[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for huge0:KIAA1268

[Show Plain Result]

#ERROR : Can't open dsspfile "1spvA.bssp"
#ERROR : Can't open dsspfile "1hjzA.bssp"
#ERROR : Can't open dsspfile "1yd9A1.bssp"
#ERROR : Can't open dsspfile "2acfA1.bssp"
#ERROR : Can't open dsspfile "1ujrA.bssp"
#ERROR : Can't open dsspfile "2afcA1.bssp"
#ERROR : Can't open dsspfile "1sgoA.bssp"
#ERROR : Can't open dsspfile "1a7aA2.bssp"
#ERROR : Can't open dsspfile "2jgrA1.bssp"
#ERROR : Can't open dsspfile "1dmwA.bssp"
#ERROR : Can't open dsspfile "1njrA.bssp"
#ERROR : Can't open dsspfile "2a90A1.bssp"
#ERROR : Can't open dsspfile "2a90A2.bssp"
#ERROR : Can't open dsspfile "1spvA.bssp"
#ERROR : Can't open dsspfile "1spvA.bssp"
#ERROR : Can't open dsspfile "1hjzA.bssp"
#ERROR : Can't open dsspfile "1hjzA.bssp"
#ERROR : Can't open dsspfile "1yd9A1.bssp"
#ERROR : Can't open dsspfile "1yd9A1.bssp"
#ERROR : Can't open dsspfile "2acfA1.bssp"
#ERROR : Can't open dsspfile "2acfA1.bssp"
#ERROR : Can't open dsspfile "2afcA1.bssp"
#ERROR : Can't open dsspfile "2afcA1.bssp"

## Summary of PDB Search
:1023
    5e-35  32%  1spvA  [c.50.1.2] PUTATIVE POLYPROTEIN/PHOSPHATASE
    2e-32  27%  1hjzA  [c.50.1.2] HYPOTHETICAL PROTEIN AF1521
    8e-28  25%  1yd9A1 [c.50.1.2] CORE HISTONE MACRO-H2A.1 A:6 -- 193
    3e-23  21%  2acfA1 [c.50.1.2] REPLICASE POLYPROTEIN 1AB A:184 -- 351
    3e-19  20%  1ujrA  [d.289.1.1] HYPOTHETICAL PROTEIN AK012080
    3e-19  18%  2afcA1 [c.50.1.2] CONSERVED HYPOTHETICAL PROTEIN A:2 -- 155
    2e-07  23%  1sgoA  [d.82.3.1] PROTEIN C14ORF129
    4e-05  28%  1a7aA2 [c.23.12.3] S-ADENOSYLHOMOCYSTEINE HYDROLASE A:2 -- 189
    2e-04  19%  2jgrA1 [e.52.1.2] YEGS A:4 -- 229
    3e-04  28%  1dmwA  [d.178.1.1] PHENYLALANINE HYDROXYLASE
    3e-04  22%  1njrA  [c.50.1.2] 32.1 KDA PROTEIN IN ADH3-RCA1 INTERGENIC REGION
    6e-04  21%  2a90A1 [d.289.1.1] DELTEX PROTEIN A:43 -- 131
    7e-04  27%  2a90A2 [d.289.1.1] DELTEX PROTEIN A:132 -- 211
    8e-29  26%  1spvA  [c.50.1.2] PUTATIVE POLYPROTEIN/PHOSPHATASE(query 572->729)
    3e-25  26%  1spvA  [c.50.1.2] PUTATIVE POLYPROTEIN/PHOSPHATASE(query 361->532)
    1e-30  28%  1hjzA  [c.50.1.2] HYPOTHETICAL PROTEIN AF1521(query 143->321)
    3e-22  20%  1hjzA  [c.50.1.2] HYPOTHETICAL PROTEIN AF1521(query 355->532)
    7e-24  20%  1yd9A1 [c.50.1.2] CORE HISTONE MACRO-H2A.1 A:6 -- 193(query 557->731)
    5e-19  26%  1yd9A1 [c.50.1.2] CORE HISTONE MACRO-H2A.1 A:6 -- 193(query 361->532)
    4e-22  19%  2acfA1 [c.50.1.2] REPLICASE POLYPROTEIN 1AB A:184 -- 351(query 562->715)
    1e-16  19%  2acfA1 [c.50.1.2] REPLICASE POLYPROTEIN 1AB A:184 -- 351(query 369->515)
    1e-14  16%  2afcA1 [c.50.1.2] CONSERVED HYPOTHETICAL PROTEIN A:2 -- 155(query 573->677)
    1e-13  15%  2afcA1 [c.50.1.2] CONSERVED HYPOTHETICAL PROTEIN A:2 -- 155(query 370->481)
:1023

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1spvA           ----------------------------------------------------------------------
1hjzA           ----------------------------------------------------------------------
1yd9A1          ----------------------------------------------------------------------
2acfA1          ----------------------------------------------------------------------
1ujrA           ----------------------------------------------------------------------
2afcA1          ----------------------------------------------------------------------
1sgoA           ----------------------------------------------------------------------
1a7aA2          ----------------------------------------------------------------------
2jgrA1          ----------------------------------------------------------------------
1dmwA           ----------------------------------------------------------------------
1njrA           ----------------------------------------------------------------------
2a90A1          ----------------------------------------------------------------------
2a90A2          ----------------------------------------------------------------------
1spvA           ----------------------------------------------------------------------
1spvA           ----------------------------------------------------------------------
1hjzA           ----------------------------------------------------------------------
1hjzA           ----------------------------------------------------------------------
1yd9A1          ----------------------------------------------------------------------
1yd9A1          ----------------------------------------------------------------------
2acfA1          ----------------------------------------------------------------------
2acfA1          ----------------------------------------------------------------------
2afcA1          ----------------------------------------------------------------------
2afcA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGQKCFSRTV
1spvA           ----------------------------------------------------------------------
1hjzA           ----------------------------------------------------------------------
1yd9A1          -------------------------------------------------------------GFTVLSTKS
2acfA1          ----------------------------------------------------------------------
1ujrA           ----------------------------------------------------------------------
2afcA1          ----------------------------------------------------------------------
1sgoA           ----------------------------------------------------------------------
1a7aA2          ----------------------------------------------------------------------
2jgrA1          ----------------------------------------------------------------------
1dmwA           ----------------------------------------------------------------------
1njrA           ----------------------------------------------------------------------
2a90A1          ----------------------------------------------------------------------
2a90A2          ----------------------------------------------------------------------
1spvA           ----------------------------------------------------------------------
1spvA           ----------------------------------------------------------------------
1hjzA           ----------------------------------------------------------------------
1hjzA           ----------------------------------------------------------------------
1yd9A1          ----------------------------------------------------------------------
1yd9A1          ----------------------------------------------------------------------
2acfA1          ----------------------------------------------------------------------
2acfA1          ----------------------------------------------------------------------
2afcA1          ----------------------------------------------------------------------
2afcA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LAPGVVLIVQQGDLARLPVDVVVNASNEDLKHYXXXXXXXXXXXXXXXQADCDQIVKREGRLLPGNATIS
1spvA           ------IHVVQGDITKLAVDVIVNAANPSLXGGGGVDGAIHRAAGPALLDACLKVRQQQGDCPTGHAVIT
1hjzA           ----------------------------------------------------------------------
1yd9A1          LFLGQKLQVVQADIASIDSDAVVHPTNTDFYIGGEVGSTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVS
2acfA1          -----NVAIKCVDIVKEAPMVIVNAANIHLKHGGGVAGALNKATNGAMQKESDDYIKLNGPLTVGGSCLL
1ujrA           ----------------------------------------------------------------------
2afcA1          ----------KGDATAPGVKVITHICNDIGGW-GKGFVLALSKKWKXPEEAYRQWYKSQEEFTLGAVQFV
1sgoA           ----------------------------------------------------------------------
1a7aA2          ----------------------------------------------------------------------
2jgrA1          ----------------------------------------------------------------------
1dmwA           ----------------------------------------------------------------------
1njrA           ----------------------------------------------------------------------
2a90A1          ----------------------------------------------------------------------
2a90A2          ----------------------------------------------------------------------
1spvA           ----------------------------------------------------------------------
1spvA           ----------------------------------------------------------------------
1hjzA           --GDITLKLAQGDITQYPAKAIVNAANKRLEHGGGVAYAIAKACAGDAGLYTEISKKGRDYIDHGEVVVT
1hjzA           ----------------------------------------------------------------------
1yd9A1          ----------------------------------------------------------------------
1yd9A1          ----------------------------------------------------------------------
2acfA1          ----------------------------------------------------------------------
2acfA1          ----------------------------------------------------------------------
2afcA1          ----------------------------------------------------------------------
2afcA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KAGKLPYHHVIHAVGPRWSGYEAPRCVYLLRRAVQLSLCLAEKYKYRSIAIPAISSGVFGFPLGRCVETI
1spvA           LAGDLPAKAVVHTVGPVWRGGE-QNEDQLLQDAYLNSLRLVAANSYTSVAFPAISTGVYGYPRAAAAEIA
1hjzA           ----------------------------------------------------------------------
1yd9A1          AGHGLPAKFVIHCNSPVWGSDKCEELLEKTVKNC---LALADDRKLKSIAFPSIGSGRNGFPKQTAAQLI
2acfA1          SGHNL-AKKCLHVVGPNLNAGEDI---------QLLKAAYENFNSQDILLAPLLSAGIFGAKPLQSLQVC
1ujrA           ----------------------------------------------------------------------
2afcA1          NVENKLY--VANXIGQHGISKGLPPIRYDAVRQCLKEVALFTIAHKASVHXPRIGCGAGG----------
1sgoA           ----------------------------------------------------------------------
1a7aA2          ----------------------------------------------------------------------
2jgrA1          ----------------------------------------------------------------------
1dmwA           ----------------------------------------------------------------------
1njrA           ----------------------------------------------------------------------
2a90A1          ----------------------------------------------------------------------
2a90A2          ----------------------------------------------------------------------
1spvA           ----------------------------------------------------------------------
1spvA           ----------------------------------------------------------------------
1hjzA           PAMNLEERYVFHTVGPICSGMWSEELKEKLYKAFLGPLEKAEEMGVESIAFPAVSAGIYGCDLEKVVETF
1hjzA           ----------------------------------------------------------------------
1yd9A1          ----------------------------------------------------------------------
1yd9A1          ----------------------------------------------------------------------
2acfA1          ----------------------------------------------------------------------
2acfA1          ----------------------------------------------------------------------
2afcA1          ----------------------------------------------------------------------
2afcA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VSAIKENFQFKKDGHCLKEIYLVDVSEKTVEAFAEAVKTVFxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1spvA           VKTVSE---FITRHALPEQVYFVCYDEENAHLYERLLT--------------------------------
1hjzA           ----------------------------------------------------------------------
1yd9A1          LKAISS-YFVSTMSSSIKTVYFVLFDSESIGIYVQEMAKLD-----------------------------
2acfA1          VQTVRTQVYIAVNDKALYEQVVMD----------------------------------------------
1ujrA           ----------------------------------------------------------------------
2afcA1          ----------------------------------------------------------------------
1sgoA           ----------------------------------------------------------------------
1a7aA2          ----------------------------------------------------------------------
2jgrA1          ----------------------------------------------------------------------
1dmwA           ----------------------------------------------------------------------
1njrA           ----------------------------------------------------------------------
2a90A1          ----------------------------------------------------------------------
2a90A2          ----------------------------------------------------------------------
1spvA           ----------------------------------------------------------------------
1spvA           ----------------------------------------------------------------------
1hjzA           LEAVKNF-----KGSAVKEVALVIYDRKSAEVALKVFERSL-----------------------------
1hjzA           ----------------------------------------------------------------------
1yd9A1          ----------------------------------------------------------------------
1yd9A1          ----------------------------------------------------------------------
2acfA1          ----------------------------------------------------------------------
2acfA1          ----------------------------------------------------------------------
2afcA1          ----------------------------------------------------------------------
2afcA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxGGLQMLLVKEGVQNAKTDVVVNSVPLDLVLSRGPLSKSLLEKAGPELQEELDTVGQGVAVSMGTVL
1spvA           ----------------------------------------------------------------------
1hjzA           ----------------------------------------------------------------------
1yd9A1          ----------------------------------------------------------------------
2acfA1          ----------------------------------------------------------------------
1ujrA           ----------------------------------------------------------------------
2afcA1          ----------------------------------------------------------------------
1sgoA           ----------------------------------------------------------------------
1a7aA2          ----------------------------------------------------------------------
2jgrA1          ----------------------------------------------------------------------
1dmwA           ----------------------------------------------------------------------
1njrA           -------------------------------------------------QLGGRYHTVGSATVVDLQRCL
2a90A1          ----------------------------------------------------------------------
2a90A2          ----------------------------------------------------------------------
1spvA           ----------------------------------------------------------------------
1spvA           ----------VVQGDITKLAVDVIVNAANPSLXGGGG-VDGAIHRAAGPALLDACLKVRQQQGCPTGHAV
1hjzA           ----------------------------------------------------------------------
1hjzA           ----GDITLKLAQGDITQYPAKAIVNAANKRLEHG-GGVAYAIAKACAGDAGLYTEISKKAMYIDHGEVV
1yd9A1          ----------------------------------------------------------------------
1yd9A1          ----------VVQADIASIDSDAVVHPTNTDFYIGGE-VGSTLEKKGGKEFVEAVLELKKNGPLEVAGAA
2acfA1          ----------------------------------------------------------------------
2acfA1          ------------------ANPMVIVNAANIHLKH-GGGVAGALNKATNGAMQKESDDIKLNGPLTVGGS-
2afcA1          ----------------------------------------------------------------------
2afcA1          -------------------GVKVITHICNDIGGWG-KGFVLALSKKWKXPEEAYRQWYKSQEEFTLGAVQ


                         .         .         +         .         .         .         .:490
query           KTSSWNLDCRYVLHVVAPEWRNGSTSSLKIMEDIIRECMEITESLSLKSIAFPAIGTGNLGFPKNIFAEL
1spvA           ----------------------------------------------------------------------
1hjzA           ----------------------------------------------------------------------
1yd9A1          ----------------------------------------------------------------------
2acfA1          ----------------------------------------------------------------------
1ujrA           ----------------------------------------------------------------------
2afcA1          ----------------------------------------------------------------------
1sgoA           ----------------------------------------------------------------------
1a7aA2          ----------------------------------------------------------------------
2jgrA1          ----------------------------------------------------------------------
1dmwA           ----------------------------------------------------------------------
1njrA           EECRDG--IRYIIHVVAPSAPIFNPQNLKTGFEPVFNAXWNALXHSPKGLIIPGLCTGYAGVPPIISCKS
2a90A1          ----------------------------------------------------------------------
2a90A2          ----------------------------------------------------------------------
1spvA           ----------------------------------------------------------------------
1spvA           ITLAGDLPAKAVVHTVGPVWRGGEQNEDQLLQDAYLNSLRLVAANSYTSVAFPAISTGVYGYPRAAAAEI
1hjzA           ----------------------------------------------------------------------
1hjzA           VTPAMNLEIKYVFHTVGPICSGMWSEEKEKLYKAFLGPLEKAEEMGVESIAFPAVSAGIYGCDLEKVVET
1yd9A1          ----------------------------------------------------------------------
1yd9A1          VSAGHGLPAKFVIHCNSPVWGSDKCEEL--LEKTVKNCLALADDRKLKSIAFPSIGSGRNGFPKQTAAQL
2acfA1          ----------------------------------------------------------------------
2acfA1          CLLSGHNLAKKCLHVVGPNLNAGED------IQLLKAA--YENFNSQDILLAPLLSAGIFGAKPLQSLQV
2afcA1          ----------------------------------------------------------------------
2afcA1          FVNVENKLYVANXIGQHGIYKDSKGLP-PIRYDAVRQCLKEFTIAHKASVHXPRIGCGAGG---------


                         *         .         .         .         .         +         .:560
query           IISEVFKFSSKNQLKTLQEVHFLLHPSDHENIQAFSDEFARRxxxxxxxxxxxxxxxxxxxxxxxxSPDS
1spvA           ----------------------------------------------------------------------
1hjzA           ----------------------------------------------------------------------
1yd9A1          ----------------------------------------------------------------------
2acfA1          ----------------------------------------------------------------------
1ujrA           ----------------------------------------------------------------------
2afcA1          ----------------------------------------------------------------------
1sgoA           ----------------------------------------------------------------------
1a7aA2          ----------------------------------------------------------------------
2jgrA1          ----------------------------------------------------------------------
1dmwA           ----------------------------------------------------------------------
1njrA           XAFALRLYXAGDHI--------------------------------------------------------
2a90A1          ----------------------------------------------------------------------
2a90A2          ----------------------------------------------------------------------
1spvA           ----------------------------------------------------------------------
1spvA           AVKTVSEFITRH--ALPEQVYFVCY--DEENAHLYERLLTQQ----------------------------
1hjzA           ----------------------------------------------------------------------
1hjzA           FLEAVKNF----KGSAVKEVALVIY--DRKSAEVALKVFERS----------------------------
1yd9A1          ------------------------------------------------------------------FTVL
1yd9A1          ILKAISSYFVSTMSSSIKTVYFVLF--DSESIGIYVQEMAKL----------------------------
2acfA1          ----------------------------------------------------------------------
2acfA1          CVQTVRTQVYIAVNKALYEQVVMDY---------------------------------------------
2afcA1          ----------------------------------------------------------------------
2afcA1          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           GVYEMKIGSIIFQVASGDITKEEADVIVNSTSNSFNLKAGVSKAILECAGQNVERECSQQAQQRKNDYII
1spvA           ----------------------------------------------------------------------
1hjzA           -LFEAKVGDITLKLAQGDITQYPAKAIVNAANKRLEHGGGVAYAIAKACAGDTEISKKAMREQFGRDYIV
1yd9A1          ----------------------------------------------------------------------
2acfA1          ----------------------------------------------------------------------
1ujrA           ----------------------------------------------------------------------
2afcA1          ----------------------------------------------------------------------
1sgoA           ----------------------------------------------------------------------
1a7aA2          ------------------------------------------------------LWCIEQTLYFKDNXIL
2jgrA1          -------------------------LILNGKSTD---NLPLREAILREEGXTIHRVTWEKGDAAR----Y
1dmwA           ----------------------------------------------------------------------
1njrA           ----------------------------------------------------------------------
2a90A1          ----------------------------------------------------------------------
2a90A2          ----------------------------------------------------------------------
1spvA           -----------IHVVQGDITKLAVDVIVNAANPSLXGGGGVDGAIHRAAGPALLDACLKVRQQQGDHAVI
1spvA           ----------------------------------------------------------------------
1hjzA           ----------------------------------------------------------------------
1hjzA           ----------------------------------------------------------------------
1yd9A1          STKSLFLGQKL-QVVQADIASIDSDAVVHPTNTDFYIGGEVGSTLEKKGGKEFVEAVLELRKKNGPGAAV
1yd9A1          ----------------------------------------------------------------------
2acfA1          -TGYLKLTDNV-AIKCVDIVKEAQMVIVNAANIHLKHGGGVAGALNKATNGAMQKES--DDYIKLNGPLT
2acfA1          ----------------------------------------------------------------------
2afcA1          ------------LYIKGDATASGVKVITHICNDIGGWGKGFVLALSKKWKXPEEQWYKSQEEFTLGAVQF
2afcA1          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           TGGGFLRCKNIIHVIGGNDVKSSVSSVLQECEKKNYSSICLPAIGTGNAKQHPDKVAEAIIDAIEDFVQK
1spvA           ----------------------------------------------------------------------
1hjzA           TPAMNLGIKYVFHTVGPIKLYKAFLGPLEKAEEMGVESIAFPAVSAGIYGCDLEKVVETFLEAVKNFKG-
1yd9A1          ----------------------------------------------------------------------
2acfA1          ----------------------------------------------------------------------
1ujrA           ----------------------------------------------------------------------
2afcA1          ----------------------------------------------------------------------
1sgoA           ---------------------------------------ELNGFEGTDMKDMRLE-AEAVVNDV------
1a7aA2          DDGGDLT--NLIHTIRGISEETT-TGVLYKXXANGI--LKVPAINVNDSKSKFHPSFNSFTNQVXELWTH
2jgrA1          VEEARKFGVATVIAGGGDGTINEVSTALIQCEGDDIPALGLPL-GTANDFATSVGIPEALDKALK-LAIA
1dmwA           ----------------------------------------------------------------------
1njrA           ----------------------------------------------------------------------
2a90A1          ----------------------------------------------------------------------
2a90A2          ----------------------------------------------------------------------
1spvA           TLAGDLPAKAVVHTVGDQLLQDAYLNSLRLVAANSYTSVAFPAISTGVYGYPRAAAAEIAVKTVSEFITR
1spvA           ----------------------------------------------------------------------
1hjzA           ----------------------------------------------------------------------
1hjzA           ----------------------------------------------------------------------
1yd9A1          SAGHGLPAKFVIHCNSPVLLEKTVKNCLALADDRKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVS
1yd9A1          ----------------------------------------------------------------------
2acfA1          VGGSCLLAKKCLHVVGPNLNAGEDIQLLKAANFNSQDILLAPLLSAGIFGAKPLQSLQVCVQTVRTQVIA
2acfA1          ----------------------------------------------------------------------
2afcA1          VNVENKLY--VANXIGQHGIYKQCLKEVALFTIAHKASVHXPRIGCG-----------------------
2afcA1          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           GSAQSVKKVKVVIFLPQVLDVFYANMKKREGTQLSSQQSVMSKLASFLGFSKQSPQKKNHxxxxxxxxxx
1spvA           ----------------------------------------------------------------------
1hjzA           ---SAVKEVALVIYDRKSAEVALKVFERS-----------------------------------------
1yd9A1          ----------------------------------------------------------------------
2acfA1          ----------------------------------------------------------------------
1ujrA           ----------------------------------------------------------------------
2afcA1          ----------------------------------------------------------------------
1sgoA           --LFAVNNMFVSKSLRCADDVAYINVETKERNRYC-----------------------------------
1a7aA2          P-----DKYPVVHFLPKKLDEAVAEAHGKLNTKLTEKQ------AQYLGXSCDGPFKPDH----------
2jgrA1          GDAIAIDXAQVGGFGTIHGLXRXDTLQPDRC-EIRGENFHWQGDALVIG---------------------
1dmwA           ----------------------------------------------------------------------
1njrA           ----------------------------------------------------------------------
2a90A1          ----------------------------------------------------------------------
2a90A2          ----------------------------------------------------------------------
1spvA           HA--LPEQVYFVCYDEENAHLYERLLTQQ-----------------------------------------
1spvA           ----------------------------------------------------------------------
1hjzA           ----------------------------------------------------------------------
1hjzA           ----------------------------------------------------------------------
1yd9A1          TMSSSIKTVYFVLFDSESIGIYVQEMAKLDA---------------------------------------
1yd9A1          ----------------------------------------------------------------------
2acfA1          VNDKALYEQVVMDYL-------------------------------------------------------
2acfA1          ----------------------------------------------------------------------
2afcA1          ----------------------------------------------------------------------
2afcA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1spvA           ----------------------------------------------------------------------
1hjzA           ----------------------------------------------------------------------
1yd9A1          ----------------------------------------------------------------------
2acfA1          ----------------------------------------------------------------------
1ujrA           ----------------------------------------------------------------------
2afcA1          ----------------------------------------------------------------------
1sgoA           ----------------------------------------------------------------------
1a7aA2          ----------------------------------------------------------------------
2jgrA1          ----------------------------------------------------------------------
1dmwA           ----------------------------------------------------------------------
1njrA           ----------------------------------------------------------------------
2a90A1          ----------------------------------------------------------------------
2a90A2          ----------------------------------------------------------------------
1spvA           ----------------------------------------------------------------------
1spvA           ----------------------------------------------------------------------
1hjzA           ----------------------------------------------------------------------
1hjzA           ----------------------------------------------------------------------
1yd9A1          ----------------------------------------------------------------------
1yd9A1          ----------------------------------------------------------------------
2acfA1          ----------------------------------------------------------------------
2acfA1          ----------------------------------------------------------------------
2afcA1          ----------------------------------------------------------------------
2afcA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxRDVMQARDEIEAMIKRVRLAKEQESRADCISEFIEWQYNDNNTSHCFNKMTNLKLEDARREKKKTV
1spvA           ----------------------------------------------------------------------
1hjzA           ----------------------------------------------------------------------
1yd9A1          ----------------------------------------------------------------------
2acfA1          ----------------------------------------------------------------------
1ujrA           ----SSGSSGFLDKPTLLSPEELKAASRGNGE-----YAWYYEGRNGWWQYDERTSRELEDAFSKGKKNT
2afcA1          ----------------------------------------------------------------------
1sgoA           ----------------------------------------------------------------------
1a7aA2          ----------------------------------------------------------------------
2jgrA1          ----------------------------------------------------------------------
1dmwA           --------------------------------------------------------------RARRKQFA
1njrA           ----------------------------------------------------------------------
2a90A1          ---------------------------------------WEFESRGKWLPYSPAVSQHLERAHAKKLTRV
2a90A2          --------------------------------------EWSADSNNDWRPYNXHVQSIIEDAWARGEQTL
1spvA           ----------------------------------------------------------------------
1spvA           ----------------------------------------------------------------------
1hjzA           ----------------------------------------------------------------------
1hjzA           ----------------------------------------------------------------------
1yd9A1          ----------------------------------------------------------------------
1yd9A1          ----------------------------------------------------------------------
2acfA1          ----------------------------------------------------------------------
2acfA1          ----------------------------------------------------------------------
2afcA1          ----------------------------------------------------------------------
2afcA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           DVKINHRHYTVNLNTYTATDTKGHSLSVQRLTKSKVDIPAHWSDMKQQNFCVVELLPSDPEYNTVASKFN
1spvA           ----------------------------------------------------------------------
1hjzA           ----------------------------------------------------------------------
1yd9A1          ----------------------------------------------------------------------
2acfA1          ----------------------------------------------------------------------
1ujrA           EMLIAGFLYVADLENMVQYNEHGRRRKIKR---DIIDIP-------------------------------
2afcA1          ----------------------------------------------------------------------
1sgoA           ----------------------------------------------------------------------
1a7aA2          ----------------------------------------------------------------------
2jgrA1          ----------------------------------------------------------------------
1dmwA           DIAYNYRHGQIPRVEYMEEEKKTWGTVFKTLKSL---YKTHACYEYNHIFPLLEGFHEDPQLEDV-SQFL
1njrA           ----------------------------------------------------------------------
2a90A1          DADPSLEQYYVNVRTXTSLTIG-----VRRXFYAPSSPAG------------------------------
2a90A2          DLTHIGLPYTINFSNLTQLRPSGPXRSIRR----TQQAP-------------------------------
1spvA           ----------------------------------------------------------------------
1spvA           ----------------------------------------------------------------------
1hjzA           ----------------------------------------------------------------------
1hjzA           ----------------------------------------------------------------------
1yd9A1          ----------------------------------------------------------------------
1yd9A1          ----------------------------------------------------------------------
2acfA1          ----------------------------------------------------------------------
2acfA1          ----------------------------------------------------------------------
2afcA1          ----------------------------------------------------------------------
2afcA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           QTCSHFRIEKVSLLLxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1spvA           -------------------------------------------
1hjzA           -------------------------------------------
1yd9A1          -------------------------------------------
2acfA1          -------------------------------------------
1ujrA           -------------------------------------------
2afcA1          -------------------------------------------
1sgoA           -------------------------------------------
1a7aA2          -------------------------------------------
2jgrA1          -------------------------------------------
1dmwA           QTCTGFRLRPVAGLL----------------------------
1njrA           -------------------------------------------
2a90A1          -------------------------------------------
2a90A2          -------------------------------------------
1spvA           -------------------------------------------
1spvA           -------------------------------------------
1hjzA           -------------------------------------------
1hjzA           -------------------------------------------
1yd9A1          -------------------------------------------
1yd9A1          -------------------------------------------
2acfA1          -------------------------------------------
2acfA1          -------------------------------------------
2afcA1          -------------------------------------------
2afcA1          -------------------------------------------