[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for huge0:KIAA1422

[Show Plain Result]

#ERROR : Can't open dsspfile "1lnqA2.bssp"
#ERROR : Can't open dsspfile "1orqC.bssp"
#ERROR : Can't open dsspfile "1p7bA2.bssp"
#ERROR : Can't open dsspfile "2h8pC1.bssp"
#ERROR : Can't open dsspfile "1bl8A.bssp"
#ERROR : Can't open dsspfile "1id1A.bssp"

## Summary of PDB Search
:1151
    2e-14  28%  1lnqA2 [f.14.1.1] POTASSIUM CHANNEL RELATED PROTEIN A:19 -- 98
    7e-12  26%  1orqC  [f.14.1.1] POTASSIUM CHANNEL
    1e-09  20%  1p7bA2 [f.14.1.1] INTEGRAL MEMBRANE CHANNEL AND CYTOSOLIC DOMAINS
    2e-09  22%  2h8pC1 [f.14.1.1] KCSA CHANNEL C:22 -- 78
    5e-08  20%  1bl8A  [f.14.1.1] PROTEIN (POTASSIUM CHANNEL PROTEIN)
    6e-05  20%  1id1A  [c.2.1.9] PUTATIVE POTASSIUM CHANNEL PROTEIN
:1151

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1lnqA2          ----------------------------------------------------------------------
1orqC           ----------------------------------------------------------------------
1p7bA2          ----------------------------------------------------------------------
2h8pC1          ----------------------------------------------------------------------
1bl8A           ----------------------------------------------------------------------
1id1A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1lnqA2          ----------------------------------------------------------------------
1orqC           ----------------------------------------------------------------------
1p7bA2          ----------------------------------------------------------------------
2h8pC1          ----------------------------------------------------------------------
1bl8A           ----------------------------------------------------------------------
1id1A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1lnqA2          ----------------------------------------------------------------------
1orqC           ----------------------------------------------------------------------
1p7bA2          ----------------------------------------------------------------------
2h8pC1          ----------------------------------------------------------------------
1bl8A           ----------------------------------------------------------------------
1id1A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFHR
1lnqA2          ----------------------------------------------------------------------
1orqC           -------------------------------------------------------------------FLS
1p7bA2          -------------------------------------------------------------------YYW
2h8pC1          ----------------------------------------------------------------------
1bl8A           ----------------------------------------------------------------------
1id1A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           AILRTQSAMFNQVLILFCTLLCLVFTGTCGIQHLERAGENLSLLTSFYFCIVTFSTVGYGDVTPKIWPSQ
1lnqA2          ------------ATRILLLVLAVIIYGTAGFHFIE----GESWTVSLYWTFVTIATVGYGDYSPSTPLGM
1orqC           AIADAADKIR--FYHLFGAVMLTVLYGAFAIYIVEYPDPNKSVFDALWWAVVTATTVGYGDVVPATPIGK
1p7bA2          ALKVSWPVFFASLAALFVVNNTLFALLYQLGDAPIANQSPPGFVGAFFFSVETLATVGYGDMHPQTVYAH
2h8pC1          -------------------LVIVLLAGSYLAVLAERGAPGITYPRALWWACETATTVGY-----------
1bl8A           -------------------LVIVLLAGSYLAVLAERGAPGATYPRALWWSVETATTVGYGDLYPVTLWGR
1id1A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LLVVIMICVALVVLPLQFEELVYLWMERQKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1lnqA2          YFTVTLIVLGIGTFAVAVERLL------------------------------------------------
1orqC           VIGIAVMLTGISALTL------------------------------------------------------
1p7bA2          AIATLEIFVGMSGIALST----------------------------------------------------
2h8pC1          ----------------------------------------------------------------------
1bl8A           CVAVVVMVAGITSFGLVTAALATWFVGREQ----------------------------------------
1id1A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxYVVILCPTEMDVQVRRVLQIPLWSQRVIYLQGSALKDQDLMRAKMDNGEACFILSSRNEVDRTAAD
1lnqA2          ----------------------------------------------------------------------
1orqC           ----------------------------------------------------------------------
1p7bA2          ----------------------------------------------------------------------
2h8pC1          ----------------------------------------------------------------------
1bl8A           ----------------------------------------------------------------------
1id1A           ----VTVISNLPEDDIQLEQRL-----GDNADVIPGDSNDSSVLKKAGIDRCRAILALSD--------ND


                         *         .         .         .         .         +         .:560
query           HQTILRAWAVKDFAPNCPLYVQILKPENKFHVKFADHVVCEExxxxxxxxxxxxxxxxxxxxxxxxxxxx
1lnqA2          ----------------------------------------------------------------------
1orqC           ----------------------------------------------------------------------
1p7bA2          ----------------------------------------------------------------------
2h8pC1          ----------------------------------------------------------------------
1bl8A           ----------------------------------------------------------------------
1id1A           ADNAFVVLSAKDMSSDVKTVLAVSDSKNKIKMVHPDIILSPQ----------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1lnqA2          ----------------------------------------------------------------------
1orqC           ----------------------------------------------------------------------
1p7bA2          ----------------------------------------------------------------------
2h8pC1          ----------------------------------------------------------------------
1bl8A           ----------------------------------------------------------------------
1id1A           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1lnqA2          ----------------------------------------------------------------------
1orqC           ----------------------------------------------------------------------
1p7bA2          ----------------------------------------------------------------------
2h8pC1          ----------------------------------------------------------------------
1bl8A           ----------------------------------------------------------------------
1id1A           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1lnqA2          ----------------------------------------------------------------------
1orqC           ----------------------------------------------------------------------
1p7bA2          ----------------------------------------------------------------------
2h8pC1          ----------------------------------------------------------------------
1bl8A           ----------------------------------------------------------------------
1id1A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1lnqA2          ----------------------------------------------------------------------
1orqC           ----------------------------------------------------------------------
1p7bA2          ----------------------------------------------------------------------
2h8pC1          ----------------------------------------------------------------------
1bl8A           ----------------------------------------------------------------------
1id1A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1lnqA2          ----------------------------------------------------------------------
1orqC           ----------------------------------------------------------------------
1p7bA2          ----------------------------------------------------------------------
2h8pC1          ----------------------------------------------------------------------
1bl8A           ----------------------------------------------------------------------
1id1A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1lnqA2          ----------------------------------------------------------------------
1orqC           ----------------------------------------------------------------------
1p7bA2          ----------------------------------------------------------------------
2h8pC1          ----------------------------------------------------------------------
1bl8A           ----------------------------------------------------------------------
1id1A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1lnqA2          ----------------------------------------------------------------------
1orqC           ----------------------------------------------------------------------
1p7bA2          ----------------------------------------------------------------------
2h8pC1          ----------------------------------------------------------------------
1bl8A           ----------------------------------------------------------------------
1id1A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1lnqA2          ----------------------------------------------------------------------
1orqC           ----------------------------------------------------------------------
1p7bA2          ----------------------------------------------------------------------
2h8pC1          ----------------------------------------------------------------------
1bl8A           ----------------------------------------------------------------------
1id1A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1lnqA2          -------------------------------
1orqC           -------------------------------
1p7bA2          -------------------------------
2h8pC1          -------------------------------
1bl8A           -------------------------------
1id1A           -------------------------------