[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for huge0:KIAA0113

[Show Plain Result]


## Summary of Sequence Search
    1::636
    6::176     5e-07  23%  668 aa  PF05557 MAD "Mitotic checkpoint protein"
  391::518     7e-06  24% 1179 aa  PF12128 DUF3584 "Protein of unknown function (DUF3584)"
   60::184     1e-05  33%  194 aa  PF04156 IncA "IncA protein"
  120::224     7e-05  33%  291 aa  PF01544 CorA "CorA-like Mg2+ transporter protein"
    1::91      2e-04  33%  181 aa  PF01017 STAT_alpha "STAT protein, all-alpha domain"
  152::296     2e-04  26%  631 aa  PF01496 V_ATPase_I "V-type ATPase 116kDa subunit family  "
   58::152     2e-04  32%  327 aa  PF04111 APG6 "Autophagy protein Apg6"
  137::247     4e-04  34%  325 aa  PF08317 Spc7 "Spc7 kinetochore protein"
  262::365     4e-04  31%  536 aa  PF02463 SMC_N "RecF/RecN/SMC N terminal domain"
   64::187     5e-04  22%  677 aa  PF05911 DUF869 "Plant protein of unknown function (DUF869)"
   12::141     5e-04  29%  311 aa  PF00038 Filament "Intermediate filament protein"
  327::421     5e-04  35%  582 aa  PF05622 HOOK "HOOK protein"
  306::486     6e-04  31%  528 aa  PF07111 HCR "Alpha helical coiled-coil rod protein (HCR)"
   45::177     6e-04  27%  194 aa  PF08614 ATG16 "Autophagy protein 16 (ATG16)"
   85::201     6e-04  24%  209 aa  PF08397 IMD "IRSp53/MIM homology domain"
   43::164     9e-04  28%  264 aa  PF06008 Laminin_I "Laminin Domain I"
   13::78      9e-04  30%  159 aa  PF06810 Phage_GP20 "Phage minor structural protein GP20"
    1::636

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05557         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------------------
PF04156         ----------------------------------------------------------------------
PF01544         ----------------------------------------------------------------------
PF01017         ----------------------------------------------------------------------
PF01496         ----------------------------------------------------------------------
PF04111         ----------------------------------------------------------------------
PF08317         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF05911         ----------------------------------------------------------------------
PF00038         ----------------------------------------------------------------------
PF05622         ----------------------------------------------------------------------
PF07111         ----------------------------------------------------------------------
PF08614         ----------------------------------------------------------------------
PF08397         ----------------------------------------------------------------------
PF06008         ----------------------------------------------------------------------
PF06810         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05557         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------------------
PF04156         ----------------------------------------------------------------------
PF01544         ----------------------------------------------------------------------
PF01017         ----------------------------------------------------------------------
PF01496         ----------------------------------------------------------------------
PF04111         ----------------------------------------------------------------------
PF08317         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF05911         ----------------------------------------------------------------------
PF00038         ----------------------------------------------------------------------
PF05622         ----------------------------------------------------------------------
PF07111         ----------------------------------------------------------------------
PF08614         ----------------------------------------------------------------------
PF08397         ----------------------------------------------------------------------
PF06008         ----------------------------------------------------------------------
PF06810         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05557         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------------------
PF04156         ----------------------------------------------------------------------
PF01544         ----------------------------------------------------------------------
PF01017         ----------------------------------------------------------------------
PF01496         ----------------------------------------------------------------------
PF04111         ----------------------------------------------------------------------
PF08317         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF05911         ----------------------------------------------------------------------
PF00038         ----------------------------------------------------------------------
PF05622         ----------------------------------------------------------------------
PF07111         ----------------------------------------------------------------------
PF08614         ----------------------------------------------------------------------
PF08397         ----------------------------------------------------------------------
PF06008         ----------------------------------------------------------------------
PF06810         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxASGRPGSPKMEGTGKKAVAGQ
PF05557         -------------------------------------------------SSLRKSSSKLELIELKAQLNQ
PF12128         ----------------------------------------------------------------------
PF04156         ----------------------------------------------------------------------
PF01544         ----------------------------------------------------------------------
PF01017         ----------------------------------------------------------------------
PF01496         ----------------------------------------------------------------------
PF04111         ----------------------------------------------------------------------
PF08317         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF05911         ----------------------------------------------------------------------
PF00038         ----------------------------------------------------------------------
PF05622         ----------------------------------------------------------------------
PF07111         ----------------------------------------------------------------------
PF08614         -------------------------------------------------------------TEKSDVPSR
PF08397         ----------------------------------------------------------------------
PF06008         ----------------------------------------------------------------------
PF06810         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           QQASVTAGKVPEVVALGAAEKKVKMLEQQRSELLEVNKQWDQHFRSMKQQYEQKITELRQKLADLQKQVT
PF05557         LEYELEQLKLEHERAQLELEKELRDLQERADADFKKNQELEARLKRLRKREEELEEELDEAQEELEQLKR
PF12128         --------------------------EERNKRREEIEKAYDALEEELRQQLEAQIAELSEQRNQLKLELA
PF04156         --------------------------------LLSKHRKLSEADRSLEQQEEQPLAQLRKELSQLQEWLA
PF01544         -------------------DRYLPVLEEIEDELDEIE---DELRDSDKNELLRRLLELRRELVRLRRSLA
PF01017         ---------------------------------------------SLQQELEQKLQDLRKSVQDLEQEIK
PF01496         -------------------KKSVFVVFFQGDQLKEKVKKICESFGASLYPLPESSGEPREMLAELNTRIE
PF04111         ----------PDIEEVEALLKELKKLEEEEEELL------------------QELEELEKEKAELDEELA
PF08317         -----------------------KMWYEWRMKLLEGLKEGDENLEELQEDYEL----LSKGLELLDELVP
PF02463         ------------------AEEELEELEEELAALAEEEEAAQEELLELKEK-----EELEEELAEELEE--
PF05911         --------------------------EEQEQRIHDAVLKKSREFEKIKMELEAKLAELSKELAKLAAENT
PF00038         ---------------LASYIEKVRFLEQQNKKLRELREKKGREVSRLKSLYEAELRDLRRQLDELTKEKA
PF05622         -------------------KKQVKELEEQNADLLQQKAMLEEQLRVQLEEYKREIQELEQKLSEEQLEKD
PF07111         ------------------------------------------------------LAQLRQESCPLPPPVT
PF08614         HSSSTSEAGKGKSSQGSELEEKLEKLQEELTELYKARSELSQQLVDLNQEKERRIAELEKELTQLREEIK
PF08397         -----------------------------------LEKKLEEDKKVVKAADKDYQKEYKKKRDELEKASS
PF06008         ---------------------------------------------------------LKSQLQDLEKALS
PF06810         -----------------------KDIENPKSKVEKVNEEYDNLKEQLKEA-DKQIEDLKKSVKDLQKQIE


                         .         .         .         .         *         .         .:420
query           DLEAEREQKQRDFDRKLLLAKSKIEMEETDKEQLTAEAKELRQKVKYLQDQLSPLTRQREYQEKEIQRLN
PF05557         KLEREKRRLQREKEQLLEEAREEQSQLKNELEELKREAQDLERQLKSLEEELEELKEQLEELQARLQEAE
PF12128         ELKLELDSVTYTEEEKEELAAARIERAQEEQEKAQAEVEQLKKEERKLRKKRDQAEEALQRAERELQELQ
PF04156         ELLKELEEQFRDFEERLLSLGREVEKLEEELRELRSR---LRKKLDRLQCEVDKLRKEVERLQTNLQRLQ
PF01544         PL--------RDVLQRLLRSSRKKWLSEEDRE--------------YLRDVLDHLERLLEMLESLRDRLS
PF01017         SL----EDLQELFDFQYQTLQSLHELEQNG----NALKEHLQQEQKMLQQMLNSLDQKRKELVDKLQKLL
PF01496         DLEKVLEATEEELEREL---EALAENLEEWREYLRKE-KAIYHTLNLFEVDVKTLIAEGWVPEKDLEKIR
PF04111         ELEEESEQL------------------DEEEEQYWREYNAFQLELIEFQDERDSLKNQYEHDQRQLERLK
PF08317         DLR-ERHEKLEEEIRNLQQLVDEIEL--CDQEEL----EELRQELSELEEEIEAKRKELEELQEELQKLN
PF02463         ELELELEEEELDLEEELLE-----ELEEEDKEEALKKEKELKEEREEL-GEVNLLAAEEELEEEE-----
PF05911         ALSKALQEKEKELSEEKSQAEAEIEALKARLESTEKENASLKYEVHVLSKELEIRNEEREFSRRSADAAH
PF00038         RLELEIDNLREEADD----LRAKYEEELALRQSLEAELNGLRKDLDEETLARVDLENKIESLKEELDFLK
PF05622         QLEFENH-----------ALTEKLESLEEEKERLLEERDELRERIEELE---------------------
PF07111         DLSLELQQERNRLDAELQLIQQEVEQGEAERQQLSEVAQQLEQELQQTQESLASLGLQLEVAR---QGQQ
PF08614         DLDEELEEKNKALEDELLSLQLQLNMLEEKLRKLEAENKEL-----------------------------
PF08397         ELKKLRKKSQKKNDQKYELKSAQAELEEFEKQSLKAALVEERRRYCFLVEKLCPVAKEEIAYHSEKELLQ
PF06008         SLEADAENLQEQANKAL----ANAQKLEEDSESTLGRAKDLEEDIKNLRDNIHELL-------EDLESLG
PF06810         DLQAKNKKAKEEYEAKL-----------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KALEEALSIQTPPSSPPTAFGSPEGAGALLRKQELVTQNELLKQQVKIFEEDFQRERSDRERMNXXXXXX
PF05557         EKLQSLQAAQ------------------------------------------------------------
PF12128         EQLDELEALLDP----------------------------------------------------------
PF04156         EKIEE-----------------------------------------------------------------
PF01544         SLLDLYLSL-------------------------------------------------------------
PF01017         NLLE------------------------------------------------------------------
PF01496         EALREALNVPETNETPPT----------------------------------------------------
PF04111         K---------------------------------------------------------------------
PF08317         QEIE------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF05911         KQHLESV---------------------------------------------------------------
PF00038         KNHEE-----------------------------------------------------------------
PF05622         ----------------------------------------------------------------------
PF07111         ESTEEAASLR----------------QELTQQQELYGQ--ALQEKVAEVETRLREQLSDTER-----RLN
PF08614         ----------------------------------------------------------------------
PF08397         QKLPD-----------------------------------------------------------------
PF06008         ENLEAA-----PSEDLDTALAEAQRMLEEIRERNFQKQREAAEQELDEAQELLER---------------
PF06810         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           XXXXXXXXAQVTLSNAQLKAFKDEEKAREALRQQKRKAKASGERxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05557         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------------------
PF04156         ----------------------------------------------------------------------
PF01544         ----------------------------------------------------------------------
PF01017         ----------------------------------------------------------------------
PF01496         ----------------------------------------------------------------------
PF04111         ----------------------------------------------------------------------
PF08317         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF05911         ----------------------------------------------------------------------
PF00038         ----------------------------------------------------------------------
PF05622         ----------------------------------------------------------------------
PF07111         EARREHAKAVVSLRQIQRQAAREKERNQELRRLQEEARKEEGQR--------------------------
PF08614         ----------------------------------------------------------------------
PF08397         ----------------------------------------------------------------------
PF06008         ----------------------------------------------------------------------
PF06810         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05557         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------------------
PF04156         ----------------------------------------------------------------------
PF01544         ----------------------------------------------------------------------
PF01017         ----------------------------------------------------------------------
PF01496         ----------------------------------------------------------------------
PF04111         ----------------------------------------------------------------------
PF08317         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF05911         ----------------------------------------------------------------------
PF00038         ----------------------------------------------------------------------
PF05622         ----------------------------------------------------------------------
PF07111         ----------------------------------------------------------------------
PF08614         ----------------------------------------------------------------------
PF08397         ----------------------------------------------------------------------
PF06008         ----------------------------------------------------------------------
PF06810         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxx
PF05557         ------
PF12128         ------
PF04156         ------
PF01544         ------
PF01017         ------
PF01496         ------
PF04111         ------
PF08317         ------
PF02463         ------
PF05911         ------
PF00038         ------
PF05622         ------
PF07111         ------
PF08614         ------
PF08397         ------
PF06008         ------
PF06810         ------