[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for huge0:KIAA1464

[Show Plain Result]


## Summary of Sequence Search
    1::621
    2::113     1e-20  48%  120 aa  PF00622 SPRY "SPRY domain"
    3::82      1e-12  48%  101 aa  PF10607 RanBPM_CRA "Ran binding protein in the
    1::621

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00622         ----------------------------------------------------------------------
PF10607         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPGWDKHS
PF00622         -------------------------------GKHYWEVEVSDKGA---WRVGVATESAKLNRLLGDDEGS
PF10607         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           YGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINGTCFYTKNGHSLGIAFTDLPANLYPTVGLQTP
PF00622         WGYHLNGGSKY-HAGTGEPYGLPFSQGDVIGCFLDLEAGTLSFTVNGKSLGYAFTDLPFSLYPAVSLQAG
PF10607         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GEIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00622         NEV-------------------------------------------------------------------
PF10607         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00622         ----------------------------------------------------------------------
PF10607         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00622         ----------------------------------------------------------------------
PF10607         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00622         ----------------------------------------------------------------------
PF10607         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxERIILFGRELQALSEQLGREYGKNLAHTEMLQDAFSLLAYSDPWSCPVGQQ
PF00622         ----------------------------------------------------------------------
PF10607         -------------------EEALEFAQELLAPFGQLNPEFLKEL------EDTMALLAYEDPESSPLGEL


                         .         .         .         *         .         .         .:630
query           LDPIQREPVCAALNSAILESQNLPKQPPLMLALGQxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00622         -------------------------------------------------------------
PF10607         LDPSQREKVADEVNSAILESQGKSSESKLEILLKQ--------------------------