLKTAKGTKQLKLDPSIFESLQ-----KERVEAGDVIYIEAN
1e2lB           TTQHRLDQGEIS------AGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRHPIAAL
2aexA           ----------------------------------------------------------------------
3c7kA           G---------------------------------------------------------------------
3cbqA           DIWEQGDAGGWLRDHCLQTGDAFLIVFSVTDRRSFSKVPETLLRLRAGRPHHDLPVILVGNKSDLSLEEG
2bwjB           ----------------------------------------------------------------------
2a5vA           RDGLSRVEFEQRHVHETVAILMARSSAISERIAGGVGVTYQLDDGRAVLRDHIGNI--------------
3bs4A           IKYLENRLAIVDTFGSFHGIMPG--VWYLEGMLSSETLPIKYAKAVEDHKKVWMDLNLFEGRELYGFAIS
2bwjD           ----------------------------------------------------------------------
3cr8B           ---------------------------------------------------REALKHEALSLPSLDLDWQ
2bwjF           ----------------------------------------------------------------------
3cddB           DWVPSYDESTITISVSGRDKTAQFNNQTLTQIADIVCKPFGIKVIVNTVGEPFQRIQIEQGETPHELLAR
3c94A           ----------------------------------------------------------------------
2a5vB           RDGLSRVEFEQRHVHETVAILSAISERIAGGSLAIVGVTYQLDDGRAVLRDHIGNI--------------
1delB           YPCLTRKEFEGIDY--------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
2dx7A           -------------------------------------------------------------VEIMTPTED
1e6vC           --------------------------------------------------------KYMNPNYELKKLRE
2bwjC           ----------------------------------------------------------------------
3dkvA           DKGLVPDEVTIGIVRERLS---------------------------------------------------
2bwjE           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
2a78A           TAGQEDYAAIRDSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEA
1dmaB           -------------------------------------------------------QLEERGYVFVGYHGT
1e9sK           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
3cddE           YVDDWVPSYDTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGVNTDVGEPFQHELLAR
2axnA           ----------------------------------------------------------------------
3dvlD           AKLVDEG----------------KLFILDASPDPEGQEVVGGFDLSALI-ERINYAIQKYRARRVSIDSV
2axzA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           LVRNPPVLILDEATSALDAESEYLIQQAIHGNLQKHTVLIIAHRLSTVEHAHLIVVLDKGRVVQQGTHQQ
3b60A           LLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLSTIEQADEIVVVEDGIIVERGTHSE
3b5jA           LVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHKE
3dmdC           MKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVDGIILTKLDADAGGAALSISYVIDAPILFVGVGQ
3dm5A           IHPHEVILVIDGTIGQQAYNQALAFKEATPI-----GSIIVTKLDGSAGGGALSAVAATGAPIKFIGTGE
3eiuA           SMPGDDITHPIPDLSGYITEGQIVVARELHR---KGIYPPINVLPSLSRLMNSGIGAGKTREDHKAVSDQ
3dt2A           AHPNSRFCTPASQCPIIDPAWESPEGVPIEGIIAGVPLVYEALSWQHGVFEATAAAEHKGKVIMHDPFAM
2c03B           LARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVTGLVLTKLDGDARGAALSARHVTGKPIYFAGVSE
3dtbB           AHPNSRFCTPASQCPIIDPAWESPEGVPIEGIIFGGPLVYEALSWQHGVFVGAAMRSEAKVIMHDPFAMR
1dkiA           GYNQSVHQINRGDFSK-----QDWEAQIDKELSQNQPVYYQGVGKVGGH----AFVID-GADGRNFYHVN
3dmdB           MKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVDGIILTKLDADAGGAALSISYVIDAPILFVGVGQ
2akaB           FVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMEGTDARDVLENKLLPLRRGYIG
1accA           VVKEAHREVINSSTEGLLLNIDKDIRKILSG----YIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFI
2d3wB           AVLEPELCILDESDSLDIDALKVVADGVNLRDGKRSFIIVTHYRILDYIKPDYVHVLYQGRIVKSGDFTL
2c61B           SMPGDDITHPIPDLSGYITEGQIVVARELHR---KGIYPPINVLPSLSRLMNSGIGAGKTREDHKAVSDQ
1e69A           FAKPSPFYVLDEVDSPLDDYNAERFKRLLKENSKHTQFIVITHNKIVMEAADLLHGV----TMVNGVSA-
2dwoA           FAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQPLDPDKCDRD
3cmvH           KQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEENVVGSETRVKVVKNQAEFQILYGEGINFYGELVD
2c03A           LARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEK
1e9cA           LPKPDLVLFLQLQLADAA--KRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDI
3dt4C           AHPNSRFCTPASQCPIIDPAWESPEGVPIEGIIFGGPLVYEALSWQHGVFEATAAAEHKGKVIMHDPFAM
3bb1A           QFSPPDGLPYDEFFSKRSEALLQVVRSGASLKSDIPVVLIENSGRCNKNDS-DEKVLPNGIAWIPHLVQT
3dt7A           AHPNSRFCTPASQCPIIDPAWESPEGVPIEGIIFGGPLVYEALSWQHGVFEATAAAEHKGKVIMHDPFAM
4dcgA           YSAEMRLLSIYTGENMRLTRVTKSDAVNYYLNKIVRNKVVVNFDY----PNQEYDYFHMYFMLRTVYCNK
3dt4A           AHPNSRFCTPASQCPIIDPAWESPEGVPIEGIIAGVPLVYEALSWQHGVFEATAAAEHKGKVIMHDPFAM
3b2qA           --NEVPGRRGYPGYMYTDLATLYERAGIVGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVAR--
3cmvG           KQSNTLLIFINQGGNALKFYASVRLDIRRIGVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGIN
2dwpA           FAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQPLDPDKCDRD
2c04A           LARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEK
2b8tA           ITKLTAICNECGAEATHSLRKIDGKHA------DYNDDIVKIGCQEFYSAVCRHHHKVPNRPYLNSNSEE
2c61A           EVPGRRGYPGYMYTDLATLYERAGIVKGAKGSTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELHRK
2cjwB           IETSAAVQHNVKELF------------------EGIVRQVRLRRDSKEKNERRLAYQKRKE---------
3eiuB           SMPGDDITHPIPDLSGYITEGQIVVARELH---RKGIYPPINVLPSLSRLMNSGIGAGKTREDHKAVSDQ
2ccjB           GLYPDLTIYLNVSAEVGRERIIKNNRL------DQEDLKFHEKVIEGYEIIQRFKSVNADQPLENV-VED
3c95A           QVFTP--EFLQGYADELQMLVQQYADDKEKVALLK-----------------------------------
2ccgA           LNEFAINGLYPDLTIYLNVSAEVGRERIIKSRDQNRLDQEDLKFHEKVEGYQEIIHNESQRFKSVNADQP
1d1cA           LAGPESFNYLNQSGCVDIKGVSDSEEFKITRQAMDIVGFSQEEQMSIFKIIAGILHLGNIKFEKGAGEGA
2ccgB           LNEFAINGLYPDLTIYLNVSAEVGRERIIKNSLDQEKFHEKVIQEIIHNESQRFKSVNADQPLEN-VVED
1e98A           LPKPDLVLFLQLQLADAAKRGAFGHERYENG--AFQERALRCFHQLMKDTTLNWKMVDASKRIEAVHEEI
1e9fA           LPKPDLVLFLQLQLADAAKRYENCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIATATEKPLGE
3cmvA           KQSNTLLIFINQGGNALKFYSVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGIN
3cmvC           SNTLLIFINQGGNALKFYASVRLDIRRIENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVD
2ahvA           VEFDNKEYLYYKAIAPDI-----AFIRATTCDSEGYATFEDEVMYLDALVIAQAVHNNGGIVMMQVQKM-
3cddF           GRYRPLIIVNEEVTTAEGAAKRGQWERQRSIGKSNAEYTVTGWRIPQTGKLWNIPVIDEIGLDEELIASI
1e2dA           LPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQE-RALRCFHQL-MKDTTLNWKMVDASKSIEAVHEDI
2bbsA           VYKDADLYLLDSPFGYLDVLTEKEIFECVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSE
1bifA           FGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYNRDSDEATEDFMRIECYENSYESLDEEQDRDLSY
3czpB           KTPYKRYKITEEDWRNRDKWDQY--VDAVGDVDRTSTVKVLRTINDAIEAA-------------------
2b8wA           LEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLRKFFPKKKCFVFRPVHRRKLAQLEKLQDEELDPE
3b2qB           SMPGDDITHPIPDLSGYITEGQIVVARELH---RKGIYPPINVLPSLSRLMNSGIGAGKTREDHKAVSDQ
3ec1A           ELTVH-RTKLEKADSLYANQLGELLSPPSK-RYAAEFPPLVPRSLSVKERKTDIVFSGLGWVTCNDPGAQ
2c9yA           TGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSA
2dr3A           RDINAKRVVVDSVTTLYINKPAMARSIILQLKRVLATSIFVSQVSGFGPGVDGIIRLDLDEIDGELKRSL
2c9oC           LESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRQTEGINISEE
2czvA           EKYKVRRFLTSSAQEKWDVRYPRDLISLGVV--IGMEIPQAKASISMY----------------------
1e9dA           LPKPDLVLFLQLQLADAAKR---GAFGHERYENGAFQERALRCFHQLMDTTLNWKMVDASKSIEAVHEDI
2bifA           FGEQNGYKTFFVESICVDPEVIAANIVQVKGSPDYVNRDSDEATEDFMRRIECYE----NSYESLDEEQD
2bofX           GLKNRPAYIIVEPDLISLMSSCMQHVQQEVLETMAYAGKALKAGSSQA------------RIYFDAGHSA
2ahwD           VEFDNKEYLYYKAIAPDI-----AFIRATTCDSEGYATFEDEVMYLDALVIAQAVHNNGGIVMMQVQKMV
2a5gA           LTRIRDRNWYVQPSCATSGDGLYEGLTWL-----------------------------------------
3da4A           HIKES-----------------------------------------------------------------
2dr3E           RDINAKRVVVDSVTTLYINKPAMARILQLKRVLAGTTSIFVSQVSVGPGVEHGIIRLDLDEIDGELKRSL
3bb1B           QFSPPDGLPYDEFFSKRSEALLQVVRSGASLASDIPVVLIENSGRCNSDEKVLGIAWIPHLVQTITEVA-
2awnB           LVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLE
2axzC           FGKDYDLTIQTVLKNALTISINRNLKEAQHLKTIKNISINGYYDLEINYLKQIYIDSYLNAVNIINIFKI
3d7wA           -SILILIQMISEAARFNPILWRARQYIN-----SGASFLPDVYMLELETSWHSLAIAPGVIVT-LTNIRD
3di4A           VFCTGGQYFKASPVRPGDYLEFFAEIDLLGNLSACPGGDCSSEA---SCHPLLVEIFAPAEGLGDWPSPS
2cgtH           ELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIEDVEGEALALVVNTMRGIVKVAAVKAPGFGDRRK
1e9sG           TFDDLRGFLEGTLAESLFAGSASKALTSARFVLSDKLPEHVTMPDGDFSIRSWLEDPNGGNLFITWREDM
3a1wA           YELQKHLGIPVVFTSSVTGEGLEELKEKI-----------------------------------------
3bgwA           NPGKRVIVMIDYLQLLEPAKANDSRTNQISQISRDLVVIALSQLSRQVERQDKRPMLSDLRESGQDADII
1e1qB           SRLLERAAKMNDAFG----GGSLTALPVIETQAGDVSAYIPTN---VISITDGQIFLETE-LFYKGIR--
1dg3A           FSLDLQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHELDPEFVQQVADFCS
1e9sF           LLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFAESLFAGSNEASKALTSARFVLSDKLPEHVTMPD-
3b85A           ILRGVDDVHFSELTSSDV-VRHQLVGHIV-----------------------------------------
2awnD           LYHYPADRFVAPKMNFLPVKVTATAIDQVQVELPMPQQVWLPVESRDVVGANMSLGIRPEHLLPSDIADV
3bb1E           QFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKASDPVVLIENSGRCNKNDSDEKVLPNGIAWIPHLVQT
3ed8A           ----------------------------------------------------------------------
2c4rL           SAFQRGGSIVIDSTEALTAIDINSARGDIE-ETAFNEAADEIARQLRLRDLGGLIVIDFIDMTPVRHQRA
3bb1H           QFSPPDGLPYDEFF--------------SKRSEALLQVVRSGASLKKDSDIPVVLIENSGRCNKNDSDEK
3bh0A           IVMIDYLQLLEPAKANDSRTNQISQISRDLKKMLDVVVIALSQLSRQVERQDKRPMLSDLRESGQDADII
1cr4A           SGLGCDVIILDHISIRKMIDNLMTKLKGFAKSTGV-VLVVICHLKDLRQLSDTIIALERNQLVLVRILKC
1e4yA           GINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLV
2axpA           EVSNAGLHTYSWDTGQWSSDE---IAKDIIFLVE------------------------------------
2cckA           EVRALNEFAINGLYPDLTIYLNVSAEIIKNSRLDQEDLKFHEKVIEGYQEIRFKSVNADQPLEN------
2d62A           IIRRPKVFLDEPLSNLDAKLRVKRAELKKLQRQLGVTTIYVTHD--QVEATGDRIAVNKGELQQVGTPDE
1e3mB           HNATEYSLVLDEIGRGTSTYDGLSLAWACAENLANKLTLFATHYFELTQLEKEGVANVHLDALEHGDTIA
2ctsA           NSESNFARAYAEGIHRTKYWEL-IYEDCMDLIAKLPCVAAKIYRNLYREGSSIGAIDSKLDWSHNFTN--
2b92B           FSLDLEADGQPLTPDEYLTYSLKLKKGTSQ--KDETFNLPRLCIRKFFPKKKCFVFDRPVHRRKLAQLEK
1e2fA           LPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQE-RALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIR
1e3mA           HNATEYSLVLDEIGRGTSTYDGLSLAWACAENLIKALTLFATHYFELTLPEKEGVANVHLDALEHGDTIA
2bkhA           SPDNFRYLNRGCTRYFANKETDKQILQNRKSPEYLKAGSLKDPLLDDHRMCTAMKKIGLDDEEKLDLFRV
3cr7C           -YEAPANPEVHVKNYELPVQDA--VKQIID-YLDTKGYL-------------------------------
2eg5G           YLDQFTKDFTTFLRIHSEELFSHGRM--LLTCICKGVELDARNAIDLLEMAI------------------
3bb1F           QFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKDIPVVLIENSGRCNKNDSDEKVLPN-GIAWIPHLVQT
2a2zD           SLELDGIIYLQATPETCLHEEQGIPLEYLEKLHYKHWLLHRTLKTFDYLQEVPILTLDVNEDFKD-KYES
2a2zA           WHDWMNNQFGQSLELDGIIYLQATPEHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRT----------
1aroP           LPKMIARINDWFEEVKAKGKRPTAFQFLQEIKPEAVAYITIKTTLACLSADNTTVQAVASAIGRAIEDGR
1e9rA           LFHWTTIATFDDLRGFLEGTLAESLFAGSN----------------------------------------
2bc9A           VTELTHRIRSKSDFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYTSQKDETFNLPRLCIRKFFPKKK
3czpA           KTPYKRYKITEEDWRNRDKWDQY--VDAVGDVDRTSTVKVLRTINDAIEAA------YKKD---------
1e9sD           LLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLAESLFAGSNEASALTSARFVLSDKLPEHVTMPDG
2dr3B           RDINAKRVVVDSVTTLYIPAMARSIILQLKRVLAGTTSIFVSQVSVGERGFPGVEHGVDGIIRLDLDEID
421pA           QDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH----------------------------------
2d3wC           AVLEPELCILDESDDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTL
3bpbA           VVRLEKVLGLKTGLAYLEHNNLLAAGEVSKPEFQDFNIIEIPEEE---SYAANCIWVNERVIMPAGYPRT
2ck3C           DNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLEAAKMNDAFGGGSLTALPVIET
1e0jB           IILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTVLVVICHLKNPDKGSDTIIALERNQQGDMPNLVL
2d0kA           LPGRKNIILSSQPGTDDRVTWVKSVDEAIAGDVPEIFVIGGGRVYEQFPKAQKLYLTHIDAEVEGDTHFP
3bb1C           QFSPPDGLPYDEFFSKRSEALLQVVRSGASLKSDIPVVLIENSGRCNKNDSDEKVLPN-GIAWIPHLVQT
2b8tB           ITKLTAICNECGAEATHSLRKIDGKHADY------NDDIVKIGCQEFYSAVCRHHHKVPNRPYLNSNSEE
3dm5B           MKQISNVIHPHEVILVIDGTIGQQAYNQAFKEATPIGSIIVTKLDGSAGGGALSAVAATGAPIKFIGTGE
3cddD           LAKQRGVLLTSDTFGNLVITRASKTKAGVS-LILGDNVKAARGRFSWRQRFSKFTIKDSAGLPTVGGIKA
3dm9B           TKPNLVIFVGDALAGNAIVEQARQFNEAV-----KIDGIILTKLDADARGGAALSISIDAPILFVGVGQG
3bm2B           APFRAPLIITVVAKVPRWEQESAGCAVAQAAVAQGFGGIWRSGALTESPVVREAFGCREQDKIYLGTPQL
1dhjA           LPGRKNIILSSQPGTDDRVTWVKSVDEAICGDVPEIMVIGGGRVYEQFPKAQKLYLTHIDAEVEGDTHFP
2d4hA           FVWTLRDFSLDLEADGQPLTPDEYLTYSLNLPRLCIRKFFPKKKCFVFDRPVHRRKLAQLEKLQDEELDP
2awnC           LVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLE
3cddC           A-KQRGVLLTSDTFGNLVITRASKTKAGVS-LILGDNVKAARGRFSWRQRFSKFTIKADSAGLPTVGGIK
2akaA           AGPESFNYLNQSGCVDIKGVSDSEEFK-ITRQAMDIVGFSQEEQMSIFKIIAGILHLGNIKFEKGAGEGA
3bb1D           AASDIPVVLIENSGRCNDEKVLPNGIAWIPHLVQTITEVALNKSESIFVDKNLI----------------
1e0jA           IILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTVLVVICHLKNPDKGKAHIIALERNQQGDMPNLVL
2dr3C           RDINAKRVVVDSVTTLYINKPAMARSIILQLKRVLATSIFVSQVSGVEHGVDGIIRLDLDEIDGELKRSL
3bjdB           ERHPSQYVSGSASRAQLQVFLRHQWFRTFRLYRDAADLLVNLTDVDEAAALARYLYGELGEEDEKGSHPR
2aumA           AFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFAD----ISVLLSAFHRHGLPAIHGPVAT
2bbsB           VYKDADLYLLDSPFGYLDVLTEKEIFESCCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSE
3d3kA           NQNRAPVLSIDPPVHIDAKWSLALGLPLPLGEHAGRIYLCDIGIPQQVFQEINYHSPFGCKFV-------
1bmfC           DNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLRAAKMNDAFGGGSLTALPVIET
2d4hB           SLKLKKGTVFDRPVHRRKLAQLEKLQDEELDPEFVQVADFCSYIFSNSKTKTLIQVNGPRLESLVLTYVN
1e6cA           VLREREALYQDVAHYVVDQPPAAIVCELM-----------------------------------------
1dvrA           TGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQISDDNADALKKRLAAYHAQTEPIVDFYKKTGIWAG
2awoC           LVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLE
2d3wD           AVLEPELCILDESDGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYPDYVHVLYQGRIVKSGDFTL
3bb1G           QFSPPDGLPYDEFFSKRSEALLQVVRSGASLS--DIPVVLIENSGRCNKNDSDEKVLPNGIAWIPHLVQT
3cbnA           DYICSRTLIRADKAAFDL-------DENLVRDLRKGRELKVEIIVEYEGH--------------------
3dhwC           LASNPKVLLCDEATSALDPATTRSILELLINRRLGLTILLITHEMDVKRICDCVAVISNGELIEQDTVSE
1e3aB           TRWDGINLLNDDGKTWQQPGSAILNVWLTMLKRTVVAAVPMPFDKWYSASYETTQDGPTGSLNISVGAKI
3bgwD           IVMIDYLQLLEPAKANDSRTNQISQISRDLKKMAREVVIALSQLSRQVEQQDKRPMLSDLGQLEQDADII
3adkA           LKRGETSGRVDDNEETIKKRLETYYKATIAFYEKRGIVRKVNAEGSVDDFSQVCTHLDT-----------
2ausC           LEKAGHGGTLDPKVSGVLPVALERATRVVALLPAGKEYVALMHLHGDVPEDKIRAVMKEFEGEIIQRTRK
1e2gA           LPKPDLVLFLQLQLADAAKRGERYENGAFQERALRCKMVDASKSIEAVHEDIRVLSEDAIATATEKPLGE
2a30A           SLELDGIIYLQATPETCLHEEQGIPLEYLEKLHYKHWLLHRTLKTFDYLQEVPILTLDVNEYESVEKVKE
2a5jA           EAFAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGL-----------------------------
2b8wB           SVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVH
3ch4B           NFGDFDWVIENHGVEQRLEEQLENLIEFIRSRLK------------------------------------
3c8uA           AIIEGNYLLFDAPGWRDLTAIWDVSIPADLEARLVQRWLDHGLNHDAAARAQGNDLANARAIEAARLPAD
2a30D           SLELDGIIYLQATPETCLHEEQGIPLEYLEKLHYKHWLLHRTLKTNFDYLEVPILTLDVNEYES------
1e9sJ           LLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALVLSDKLPEHVTMPDG
1bg0A           LFKEGDRFLQTANACRYWPTGRGIFHNDAKVNEEDHLRIISMQKGGDLKTVYKRVDNIESKLPFSHDDRF
1d2zD           ----------------------------------------------------------------------
3cioD           VGRSVGTSLLVARFGLNTAKEVSLSMQRLE-QAGVNIKGAILNGVIKRASTAYS----------------
2dflA           VTSHFRAEYPGRENLAVRQQKLNKHLHQLTRLAEVYAVIITNQVMHTLYHPGIRIQLKKSRGNRRI----
2d2eA           LVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGITHYQRILNYIQPDKVHVMMDGRVVATGGPEL
3dffA           EGRQKLAVNDHSPDSDHDLVGE--VADDIRSIIDEFDPTLVVTCAAIGEHPDHEATRDAALFATHEKNVP
2c0bL           SAFQREVRLPSGGSIVIDRDIEETAFNTNLEAADEIARQLRLRDLGGIDFIDMTPVRHQRAVENRLREAV
1e2kA           FDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIRLAKRQRPGERLDLAM
2bx2L           SAFQREVRLPSGGSIVIDSTEALTAIDINS-ARGDIEETAFNTNLEAAEIARQLRLRDLGGLIVIDFIDM
1ai4B           TRWDGINLLNDDGKTWQQPGSAILNVWLTSMRTVVAAVPMPFDKWYSASGYETTQDGPTGSLNISVGAKI
2bbtB           VYKDADLYLLDSPFGYLDVLTEKEIFESCVCLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSE
3cr7D           -YEAPANPEVHVKNYELPVQDA--VKQIID-YLDTKGYLP------------------------------
2bkeA           VTSHFRAEYPGRENLAVRQQKLNKHLHQLTRLAEVYAVIITNQVVPGI--RIQLKKSRGNRRIARVVDAP
1cr0A           SGLGCDVIILDHISIRKM--IDNLMTKLKGFAKSTGVVLVVICHLKDLRASDTIIALERNQLVLVRILKC
1cr1A           SGLGCDVIILDHIS-IRKMIDNLMTKLKGFAKSTGVVLVVICHLKALRQLSDTIIALERNQLVLVRILKC
3cr7A           YAPANPEVHVKNYELPVQDAVKQIID-----YLDTKGYLP------------------------------
1afrA           ISHGNTARQAKEHGDIKLAQICGTIAADEK-----RHETAYTKIVEKLEIDPDGTVLAFADMMRKKISMP
2b8tC           ITKLTAICNECGAEATHSLRKIDGKHADYND-----DIVKIGCQEFYSAVCRHHHKVPNRPYL-NSNSEE
3bo6B           RLSESGLMPGQYPESDVHPENWKYVSYRNELRSGRD----GGEMQSQALREEPFYRL-------------
2dr3F           RDINAKRVVVDSVTTLYINKPAMARSIILQLAGTGCTSIFVSQVSGFGPGVEHIIRLDLDEIDGELKRSL
2bnlB           ----------------------------------------------------------------------
3a00A           IPELNARFLFIAPPSVTGAHDKVIVNDDLDKAYKELKDFIFAEK--------------------------
3d3qA           SAKDIHPNNRKRVLRAIEYKTKKLLKVQQFTENYDTLLIGIESRETLYRINKRVDILGHGLFNEVQHLVE
1d6jA           YVDVPVEAPYEAPANPNYELPVQDAVKQIIDYLDTKGY-LPAKK--------------------------
1e9rE           LLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKRFVLSDKLPEHVTMPDG
3ecpA           ----FPELLAIEDTTSLSYRHQVAEELGKLGSIQDKSRGWWVHSVLLLETTFRTVGLLHQEWWMRPDDPA
2dr3D           RDINAKRVVVDSVTTLYINKPAMARSIILQLAGTGCTSIFVSQVSVGERGFPGVEHGVDGIIRLDLDEID
3bczC           ESHKDEFTIIPVLVGALSESKEQEFGKLFDFCHWGQRFRYSYYDESQGEIYRSIEHLDKGSIIEQLDPVS
2awoA           LVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLE
2d2fA           LVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNLVITHYQRILNYIQPDKVHVMMDGRVVATGGPEL
1ak2A           TGRLIHPQSGRSYHEEFNPPKEPMKDDEPLIRRSDDNKKALKIRLEAYHTTTPLVEYYRGIHSAIDASQT
3cmxA           FYA-SVRLDIRRIGAVKEGENVVGSETR----VKVVKNKIAAPFKQAEQILYGEGINFYGELVDLGVKEK
2cckB           LNVSAEVGRERIIKNRLDQEDLKFHEKVIEGYQEIIKSVNADQPLENVEDTYQTI---------------
5dfrA           LPGRKNIILSSQPGTDDRVTWVKSVDEAACGDVPEIMVIGGGRVYEQFPKAQKLYLTHIDAEVEGDTHFP
2d3wA           AVLEPELCILDESDSGLDIDALKVVADGVNSRDGKRSFIIVTHRILDYIKPDYVHVLYQGRIVKSGDFTL
1e2iA           TLPGTNIVLGARHIDRLAKRQRPGERLDLANTVRYLQCGGSWREDWGQLSGTGPRPHIGDTLFTLFRAPE
3b9qA           SGAPNEILLVLDGNTGLNMLPQAREFNEVVG----ITGLILTKLDGSAGGCVVSVVEELGIPVKFIGVGE
2a30B           SLELDGIIYLQATPETCLHEEQGIPLEYLEKLHYKHWLLHRTLKTNFDYLEVPILTLDVNEYES------
1e9rG           TTIATFDDLRGFLEGTLAENEASKALTSARFVLSDKLPEHVTMPDGDFSIRSWLEDPNGGNLFITWREDM
3dauA           LPGRKNIILSSQPGTDDRVTWVKSVDEAACGDVPEIMVIGGGRVYEQFPKAQKLYLTHIDAEVEGDTHFP
1d6jB           PYEAPANPEVHVKNYELPVQD---AVKQIIDYLDTKGYL-------------------------------
1dhiA           LPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVIMVIGGGRVYEQFPKAQKLYLTHIDAEVEGDTHFP
3cmvB           QSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGIN
1cr2A           SGLGCDVIILDHISIRKMIDNLMTKLKGFAKSTGV-VLVVICHLKSGAQLSDTIIALERNNLVLVRILKC
3d31A           LVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKNTVLHITHDQTEAIMADRIAVVMDGKLIQVGKPEE
2d4uA           GKINE---FFDQPTQGYQDGFEKQYVAYM-----------------------------------------
3dfnC           IVAPGKGILAANESTGSAKRLQSIGTENTEENRRFYRQLLLTADDRVNCIGGVILFHETLYQKADD----
3cmvE           SINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVD
3cd9A           ----------------------------------------------------------------------
3clvA           QKYAQDNNLLFIQTSAKTGTNIKNIFYMLAEEIYKNII--------------------------------
1e9sB           LFHWTTIATFDDLRGFLE----------------------------------------------------
2bdtA           E--EFESKGIDERYFYNTSHLQPTNLNDIVKNLKTNPRFI------------------------------
2a1fF           GE-----ALQGEDGLGIDPAILDRMAVEIKLVEMGVEVSVVLGGGNLFGAKLAKAGMNRVVGDHMGMLAT
1av6A           WIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFR
1bglA           RWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHKTLFISRKTYRIDGGQMAITVDVEVASDTPHPAR
1e59A           AKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVIAAHGNSLRALVKYLDNMSEEEILELNIPTG
3dfdA           ----------------------------------------------------------------------
2dpyB           VFAKLPAL-VERAGNGIHGGGSITAFYTVLTEGDDQQDPIADSARAILD---------------------
3d3qB           KLHEYLASFDKESAKDIHPNNRKRVLRAIFTENYDTLLIGIESRETLYLRNKRVDILGHGLFNEVQHLVE
2bkiA           SSPDNFRYLNRGCTRYFANKETDKQILQN-----------------------------------------
3b55A           G--SASIVGLGEATHGAHEVFTKHRIVKYLVSEKGFTNLVLEEGWDRALELDRYVLTGKG--NPSQHLTP
1eilA           DQRAWRIAVQPGELDDLAYAGLEVDDAAALERMADRQAGVAFTRGDEALMQQRKVMGLLCLQDPFGLPLE
2aunA           AFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFSDISVLAFHRHGLPAIHGPVATGLGLQE
1dekA           RLMQALGTDLIVNNFDRMY---WVKLFALDYLDKFNSGYDYYIVPDTRQDHEMDAARAMGATVIHVVRPG
3cr7B           GVIKEFTGISAPYEAPANPEVHVKN--------YELPVQDAVKQIIDYLDTKGYLP--------------
2aunB           AFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFSD----ISVLLSAFHRHGLPAIHGPVGL
1e2hB           AVLAFVALIPPTLPGTNIVLGALPEDRHID-RLAKRLDLAMLAAIRRVYGLNTVRYLQCGGSWREDWGQL
3c85A           P-DQLEGLLESGVDAAFNIYSEGFARHVCKQLEPQFTSI-------------------------------
3dfqA           IVAPGKGILAASESTGSIARLQSIGTENTEENRRFYRQLLLTADDRNPCIGGVILFHETLYQKADGRPQV
2bnlA           ----------------------------------------------------------------------
3d1mA           LNYNPDIIFKDEENTGADRLMTQRCKDKLMNQWPGVKLRVTEGWDEDGHHSEESLHYE-GRAVDITTSDR
2drcA           LPGRKNIILSSQPGTDDRVTWVKSVDEAIAGDVPEIMVIGGGRVYEQFPKAQKLYLTHIDAEVEGDTHFP
2cvfA           QVHFDSRTEMTKPVAEQTLGYRCKDILRLLPKPGLRVAVLERHRFRPEGLMAYFRITERGIE--------
3dfoD           IVAPGKGILAANESTGIAKRLQSIGTENTEENRRFYRQLLLTADDRNPCIGGVILFHETLYQKADGRPQV
2a2zB           SLELDGIIYLQATPETGRNEEQGIPLEYLEKLHYKHWLLHRTLKTNFDYLEVPILTLDVNEDFKD-KYES
3dftD           IVAPGKGILAASESTGIAKRLQSIGTENTEENRRFYRQLLLTADDRNPCIGGVILFHETLYQKADGRPQV
3dfpD           IVAPGKGILAANESTGIAKRLQSIGTENTEENRRFYRQLLLTADDRNPCIGGVILFHETLYQKADGRPQV
1ek0A           LAEEKGLLFFE--TSAKTGENVNDVFLGIGEKIPL-----------------------------------
3cnlA           FFTKAGRVSFERPED-------------------------------------------------------
2bhvD           ITPHGINIMLTNGYNGLVGELIERNFQRYGVPLDYLLMQLMNQILRDKSKIAPIVVIREGSRVFISPNTD
2bhvA           ITPHGINIMLTNAYNGLVGELIERNFQRYGVPLDYLLMQLMRQSGMGINKIAPIVVIREGSRVFISPNTD
2c7cH           ELESPFILLADKKISNIREMLPVLEAVAKAGKPLLAEDVEGEALATLVNTMRGIVKVAAVKAPGFGDRRK
1e9sL           TFDDLRGFLEGAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSIRSWLEDPNGGNLFITWREDM
6aldA           IVAPGKGILAADESGSIAKRLQSIGTENTEENRRFYRQLLLTADDRNPCIGGVILFHETLYQKADGRPQV
3d1mB           LTPNPDIIFKDEENTGADRLMTQRCKDKLVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDR
3dlbB           VADPK---DPRKPIPHLTGLLVPVGSLALSLPWEERRTREIASWIGRRGLGTPEAVRAQAYRLSIPKLMG
1cjaA           ISMQEGFLATVRECASFDLDAQESLQKCHNLSISPQAIPFILRMLRIF----------------------
1culC           IKQ------DDYVPSDQDLLRCRVLTSGIF----------------------------------------
1aldA           IVAPGKGILAADESTGSIKRLQSIGTENTEENRRFYRQLLLTADDRNPCIGGVILFHETLYQKADGRPQV
2bnlC           ----------------------------------------------------------------------
3dfnA           IVAPGKGILAANESTGSIKRLQSIGTENTEENRRFYRQLLLTADDRNPCIGGVILFHETLYQKADDGRQV
2aumB           AFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFADISVLLSA----FHRHGLPAIHGPVAT
2bwjA           LQMSRSSLPVDDTTKTIAKRLEAYYRIPVIAYYETKTQLHNAEGTPEDVFLQLCTAIDSI----------
1e9sE           MRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKL--------------------
3dfnD           IVAPGKGILAANESTGSAKRLQSIGTENTEENRRFYRQLLLTADDRVNPIGGVILFHETLYQKADDGRQV
3dfpC           IVAPGKGILAANESTGSAKRLQSIGTENTEENRRFYRQLLLTADDRVNPIGGVILFHETLYQKAD-----
3dftC           IVAPGKGILAASESTGSIKRLQSIGTENTEENRRFYRQLLLTADDRNPCIGGVILFHETLYQKADGRPQV
3czjA           RWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHKTLFISRKTYRIGSGQMAITVDVEVASDTPHPAR
1adoA           IVAPGKGILAADESTGSAKRLQSIGTENTEENRRFYRQLLLTADDRVNPIGGVILFHETLYQKADDGRQV
1e9rF           LFHWTTIATFDDLRGFLEGT--------------------------------------------------
1e2iB           LIFDRHPIAALLCYPAARYLMGSMTPQAVL-AFVALIPPTLPGTNIVLGALPEDRHIDRLAKRERLDLAM
1e9rD           LLRETAKKLALIGTPSMRELFHWTTIATFD-DLRGFAESLFAGSNEASALTSARFVLSDKLPEHVTMPDG
2dftA           LYRRVATMRVDTNRRNPGAVVRHILSR-------------------------------------------
3dfqD           IVAPGKGILAASESTGSIKRLQSIGTENTEENRRFYRQLLLTADDRNPCIGGVILFHETLYQKADGRPQV
3cqcA           --VREDAKEDHERTHQMVLLRKLCLPMLCF---LLHTILHSTGQYQECLQLADMVSSERHKLYLVFSKEE
1eamA           PFPDQWIKDFYIPHGNKMLQPFAPSYSAELSIYTGENMRLTRVTKSDAVNAKKMYYLNKIVRNKVVVNFD
1draA           LPGRKNIILSSQPGTDDRVTWVKSVDEAIAGDVPEIMVIGGGRVYEQFPKAQKLYLTHIDAEVEGDTHFP
1ckvA           ----------------------------------------------------------------------
2bhjA           CIGRIQWSNLQVFDARNCSTAQEMFQHICRLYATNNGNIRSAITVFPQRSGKHDFRLWNSQLIRYAGYQM
3cmtD           LKFYASVRLDIRRIGAVKEGENVVGSETR---VKVVKNKIAAPKQAEFQILYGEGINFYGELVDLGVKEK
1b0uA           LAMEPDVLLFDEPTSALDPELGEVLRIMQQLAEEGKTMVVVTHEMGFAHVSSHVIFLHQGKIEEEGDPEQ
2dpyA           VFAKLPALVERAGNGIHGGGSITAFY----------TVLTEGDDQQDPIADSARAILD------------
2awnA           ---------MRIEISRLHKRLGRTMIYVTH---DQVEAMTLADK---------IVVLDAGRVAQVGKPLE
2bjbA           LPSAPHIAMTAAMLRQAGVDDSTPNRWQVRPGPVAARRWDIEPDLTNAVAFLSAAVVSGGTVRITGWPRV
1e9sI           LLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLTLAESLFAGSNEASKALRFVLSDKLPEHVTM---
1e4vA           IVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEEHQMTAPLIGYYSKEAAGNTKYAKVDGTKPVAEVRAEK
2a1fD           LLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEGVEVSVVLGGGNLFRGKLAKAGMNRVVGDHMGMLAT
1akeA           VGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTMTAPLIGYYSKEAAGNTKYAKVDGTKPVAEVRAD-
2b0lC           HMSKAVVQMAISSLSYSELEAIEHIFEELDGNEGLLVASKIAVIVNALRKLESAGVIESRSLGMKGTYIK
3dymA           VWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHKTLFISRKTYRIDGSGQMAITVDVEVASDTPHPA
1cs4C           ----------------------------------------------------------------------
1dyhA           LPGRKNIILSSQPGTDDRVTWVKSVDEAICGDVPEIMVIGGGRVYEQFPKAQKLYLTHIDAEVEGDTHFP
3dfoC           IVAPGKGILAANESTGSAKRLQSIGTENTEENRRFYRQLLLTADDRVNCIGGVILFHETLYQKADDGRQV
2ancF           LRMSRQKQRHDALISKLLA---------------------------------------------------
3be4A           YHVKYNPPKQPGIDDVTGEPLVWRDDDNAEKVRLDVFHKQTAPLVKFYDLGILKRVNAKLPPKE------
2bbtA           VYKDADLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSE
1d8jA           LVNNPKIEVIDGKYAFKPKYNV------------------------------------------------
2dftC           LYRRVATMRVDTNRRNPGAVVRHILSR-------------------------------------------
1d6aA           ----------------------------------------------------------------------
3bk7A           LLRDADIYLLDEPSAYLDVEQRLAVSRAIRHEKNEKTALVVEHDVLMIDYVSDRLIVFEGEPGRHG---R
3dyoA           RWKAAGHYQAEAALLQCTADTLADAVLITTAWQHQGKTLFISRKTYRIDGGQMAITVDVEVASDTPHPAR
3bv4A           IVAPGKGILAADESTGSIAKRQSIGTENTEENRRFYRQLLLTADDRVNCIGGVILFHETLYQKADDGRQV
3brwA           STN-EESPAFVEFLEFLGQKVKLQDFKGFRGGLDVTESVYCNFRNKEITEGDAQQLQRKRHIGNDIVAVV
1drbA           LPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPMVIGGGRVYEQFPKAQKLYLTHIDAEVEGDTHFP
2bv7A           LYAAPYKSDFLKALSKGQNVTEEECLEKVRLFLVNTATIDVIYEMYTRMNAELN----------------
2e85A           RELRPRLLIVDATDMGLNPGEIRIIDPDDIA----EMFMMTTHNMPLNYLEDIGEVIFLGIQPDIVGFYY
3cnnA           FFTKAGRVSFERPE--------------------------------------------------------
3a00B           IPELNARFLFIAPPSGAH--DKVIVNDDLDKAYKELKDFIFAEK--------------------------
2anbA           FILPPSKIELDRRLRGRGQDSEMAQAVAEMSHYAEYDYLIVNDDFDTATDLKTIIRAERLRMSRQKQRHD
1e9sM           LFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHPDGDFSIRSWLEDPNGGNLF
3dfqC           IVAPGKGILAASESTGSIAKRQSIGTENTEENRRFYRQLLLTADDRVNCIGGVILFHETLYQKADDGRQV
4dfrA           LPGRKNIILSSQPGTDDRVTWVKSVDEAICGDVPEIMVIGGGRVYEQFPKAQKLYLTHIDAEVEGDTHFP
4atjA           DSLQLANANLPAPFFTLPQLKDSFRNVGRSSDLVALSGGHTFGKNQCRFIMDRLYNFSNTGLPDPTLNTT
2e85B           ELRPTRLLIVDATDMGLNPGEIRIID----PDDIAEMFMMTTHNMPLNYLIDQLKVIFLGIQPDIVGFYY
2czvB           EKYKVRRFLTSSAQEKWDVRYPRDLISL----GVVIEIPQAKASISMY----------------------
3cmwC           LAGNLK----QSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS---
1ckeA           FRELPVVFPDAPVKIFLDASSEERAHRRMLQLQVKGNFERLLAEIKLVPAADALVLDSTTLSIEQ-VIEK
3crmA           IAPEQRQVLHARIAQRFRQMLEQGFIAEVEALHALHAGLPSIRAVGYRQVWDYLDGKLSYAEMTERGIIA
2awoD           FIGSPKMNFLPVKVTATAIDQVQVELPMPN-----RQQVWLPVESRDVVGANMSLGIRPEHLLPSDIADV
3cueF           KEFADANKMPFLETSALDSTNVEDAFLTM-----------------------------------------
2a1fE           LLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMVEVSVVLGGGNLFGAKLAKAGMNRVVGDHMGMLAT
1cfrA           RREELKSMLKDISFSNISLSTISEIDKNFIDYAEL-EHIKSFLSVKTTFR--------------------
2ccjA           LNEFAINGLYPDLTIYLNVSAEVGRERIIKNSNREDLKFHEKVIEGYQEIIHRFKSVNADQPLENVVEDT
1dekB           DE-GKESVNFVAFNKITDVINNIEDQWSVRRLMQALDLIVNNFDRMYVKLFALDYLDKFNSGYDYYIVPD
1e9sH           TFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSIWLEDPNGGNLFITWREDM
2b8tD           ITKLTAICNECGAEATHSLRKIDGKHADYNDD-----IVKIGCQEFYSAVCRHHHKVPNRPYLNSNSEEF
3cm0A           ELEGRSD-DNEETVRRRLEVYREKTEP-LVGYYEVLKRVDGLGTPDEV----------------------
1e2lA           FVALIPPTLPGTNIVLGALPEDRHLAKRQRPGERLDLAMLAAIRRVYGLLANTVRYLQCGGSWREDWGQL
2boeX           AGKIPILVVSNAPGRDCGGSAYRSWIDEFAAGLKNRYIIVEPDLISLMSSMQHVQQEVLETMAYAG----
2cbzA           NADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQE
1cjtC           ----------------------------------------------------------------------
1e2jA           FVALIPPTLPGTNIVLGALPEDRHLAKRQRPGERLDLAMLAAIRRVYGLLANTVRYLQCGGSWREDWGQL
2bboA           FGYLDVLTE------------KEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSE
2d7vA           ----------------------------------------------------------------------
1c9kC           CQRCPAKVVLVTNEVGMGIVPENRLARHFR-DIAGR----VNQRLAAA--ADEVWLVVSGIGVK------
3do6A           ----------------------------------------------------------------------
2ancD           FILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMDYLIVNDDFDTATDLKTIIRAERLRMSRQKQRHD
1e2mB           AVLAFVALIPPTLPGTNIVLGALPEDRHID-RLAKNTVRYLQCGGSWREDWGQLSGPQSNAGPRPHIGDT
2d7vB           ----------------------------------------------------------------------
1dp0A           RWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHKTLFISRKTYRIDGGQMAITVDVEVASDTPHPAR
1e2nA           RYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALEDRHIDRLAKRQRPGERLDLVRYLQCGGSWREDWGQL
3c15C           ----------------------------------------------------------------------
2an9A           FILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMDYLIVNDDFDTALTLKTIIRAERLRMSRQKQRHD
2a1fC           ---LSGEALQGEDGLGIDPAILDRMAVEIELVEMGVEVSVVLGGGNLFRAKLAKAGMNRVVGDHMGMLAT
2d4uB           GKINE---FFDQPTQGYQGFEKQYVA--------------------------------------------
1e2nB           PQAVLAFVIPPTLPGTNIVLGALPEDRHIDRLAKLDLAMLAAIRRVYGLLANTVRYLQCGGSWREDWGQL
1bccF           LEPYLKEVI-------------------------------------------------------------
1e2kB           LIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGT---------------------------
3cmuA           AMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRL--------------------
3bwdD           LKKLIGAPAYIECSSKSQENVKGVFDAAI-----------------------------------------
3e70C           IARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQ
1e9sA           LFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHRSWLEDPNGGNLFITWREDM
1e2hA           LIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAAIRRVYGLLANTVRYLQCGGSWREDWGQL
3dmdA           ----------------------------------------LTKLDADAGGAALSISYVIDAPILFVGVGQ
2ancB           FILPPSKIELDRRLRGRGQDSRMAQAVAEMSHYAEYDYLIVNDDFDTALDLKTIIRAERLRMSRQQRHDA
1chdA           LLSSEKLIAIGASTGGTEAIRHVLQPLPLSS----PAVIITQHMPPGFSFAERLNKLCQISVKEAEDGER
3b85B           LGFGSKVVTGDSGLRLVRHILRGVDDVHFSELTSSDRHQLVGHIVDAYE---------------------
3bjqB           -----DPILSTHARGYRQSTLIGKKLFPVAPAQYGGKILTFGKEAFRLYNTKRIDFGYEGDPYSIVPSAL
3cphA           EALAKELGIPFIESSAKNDDNNEIFFTLAKLIQEKIDSNKLVGVGN------------------------
2b0lB           ---KAVVQMAISSLSYSELEAIEHIFEELDGNEGLLVASKISVIVNALRKLESAGVIESRSLGMKGTYIK
3c14C           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
2c5mD           IKIDP-YINIDAGLTKDNNLTTGKIYQYVINKERKGTVQVVPHITDAIEWVMRQALEPQVCVIELGGTVG
2ax4A           GIDSDPERVLK--TNLSTVSD---CVHQVVELLQEQNIV-------------------------------
1cjvC           ----------------------------------------------------------------------
2cdnA           LKGRGRADDTDDVILNRMKVYRDETAPLLEYY--RDQLKTVDAVGTMDEFARALRALGK-----------
2bhvC           ITPHGINIMLTNAYNGLVGELIERNFQRYGV----------PLLLSTLTNGLLIGITGDYLLMQLMRQSG
1azsC           ----------------------------------------------------------------------
2c95B           LKRGETSGRVDDNEETIKKRLE---------TYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQ-----
2ax4B           GIDSDPERVLK--TNLSTVSD---CVHQVVELLQEQNIV-------------------------------
2c9gA           ----------------------------------------------------------------------
1e2mA           PIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAA
3e8aC           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1delA           INNIEDQWSVRRLMQALGTDLIVNNF-----DRMYWVKLFALDYLDKFNSGYDYYIVPDTRQDHE--MDA
2c9oA           SGAVKRQGRCDTYATEFDLEAEEYVPLPKGHKKKEIIQDVTLHDLDVANGINKVVNKYIDQGIAELVP--
1e2lB           LCYPAARYLMGSMTPQAVLAFVALIPPTLPGTN---IVLGALPEDRHIDRLAKRLDLAMLAAIRRVYGL-
2aexA           ---EDELAHRCSSFMAPPVTDLGELRRRPGDETQAQALAQVDGGANFSVDGGISCVLQDGCVFEKAGVSI
3c7kA           ----------------------------------------------------------------------
3cbqA           RHLAGTLSCKHIETSAALHHNTRELFEGAVRQIRLR----------------------------------
2bwjB           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
3bs4A           MSGYLEVFTPEETLRYLETSAEVRYGHPAYKKYPRGTNFWLWEGVKDKRVLLSVYRRADYVLKTRS----
2bwjD           ----------------------------------------------------------------------
3cr8B           QQCELE-MLMTGAYSPLTGRVESAQQLDDGSFWPSPITLTSRDRADRRPGERLALRDGEGYMLAILTLSD
2bwjF           ----------------------------------------------------------------------
3cddB           LAKQRGVLLTSDTFGNLVITRASKTKAGVS-LILGDNVKAARGRFSWRQRFSKFTIKGGIKADVTDSEIG
3c94A           ---QSTFLFHDYETFGTHPALDRPAQFAAIRTDSEFNVIGEPEVFYCKPADDYLPQPGAVLI--TGITPQ
2a5vB           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
2dx7A           EQKDVMRGIYEGVKAGNLKLGRELLLKTAKILEERGIIAGCTEVSVVLKQDDLVPLIDPMDVIAEVAVKV
1e6vC           IPDEDIVRLMGHREPGEEYP--------------------------------------------------
2bwjC           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
2a78A           KNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRAR----------------------------------
1dmaB           FLEAAQSIVFGGVR---ARSQDLD-AIWRGFYIAGDPALAYGYAQIRNGALLRVYVP--RSSLPGFYRTS
1e9sK           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
3cddE           LAKQRGVLLTSDTFGNLVITRASKTKAG-VSLILGDNVKAARGRFSWRQRFSKFTIKDVTD---------
2axnA           ----------------------------------------------------------------------
3dvlD           ----TSVFQQYDASSVVRRELFRLVARL---KQIGATTVMTTERIEEYG------PIARYGVEEFVSDNV
2axzA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           LLAQGGLYAKLVQRQMLGLQPAADFTAGHNEPVANGSHKA
3b60A           LLAQHGVYAQLHKMQ-FG----------------------
3b5jA           LLSEESLYSYLYQLQ-------------------------
3dmdC           GYDDRPFEKEWFLERIFG----------------------
3dm5A           KIDDEPFDPPRFVSRLLG----------------------
3eiuA           MYAGYAEGRDLRGLVAIVGKEALS----------------
3dt2A           RPFFGYNFGKYLAHWL------------------------
2c03B           KPEGEPFYPERLAGRILG----------------------
3dtbB           PFFGYGKYLAHWLSMAHRPAAKLPKIFHVNWFRKDKNGKF
1dkiA           WGWGGGFFRLDALYQVVGIKP-------------------
3dmdB           GYDDRPFEKEWFLERIFG----------------------
2akaB           VVNRSQKDIDGKKDI-------------------------
1accA           DFKKYNDKLPL-----------------------------
2d3wB           VKQLEQGYGWLTE---------------------------
2c61B           MYAGYAEGRDLRGLVAIV----------------------
1e69A           ----------------------------------------
2dwoA           LSLIKVIDVGRRFLVN------------------------
3cmvH           LGVKEKLIEKAGAWY-------------------------
2c03A           PEGLEPFYPERLAGRILGM---------------------
1e9cA           RVLSEDAIATATEKP-------------------------
3dt4C           RPFFGYNFGKYLAHW-------------------------
3bb1A           IT--------------------------------------
3dt7A           RPFFGYNFGKYLAHWL------------------------
4dcgA           TFPTKAKVLFLQQSIF------------------------
3dt4A           RPFFGYNFGKYLAHWL------------------------
3b2qA           ----------------------------------------
3cmvG           FYGELVDLGVKEKLI-------------------------
2dwpA           LSLIKVIDVGRRFLVN------------------------
2c04A           PEGLEPFYPERLAGRILG----------------------
2b8tA           FIK-------------------------------------
2c61A           GIYPPINVLPSLSRLM------------------------
2cjwB           ----------------------------------------
3eiuB           MYAGYAEGRDLRGLVAIV----------------------
2ccjB           TYQ---TIIKYLEK--------------------------
3c95A           ----------------------------------------
2ccgA           LENVVEDTYQTIIKYL------------------------
1d1cA           VLKDKTALNAASTVFG------------------------
2ccgB           TYQ---TIIKYLEK--------------------------
1e98A           RVLSEDAIRTATEKP-------------------------
1e9fA           LW--------------------------------------
3cmvA           FYGELVDLGVKEKLI-------------------------
3cmvC           LGVKEKLIEKAGAWY-------------------------
2ahvA           ----------------------------------------
3cddF           LFSDAGRLAVISVVR-------------------------
1e2dA           RVLSEDAIATATEKP-------------------------
2bbsA           LQNLRPDFSSKLMSF-------------------------
1bifA           IKIMDVGQSYVVNRVA------------------------
3czpB           ----------------------------------------
2b8wA           FVQQVADFCSYIFSNSKTKTLSGGIQV-------------
3b2qB           MYAGYAEGRDLRGLVAIV----------------------
3ec1A           LVVHAPKGVDVFIRQSL-----------------------
2c9yA           IDASQTPFASILA---------------------------
2dr3A           IVWKRGTSHSMRRHPF------------------------
2c9oC           ALNHLGEIGTKTTLRYSVLTPANLLAKINGKDS-------
2czvA           ----------------------------------------
1e9dA           RVLSEDAIATATEKP-------------------------
2bifA           RDLSYIKIMDVGQSYV------------------------
2bofX           WHSPAQMASWLQQAD-------------------------
2ahwD           KKAT------------------------------------
2a5gA           ----------------------------------------
3da4A           ----------------------------------------
2dr3E           IVWK------------------------------------
3bb1B           ----------------------------------------
2awnB           LYHYPADRFVAGFIGS------------------------
2axzC           IGKE------------------------------------
3d7wA           VIASLAIM--------------------------------
3di4A           VNGYDRSHGR------------------------------
2cgtH           AMLQDIATLTG-----------------------------
1e9sG           G---------------------------------------
3a1wA           ----------------------------------------
3bgwA           EFLYRDDYY----DKESESKNIVEVIIAKHRDGPVGT---
1e1qB           ----------------------------------------
1dg3A           YIFSNSKTKTLSGGIQVNGPRLESLVLTY-----------
1e9sF           ----------------------------------------
3b85A           ----------------------------------------
2awnD           ILEG------------------------------------
3bb1E           ITEVANKSESIFVDK-------------------------
3ed8A           ----------------------------------------
2c4rL           V---------------------------------------
3bb1H           VLPNGIAWIPHLVQTITEVALNKS----------------
3bh0A           EFLYRDDYY----DKESESKNIVEVIIAKHRDGPVGT---
1cr4A           RFTDTGIAGYMEYNKETGLEPSS-----------------
1e4yA           EYHQMTAP--------------------------------
2axpA           ----------------------------------------
2cckA           ----------------------------------------
2d62A           VYYKVNTFVAGFIGSPPNFLDAT-----------------
1e3mB           FHS----VQDGAASKSYGLAVA------------------
2ctsA           ----------------------------------------
2b92B           L---------------------------------------
1e2fA           VLATEKPLGELWK---------------------------
1e3mA           FHSVDGAASKSYGLAVAALAGVPKE---------------
2bkhA           VAGVLHLGNIDFEEA-------------------------
3cr7C           ----------------------------------------
2eg5G           ----------------------------------------
3bb1F           ITELNKSESIFVDKNLI-----------------------
2a2zD           LVEK------------------------------------
2a2zA           ----------------------------------------
1aroP           IRDLEAKHFKKFMQVV------------------------
1e9rA           ----------------------------------------
2bc9A           CFVF------------------------------------
3czpA           ----------------------------------------
1e9sD           ----------------------------------------
2dr3B           GELK------------------------------------
421pA           ----------------------------------------
2d3wC           VKQLEQGYGWL-----------------------------
3bpbA           REKIARLGYRVIEVDT------------------------
2ck3C           QAGDVSAYIPTNVISITDGQIFLET---------------
1e0jB           VRILKCRFTGDT----------------------------
2d0kA           DYEPDDW--ESVFSEFHDAD--------------------
3bb1C           ITELNKSESIFVDKNLI-----------------------
2b8tB           FIK-------------------------------------
3dm5B           KIDDEPFDPPRFVSRLLG----------------------
3cddD           ----------------------------------------
3dm9B           YDDLRPFEKEWFLERIFG----------------------
3bm2B           VPDPTPFVTYF-----------------------------
1dhjA           DYEPDDW--ESVSSEFHDAD--------------------
2d4hA           E---------------------------------------
2awnC           LYHYPADR--------------------------------
3cddC           ADVT------------------------------------
2akaA           VLKDKTAL--------------------------------
3bb1D           ----------------------------------------
1e0jA           VRILKCRFTGDT----------------------------
2dr3C           IVWKRGTSHSMRRHPFDITDK-------------------
3bjdB           LLAKLLEAIGLEADFQAVSTPEEIAYLNNRARAFRHAEVG
2aumA           GLG-------------------------------------
2bbsB           LQNLRDSFDQFSAERRNSILTE------------------
3d3kA           ----------------------------------------
1bmfC           QAGDVSAYIPT-----------------------------
2d4hB           AISSGDL---------------------------------
1e6cA           ----------------------------------------
1dvrA           VDASQ-----------------------------------
2awoC           LYHYPADR--------------------------------
2d3wD           VKQLEQGYGWL-----------------------------
3bb1G           ITELNKSESIFVDKNLI-----------------------
3cbnA           ----------------------------------------
3dhwC           VFSHPK----------------------------------
1e3aB           LYEA------------------------------------
3bgwD           EFLYRDDYYDKESES----KNIVEVIIAKHRDGPVGT---
3adkA           ----------------------------------------
2ausC           VYYIEILEIDGRDVLF------------------------
1e2gA           LW--------------------------------------
2a30A           FLST------------------------------------
2a5jA           ----------------------------------------
2b8wB           RRKLAQLEKLQDEEL-------------------------
3ch4B           ----------------------------------------
3c8uA           L---------------------------------------
2a30D           ----------------------------------------
1e9sJ           D---------------------------------------
1bg0A           G---------------------------------------
1d2zD           ----------------------------------------
3cioD           ----------------------------------------
2dflA           ----------------------------------------
2d2eA           ALELEAKGYEWLKEK-------------------------
3dffA           VRLWEDLPYAVFKSGAVELPQG------------------
2c0bL           R---------------------------------------
1e2kA           LAAIRRVYGLLANTVR------------------------
2bx2L           TPVR---HQRAVENRLRE-AVRQDRARIQ-----------
1ai4B           LYEAVQGDKSPIPQAVDLFAGK------------------
2bbtB           LQNLRPDFSSKLMDSFDQFSA-------------------
3cr7D           ----------------------------------------
2bkeA           HLPEGEVVFALTEEGI------------------------
1cr0A           RFGDTGIAGYMEYNKETGWLEPSSY---------------
1cr1A           RFT-------------------------------------
3cr7A           ----------------------------------------
1afrA           ----------------------------------------
2b8tC           FI--------------------------------------
3bo6B           ----------------------------------------
2dr3F           IVWK------------------------------------
2bnlB           ----------------------------------------
3a00A           ----------------------------------------
3d3qA           QGFEASQSQAIGYKELVPVIKGNISENAVEKLKQHSRQYA
1d6jA           ----------------------------------------
1e9rE           ----------------------------------------
3ecpA           DADEKESGKWLAAAAT------------------------
2dr3D           GELKRSLI--------------------------------
3bczC           FSNYLKKYHNTICGRH------------------------
2awoA           LYHYPADR--------------------------------
2d2fA           ALELEAKGYEWLKEKV------------------------
1ak2A           PDVVFASILAAFSKAT------------------------
3cmxA           LIEKGAWYSYKGEKIGQGKANATAWLKDNPETAK------
2cckB           ----------------------------------------
5dfrA           DYEPDDWESVFSEF--------------------------
2d3wA           VKQLEQGYGWL-----------------------------
1e2iA           LLAPNGDLYNVFAWALDVL---------------------
3b9qA           AVEDQPFDPEAFVNAIF-----------------------
2a30B           ----------------------------------------
1e9rG           GPALRPLISAWVDVVC------------------------
3dauA           DYEPDDW--ESVFSEFHDAD--------------------
1d6jB           ----------------------------------------
1dhiA           DY--------------------------------------
3cmvB           FYGELVDLGVKEKLI-------------------------
1cr2A           ----------------------------------------
3d31A           ----------------------------------------
2d4uA           ----------------------------------------
3dfnC           ----GRPFPQVIK---------------------------
3cmvE           LGVKEKLIEKAGAWYS------------------------
3cd9A           ----------------------------------------
3clvA           ----------------------------------------
1e9sB           ----------------------------------------
2bdtA           ----------------------------------------
2a1fF           VMNGLAMRD---SLFRADVNAKLMSAFQLNGI--------
1av6A           FL--------------------------------------
1bglA           IGLNCQLAQVAERVN-------------------------
1e59A           VPLVYEFDENFKPLKRYYLGNADE----------------
3dfdA           ----------------------------------------
2dpyB           ----------------------------------------
3d3qB           ------QGFEASQSQAIGYKELVPVIKG------------
2bkiA           ----------------------------------------
3b55A           VFKTKELDLLDWIRQYNANPKH------------------
1eilA           IYYGPAEIFHEPFLP-------------------------
2aunA           RLA-------------------------------------
1dekA           QKSN------------------------------------
3cr7B           ----------------------------------------
2aunB           GLEQQERLASLASVSRLLAGIDHELPVQHLGGHKQRVEG-
1e2hB           SGPQ------------------------------------
3c85A           ----------------------------------------
3dfqA           IKSKGGVVGIKVDK---GVVPLAGT---NGETTTQG----
2bnlA           ----------------------------------------
3d1mA           DRSKYGMLARLAVEAGFDWVYYESKAHIH-----------
2drcA           DY--------------------------------------
2cvfA           ----------------------------------------
3dfoD           IKSKGGVVGIKVDKGVVPL---------------------
2a2zB           LVE-------------------------------------
3dftD           IKSKGGVVGIKVDKGVVPL---------------------
3dfpD           IKSKGGVVGIKVDKGVVPL---------------------
1ek0A           ----------------------------------------
3cnlA           ----------------------------------------
2bhvD           IFFPIPRENEVIA---------------------------
2bhvA           I---------------------------------------
2c7cH           A---------------------------------------
1e9sL           GPALRPLISAWVDVVCTSILSLPEE---------------
6aldA           IKSKGGVVGIKVDK---GVVPLAGT---NGETTTQG----
3d1mB           DRSKYGMLARLAVEAGFDWVYYESKAHIH-CSV-------
3dlbB           ----------------------------------------
1cjaA           ----------------------------------------
1culC           ----------------------------------------
1aldA           IKSKGGVVGIKVDK---GVVPLAGT---------------
2bnlC           ----------------------------------------
3dfnA           IKSKGGVVGIKVDK---GVVPLAGT---------------
2aumB           GLG-------------------------------------
2bwjA           ----------------------------------------
1e9sE           ----------------------------------------
3dfnD           IKSKGGVVGIKVDK---GVVPLAGT---------------
3dfpC           ---DGRPFPQVIK---------------------------
3dftC           IKSKGGVVGIKVDKGVVPL---------------------
3czjA           IGLNCQLAQVAERVNWLGLGPQENY---------------
1adoA           IKSKGGVVGIKVDK---GVVPLAGTN---GETTTQGLD--
1e9rF           ----------------------------------------
1e2iB           LAAIRRVYGLLANTVRY-LQCGGSWREDWGQ---------
1e9rD           DFSI------------------------------------
2dftA           ----------------------------------------
3dfqD           IKSKGGVVGIKVDKGVVPL---------------------
3cqcA           L---------------------------------------
1eamA           YP--------------------------------------
1draA           DY--------------------------------------
1ckvA           ----------------------------------------
2bhjA           PDG-------------------------------------
3cmtD           L---------------------------------------
1b0uA           VFGNPQRLQQFLKGS-------------------------
2dpyA           ----------------------------------------
2awnA           LYHYPADR---FVAGFIGSPKMNFLPVKVTAT--------
2bjbA           SV--------------------------------------
1e9sI           ----------------------------------------
1e4vA           ILG-------------------------------------
2a1fD           VMN-----GLAMRDSLFRADVNAKLMSAF-----------
1akeA           ----------------------------------------
2b0lC           VLNNKFLI--------------------------------
3dymA           RIGLNCQLAQVAERVN------------------------
1cs4C           ----------------------------------------
1dyhA           DYEPDDW--ESVFSEFHDAD--------------------
3dfoC           IKSKGGVVGIKVDK---GVVPLAGTN---GETTTQGLD--
2ancF           ----------------------------------------
3be4A           ----------------------------------------
2bbtA           LQNL------------------------------------
1d8jA           ----------------------------------------
2dftC           ----------------------------------------
1d6aA           ----------------------------------------
3bk7A           ALPPMGMREGMNRFLSVGITFRRDPDSGRPRANKEGSVK-
3dyoA           IGLNCQLAQVAERVNWLGLGPQENY---------------
3bv4A           IKSKGGVVGIKVDK---GVVPLAGT---------------
3brwA           FQDENTPFV----PDMIASNFLHAYVV-------------
1drbA           DYEPDDWESVFSEF--------------------------
2bv7A           ----------------------------------------
2e85A           PMTQ------------------------------------
3cnnA           ----------------------------------------
3a00B           ----------------------------------------
2anbA           ALIS------------------------------------
1e9sM           I---------------------------------------
3dfqC           IKSKGGVVGIKVDK---GVVPLAGTNG---ETTTQGLD--
4dfrA           DYEPDDW--ESVFSEFHDAD--------------------
4atjA           YLQTLRGL--------------------------------
2e85B           PMTQ------------------------------------
2czvB           ----------------------------------------
3cmwC           ----------------------------------------
1ckeA           ALQ-------------------------------------
3crmA           TR--------------------------------------
2awoD           ----------------------------------------
3cueF           ----------------------------------------
2a1fE           VMNGLAMRDSLFRAD-------------------------
1cfrA           ----------------------------------------
2ccjA           Y---------------------------------------
1dekB           T---------------------------------------
1e9sH           GPALRPLISAWVDVVCTSILSLPE----------------
2b8tD           IKF-------------------------------------
3cm0A           ----------------------------------------
1e2lA           SGPRPHIGDTLFT---------------------------
2boeX           ----------------------------------------
2cbzA           LLARDGAFAEFLRTYA------------------------
1cjtC           ----------------------------------------
1e2jA           SGPRPHIGDTLFT---------------------------
2bboA           LQNLQPDFSSKLMSFDQFSAERRNSILTETLRRF------
2d7vA           ----------------------------------------
1c9kC           ----------------------------------------
3do6A           ----------------------------------------
2ancD           ALIS------------------------------------
1e2mB           LFT-------------------------------------
2d7vB           ----------------------------------------
1dp0A           IGLNCQLAQ-------------------------------
1e2nA           SGPRPHIGDTLFT---------------------------
3c15C           ----------------------------------------
2an9A           ALISKLL---------------------------------
2a1fC           VMNGLAMRDSLFRADV------------------------
2d4uB           ----------------------------------------
1e2nB           SGPQSNAGPRPHIGDTLFTLFRAPELLAPNG---------
1bccF           ----------------------------------------
1e2kB           ----------------------------------------
3cmuA           ----------------------------------------
3bwdD           ----------------------------------------
3e70C           GYDDRPFEKEWFLERIFG----------------------
1e9sA           GPALRPLISAWVDVVC------------------------
1e2hA           SGP-------------------------------------
3dmdA           GYDDRPFEKEWFLERIFG----------------------
2ancB           LISK------------------------------------
1chdA           VLPGHAYIAPGDKHMELARSGANYQIKIHDGPPVNRHR--
3b85B           ----------------------------------------
3bjqB           EAKV------------------------------------
3cphA           ----------------------------------------
2b0lB           VLNNKFL---------------------------------
3c14C           ----------------------------------------
1e9rB           ----------------------------------------
2c5mD           DIES--MPFIEAFRQFQFKVKRENFCNIHVSLV-------
2ax4A           ----------------------------------------
1cjvC           ----------------------------------------
2cdnA           ----------------------------------------
2bhvC           M--GINQVVNQILRDKSKIAP-------------------
1azsC           ----------------------------------------
2c95B           ----------------------------------------
2ax4B           ----------------------------------------
2c9gA           ----------------------------------------
1e2mA           I---------------------------------------
3e8aC           ----------------------------------------
1cjuC           ----------------------------------------
1delA           ARAMGATVIHVVRPGQK-----------------------
2c9oA           ----------------------------------------
1e2lB           ----------------------------------------
2aexA           S---------------------------------------
3c7kA           ----------------------------------------
3cbqA           ----------------------------------------
2bwjB           ----------------------------------------
2a5vA           ----------------------------------------
3bs4A           ----------------------------------------
2bwjD           ----------------------------------------
3cr8B           VWKD------------------------------------
2bwjF           ----------------------------------------
3cddB           RYR-------------------------------------
3c94A           EARAKGENEAAFAARIH-----------------------
2a5vB           ----------------------------------------
1delB           ----------------------------------------
1e2jB           ----------------------------------------
2dx7A           ALEK------------------------------------
1e6vC           ----------------------------------------
2bwjC           ----------------------------------------
3dkvA           ----------------------------------------
2bwjE           ----------------------------------------
2c9oB           ----------------------------------------
2a78A           ----------------------------------------
1dmaB           LTLAAPEAAGEVERL-------------------------
1e9sK           ----------------------------------------
1dapA           ----------------------------------------
3cddE           ----------------------------------------
2axnA           ----------------------------------------
3dvlD           VILRNVLEGERRRRTL------------------------
2axzA           ----------------------------------------