[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for huge0:KIAA0348

[Show Plain Result]


## Summary of Sequence Search
    1::1443
    2::294     7e-45  45%  301 aa  PF02383 Syja_N "SacI homology domain"
    1::140     3e-27  46%  142 aa  PF08952 DUF1866 "Domain of unknown function (DUF1866) "
    1::230     2e-26  45%  261 aa  PF03372 Exo_endo_phos "Endonuclease/Exonuclease/phosphatase family"
    1::1443

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxYGCLGELRLKSGGTSLSFLVLVTGCTSVGRIPDAEIYKITATDFYPLQEEAKEEERLIALKKI
PF02383         -------YGILGIIRLLSG----SYLLVITKREQVGSIGNHPIYKITGVEFIPLKEKSDEERYLKLLKKL
PF08952         ----------------------------------------------------------------------
PF03372         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LSSGVFYFSWPNDGSRFDLTVRTQKQGDDSSEWGNSFFWNQLLHVPLRQHQVSCCDWLLKIICGVVTIRT
PF02383         LSSGGFYFSYD-----YDLTRSLQRKFKNNSEWKSAFVWNRYLLKPL----IDAGDWLLPLIQGYVGQRS
PF08952         ----------------------------------------------------------------------
PF03372         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VYASHKQAKACLVSRVSCERTGTRFHTRGVNDDGHVSNFVETEQMIYMDDGVSSFVQIRGSVPLFWEQPG
PF02383         ISVSGKPFTLTLISRRSRHRAGTRYLRRGIDDDGNVANFVETEQIVSINNRIFSFVQIRGSVPLFWSQIS
PF08952         ----------------------------------------------------------------------
PF03372         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LQVGSHHLRLHRGLEANAPAFDRHMVLLKEQYGQQVVVNLLGSRGGEEVLNRAFKKLLWASCHAGDTPMI
PF02383         GLSYKPPIVISRSSELSQKAFKRHFKKLIRRYGPIYIVNLLEKKGREKKLSEAYEELNKDLPENDDIRYI
PF08952         ----------------------------------------------------------------------
PF03372         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           NFDFHQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02383         WFDFHQ----------------------------------------------------------------
PF08952         ----------------------------------------------------------------------
PF03372         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02383         ----------------------------------------------------------------------
PF08952         ----------------------------------------------------------------------
PF03372         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIRIAMGTWNVNGGK
PF02383         ----------------------------------------------------------------------
PF08952         ----------------------------------------------------------------------
PF03372         --------------------------------------------------------LRVA--TWNVLG--


                         *         .         .         .         .         +         .:560
query           QFRSNVLRTAELTDWLLDSPQLSGATDSQDDSSPADIFAVGFEEMVELSAGNIVNASTTNKKMWGEQLQK
PF02383         ----------------------------------------------------------------------
PF08952         ----------------------------------------------------------------------
PF03372         ------LRPADDLD--LD--------DLLDELEPADPDVLGLQEVVPLNAGNVLGASTVGVGLMGYGGNK


                         .         .         .         *         .         .         .:630
query           AISRSHRYILLTSAQLVGVCLYIFVRPYHVPFIRDVAIDTVKTGMGGKAGNKGAVGIRFQFHSTSFCFIC
PF02383         ----------------------------------------------------------------------
PF08952         ----------------------------------------------------------------------
PF03372         GLSRLPIFELVE-----GIEIFRLSR-------RDVLGRVISAG------------------GTSLCFVN


                         .         +         .         .         .         .         *:700
query           SHLTAGQSQVKERNEDYKEITQKLCFPMGRNVFSHDYVFWCGDFNYRIDLTYEEVFYFVKRQDWKKLLEF
PF02383         ----------------------------------------------------------------------
PF08952         ----------------------------------------------------------------------
PF03372         THLPAGEEGREDRNAQAEEILRRLKFL--RTILDHDPVILCGDFNYRPDSSDYKALRLLGLKSWDDLLER


                         .         .         .         .         +         .         .:770
query           DQLQLQKSSGKIFKDFHEGAINFGPTYKYDVGSAAYDTSDKCRTPAWTDRVLxxxxxxxxxxxxxxxxxx
PF02383         ----------------------------------------------------------------------
PF08952         ----------------------------------------------------------------------
PF03372         DQLRLRK--GRVFDGFREGPIEFPPTYKYDRNS-----SEKRRTPARLDRIL------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEVEVQEVDVGARERVFQEVSSFQGPLDATVV
PF02383         ----------------------------------------------------------------------
PF08952         ---------------------------------------DVEIFEVDPERRQQVFKEVIASQGPPDGTVV
PF03372         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           VNLQSPTLEEKNEFPEDLRTELMQTLGSYGTIVLVRINQGQMLVTFADSHSALSVLDVDGMKVKGRAVKI
PF02383         ----------------------------------------------------------------------
PF08952         VSIAS-SLDEGNFFDDALISELLQELANYGEVTLVRFVEDKMWVTFLDGSSALNALSLDGKKVLGRTLTI
PF03372         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           RPKTKDWLKGLREEIIRKRDSMAPVSPTANSCLLEENFDFTSxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02383         ----------------------------------------------------------------------
PF08952         TLKSPDWIKLLEEEM--NLCSLNTISVSASSTLLGEDADVTA----------------------------
PF03372         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02383         ----------------------------------------------------------------------
PF08952         ----------------------------------------------------------------------
PF03372         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02383         ----------------------------------------------------------------------
PF08952         ----------------------------------------------------------------------
PF03372         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02383         ----------------------------------------------------------------------
PF08952         ----------------------------------------------------------------------
PF03372         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02383         ----------------------------------------------------------------------
PF08952         ----------------------------------------------------------------------
PF03372         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:1330
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02383         ----------------------------------------------------------------------
PF08952         ----------------------------------------------------------------------
PF03372         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:1400
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02383         ----------------------------------------------------------------------
PF08952         ----------------------------------------------------------------------
PF03372         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:1470
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02383         -------------------------------------------
PF08952         -------------------------------------------
PF03372         -------------------------------------------