[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for huge0:KIAA1520

[Show Plain Result]


## Summary of Sequence Search
    1::810
    9::266     4e-35  35%  274 aa  PF00664 ABC_membrane "ABC transporter transmembrane region"
    1::123     1e-12  38%  123 aa  PF00005 ABC_tran "ABC transporter"
    1::810

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxIVAALGETFLPYYTGRAIDGIVIQKSMDQFSTAVVIVCLLA
PF00664         -----------------------------LLAGLLALLLPLLLGRLIDSLS-DGNGDELSTLYLLALLLL
PF00005         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IGSSFAAGIRGGIFTLIFARLNIRLRNCLFRSLVSQETSFFDENRTGDLISRLTSDTTMVSDLVSQNINV
PF00664         ALAVLIALLLYLSFYLA-ARLGQRLRRRLFRKLLRLPLSFFDRNPTGELLSRLTNDVEAIDDLLGSTLPL
PF00005         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           FLRNTVKVTGVVVFMFSLSWQLSLVTFMGFPIIMMVSNIYGKYYKRLSKEVQNALARASNTAEETISAMK
PF00664         LLQALLTLVGALILLFLLSWKLALVLLAVLPLLILLAALFGKRLRKLSRKEQEARSELNSVLEESLSGIR
PF00005         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           TVRSFANEEEEAEVYLRKLQQVYKLNRKEAAAYMYYVWGSGLTLLVVQVSILYYGGHLVISGQMTSGNLI
PF00664         TVKAFGAEERELERFEEALDEYRKASLK--AARLSALLSPLLQLLLSLALVLWLGGYLVLSGELTVGDLV
PF00005         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           AFIIYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00664         AFLSY-----------------------------------------------------------------
PF00005         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxSSCVNILENFYPLEGGRVLLDGKPISAYDHKYLHRVISLVS
PF00664         ----------------------------------------------------------------------
PF00005         -----------------------------STLLRLLAGLLKPTSGKILLDGV-ISPLELRKLR--IGYVF


                         .         +         .         .         .         .         *:700
query           QEPVLFARSITDNISYGLPTVPFEMVVEAAQKANAHGFIMELQDGYSTETGEKGAQLSGGQKQRVAMARA
PF00664         ----------------------------------------------------------------------
PF00005         QDPALFPHTVRENIAFGLKN---DEKLKEIKKKEAKEEILEALEGLLKFLYRYPHELSGGQRQRVAIARA


                         .         .         .         .         +         .         .:770
query           LVRNPPVLILDEATSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00664         ----------------------------------------------------------------------
PF00005         LIKEPKVLLLDEPTS-------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00664         ----------------------------------------
PF00005         ----------------------------------------