[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for huge0:KIAA0059

[Show Plain Result]


## Summary of Sequence Search
    1::724
    1::53      3e-11  48%   57 aa  PF00412 LIM "LIM domain"
    1::36      2e-08  56%   36 aa  PF02209 VHP "Villin headpiece domain"
    1::52      3e-08  47%   57 aa  PF00412 LIM "LIM domain"(query 104->155)
    1::49      6e-08  46%   57 aa  PF00412 LIM "LIM domain"(query 45->92)
    1::724

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxCHKCGEPCKGEVLRVQTKHFHIKCFT
PF00412         ----------------------------------------------------------------------
PF02209         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------
PF00412         --------------------------------------------CAGCGKPIEGEVVRALGKVWHPECFR


                         .         .         *         .         .         .         .:140
query           CKVCGCDLAQGGFFIKNGEYLCxxxxxxxxxxxCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPG
PF00412         ----------------------------------------------------------------------
PF02209         ----------------------------------------------------------------------
PF00412         ---------------------------------CAGCGKPIEGEVVRALGKVWHPECFRCSTCGKPLVDG
PF00412         CSTCGKPLVDGSFFEKDGKLYC------------------------------------------------


                         +         .         .         .         .         *         .:210
query           DRVTFNGRDCLCQLCxxxxxxxxxxxxxxxxCAGCGRDIKNGQALLALDKQWHLGCFKCKSCGKVLTGEY
PF00412         -------------------------------CAGCGKPIEGEEVVRALGKVWHPECFRCSTCGKLVDGSF
PF02209         ----------------------------------------------------------------------
PF00412         SFFEKDGK-LYCERC-------------------------------------------------------
PF00412         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ISKDGAPYCEKDYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00412         FEKDGKLYCERCY---------------------------------------------------------
PF02209         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00412         ----------------------------------------------------------------------
PF02209         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00412         ----------------------------------------------------------------------
PF02209         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00412         ----------------------------------------------------------------------
PF02209         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00412         ----------------------------------------------------------------------
PF02209         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00412         ----------------------------------------------------------------------
PF02209         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHLAPEVFREIFG
PF00412         ----------------------------------------------------------------------
PF02209         ----------------------------------------------------------YLSDEDFEEVFG
PF00412         ----------------------------------------------------------------------
PF00412         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           MSIQEFDRLPLWRRNDMKKKAKLF
PF00412         ------------------------
PF02209         MSREEFYKLPKWKQNNLKKKAGLF
PF00412         ------------------------
PF00412         ------------------------