[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for huge0:KIAA1464

[Show Plain Result]

#ERROR : Can't open dsspfile "2fbeA1.bssp"
#ERROR : Can't open dsspfile "2fnjA1.bssp"
#ERROR : Can't open dsspfile "1uujA.bssp"

## Summary of PDB Search
:621
    2e-28  13%  2fbeA1 [b.29.1.22] PREDICTED: SIMILAR TO RET FINGER PROTEIN-LIKE 1
    9e-24  16%  2fnjA1 [b.29.1.22] CG2944-PF, ISOFORM F A:35 -- 251
    1e-09  23%  1uujA  [a.221.1.1] PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB
:621

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRLYPAVNQQETPLPRSWSPKDKYNYIGLS
2fbeA1          -------------------------------------------------PEFQVDXTFDVDTANNYLIIS
2fnjA1          -----------------------------------------LLDMPPASRDLQLKHSWNSEDRSLNIFVK
1uujA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QGNLRVHYKGHGKNHKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPGWDKHS
2fbeA1          EDLRSFRSGDLSQNRKEQAERFDTALCVLGSGRHYWEVD-VGTSQVWDVGVCKESVNRQGKIELSSEHGF
2fnjA1          EDDK--LTFHRHPVAQSTDCIRGKVGLTKGLHIWEIYWPTRQRGTHAVVGVDAPLHSVGYQSLVGSTEQS
1uujA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           YGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINGTCFYTKNGHSLGIAFTDLPANLYPTVGLQTP
2fbeA1          LTVGCREGKVFAASTVPXTPLWVSPQLHRVGIFLDVGXRSIFYNVSDGCHIYTFIEIPVCWRPFFAHKRG
2fnjA1          WGWDLGRNKLYHDSKNILKNDEAFLVPDKFLVALDMDEGTLSFIVDQQYLGIAFRGLGKKLYPIVSAVWG
1uujA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GEIVDANFGQQPFLFDIEDYxxxxxxxxxxxxxxxxxxxxLGEWQAVLQNMVSSYLVHHGYCATATAFAR
2fbeA1          SQDDQSILSICSVI--------------------------------------------------------
2fnjA1          HCEITMRYIGGLDPEPLPLM--------------------------------------------------
1uujA           ----------------------------------------LSQRQRDLNRAIADYLRSNGYEEAYSVFKK


                         .         *         .         .         .         .         +:350
query           MTETPIQEEQASIKNRQKIQKLVLEGRVGEAIETTQRFYPGLLEHNPNLLxxxxxxxxxxxxxxxxxxxx
2fbeA1          ----------------------------------------------------------------------
2fnjA1          ----------------------------------------------------------------------
1uujA           EAELDXNEELDKKYAG------LLEKKWTSVIRLQKK----VXELESKLN--------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2fbeA1          ----------------------------------------------------------------------
2fnjA1          ----------------------------------------------------------------------
1uujA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2fbeA1          ----------------------------------------------------------------------
2fnjA1          ----------------------------------------------------------------------
1uujA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2fbeA1          ----------------------------------------------------------------------
2fnjA1          ----------------------------------------------------------------------
1uujA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2fbeA1          -------------------------------------------------------------
2fnjA1          -------------------------------------------------------------
1uujA           -------------------------------------------------------------