[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:metC

[Show Plain Result]

#ERROR : Can't open dsspfile "3e6gA.bssp"
#ERROR : Can't open dsspfile "3e6gB.bssp"
#ERROR : Can't open dsspfile "3e6gD.bssp"
#ERROR : Can't open dsspfile "1n8pA.bssp"
#ERROR : Can't open dsspfile "3cogD.bssp"
#ERROR : Can't open dsspfile "2nmpC.bssp"
#ERROR : Can't open dsspfile "2nmpD.bssp"
#ERROR : Can't open dsspfile "1e5eB.bssp"
#ERROR : Can't open dsspfile "1e5eA.bssp"
#ERROR : Can't open dsspfile "1ibjA.bssp"
#ERROR : Can't open dsspfile "1pg8A.bssp"
#ERROR : Can't open dsspfile "2nmpA.bssp"
#ERROR : Can't open dsspfile "1pffA.bssp"
#ERROR : Can't open dsspfile "2nmpB.bssp"
#ERROR : Can't open dsspfile "3cogB.bssp"
#ERROR : Can't open dsspfile "1ukjA.bssp"
#ERROR : Can't open dsspfile "1gc2A.bssp"
#ERROR : Can't open dsspfile "1gc2C.bssp"
#ERROR : Can't open dsspfile "2rfvA.bssp"
#ERROR : Can't open dsspfile "1gc2B.bssp"
#ERROR : Can't open dsspfile "1cs1A.bssp"
#ERROR : Can't open dsspfile "1y4iA.bssp"
#ERROR : Can't open dsspfile "1qgnA.bssp"
#ERROR : Can't open dsspfile "1i41A.bssp"
#ERROR : Can't open dsspfile "3elpB.bssp"
#ERROR : Can't open dsspfile "1gc0C.bssp"
#ERROR : Can't open dsspfile "1gc0D.bssp"
#ERROR : Can't open dsspfile "1gc0A.bssp"
#ERROR : Can't open dsspfile "1gc0B.bssp"
#ERROR : Can't open dsspfile "2fq6B.bssp"
#ERROR : Can't open dsspfile "2fq6A.bssp"
#ERROR : Can't open dsspfile "1cl1B.bssp"
#ERROR : Can't open dsspfile "1cl1A.bssp"
#ERROR : Can't open dsspfile "2ctzA.bssp"
#ERROR : Can't open dsspfile "2cb1A.bssp"

## Summary of PDB Search
:380
    3e-87  48%  3e6gA  [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN
    5e-77  48%  3e6gB  [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN
    4e-76  48%  3e6gD  [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN
    8e-73  44%  1n8pA  [c.67.1] CYSTATHIONINE GAMMA-LYASE
    1e-71  41%  3cogD  [x.x.x] CYSTATHIONINE GAMMA-LYASE
    2e-70  42%  2nmpC  [x.x.x] CYSTATHIONINE GAMMA-LYASE
    4e-70  42%  2nmpD  [x.x.x] CYSTATHIONINE GAMMA-LYASE
    4e-69  40%  1e5eB  [c.67.1] METHIONINE GAMMA-LYASE
    4e-69  40%  1e5eA  [c.67.1] METHIONINE GAMMA-LYASE
    5e-68  39%  1ibjA  [c.67.1] CYSTATHIONINE BETA-LYASE
    9e-67  43%  1pg8A  [c.67.1] METHIONINE GAMMA-LYASE
    1e-66  42%  2nmpA  [x.x.x] CYSTATHIONINE GAMMA-LYASE
    2e-66  44%  1pffA  [c.67.1] METHIONINE GAMMA-LYASE
    6e-66  42%  2nmpB  [x.x.x] CYSTATHIONINE GAMMA-LYASE
    4e-65  42%  3cogB  [x.x.x] CYSTATHIONINE GAMMA-LYASE
    8e-65  43%  1ukjA  [c.67.1] METHIONINE GAMMA-LYASE
    5e-64  43%  1gc2A  [c.67.1] METHIONINE GAMMA-LYASE
    1e-63  43%  1gc2C  [c.67.1] METHIONINE GAMMA-LYASE
    3e-63  40%  2rfvA  [x.x.x] METHIONINE GAMMA-LYASE
    3e-63  43%  1gc2B  [c.67.1] METHIONINE GAMMA-LYASE
    3e-63  37%  1cs1A  [c.67.1] PROTEIN (CYSTATHIONINE GAMMA-SYNTHASE)
    6e-63  40%  1y4iA  [x.x.x] METHIONINE GAMMA-LYASE
    4e-62  37%  1qgnA  [c.67.1] PROTEIN (CYSTATHIONINE GAMMA-SYNTHASE)
    4e-62  37%  1i41A  [c.67.1] CYSTATHIONINE GAMMA-SYNTHASE
    6e-60  42%  3elpB  [x.x.x] CYSTATHIONINE GAMMA-LYASE
    4e-59  43%  1gc0C  [c.67.1] METHIONINE GAMMA-LYASE
    1e-57  43%  1gc0D  [c.67.1] METHIONINE GAMMA-LYASE
    9e-56  43%  1gc0A  [c.67.1] METHIONINE GAMMA-LYASE
    1e-55  43%  1gc0B  [c.67.1] METHIONINE GAMMA-LYASE
    5e-38  28%  2fq6B  [c.67.1 (1cl2B)] CYSTATHIONINE BETA-LYASE
    5e-38  28%  2fq6A  [c.67.1 (1cl2A)] CYSTATHIONINE BETA-LYASE
    5e-36  28%  1cl1B  [c.67.1] CYSTATHIONINE BETA-LYASE
    5e-36  28%  1cl1A  [c.67.1] CYSTATHIONINE BETA-LYASE
    7e-32  34%  2ctzA  [x.x.x] O-ACETYL-L-HOMOSERINE SULFHYDRYLASE
    1e-24  34%  2cb1A  [x.x.x] O-ACETYL HOMOSERINE SULFHYDRYLASE
:380

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKFETKLIHGGQSEDQATGAVSISVYRSSTFHQYELGGNPKWEYSRTGNPTRAALEALIADLEGGVXXXX
3e6gA           LSLATLAIHGGQSPDPSTGAVMPPIYATSTYAQ-----------SSTHNPTRFAYERCVAALEGGTRAFA
3e6gB           ----------------------------------------------THNPTRFAYERCVAALEGGTRAFA
3e6gD           ----------------------------------------------THNPTRFAYERCVAALEGGTRAFA
1n8pA           -KFATKAIHAGEHVD-VHGSVIEPISLSTTFKQSS-PANPTYEYSRSQNPNRENLERAVAALENAQYGLA
3cogD           --FATQAIHVGQDPEQWTSAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLA
2nmpC           --FATQAIHVGQDPEQWTSAVVPPISLSTTFKQGAPGQG--FEYSRSGNPTRNCLEKAVAALDGAKYCLA
2nmpD           --FATQAIHVGQDPEQWTSAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLA
1e5eB           ----TACIHANPQKDQF-GAAIPPIYQTSTFDNCQQGGNSGYIYTRLGNPTVSNLEGKIAFLEKTEACVA
1e5eA           ----TACIHANPQKDQF-GAAIPPIYQTSTFDNCQQGGNSGYIYTRLGNPTVSNLEGKIAFLEKTEACVA
1ibjA           -------------------AMSTPLYQTATFKQPSAIENGPYDYTRSGNPTRDALESLLAKLDKADRAFC
1pg8A           --FATRAIHHGYDPQDHGGALVPPVYQTATFTEYGAGEQAGHFYSRISNPTLNLLEARXXXXXXXXXXXX
2nmpA           --FATQAIHVGQDPEQWTSAVVPPISLSTTFKQ--------------GNPTRNCLEKAVAALDGAKYCLA
1pffA           ----------------------------------------------------------------------
2nmpB           --FATQAIHVGQDPEQWTSAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLA
3cogB           --FATQAIHVGQDPEQWTSAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLA
1ukjA           --FATRAIHHGYDPQDHGGALVPPVYQTATFTEYGAGEQAGHFYSRISNPTLNLLEARXXXXXXXXXXXX
1gc2A           --FATRAIHHGYDPQDHGGALVPPVYQTATF-----------TFPTVSNPTLNLLEARXXXXXXXXXXXX
1gc2C           --FATRAIHHGYDPQDHGGALVPPVYQTATFTF------PTVEIS---NPTLNLLEARXXXXXXXXXXXX
2rfvA           --FNTQIVHAGQQPDPSTGALSTPIFQTSTFDSAEQGAARGYIYTRLGNPTTDALEKKLAVLERGAGLXX
1gc2B           --FATRAIHHGYDPQDHGGALVPPVYQTATF--------------TFSNPTLNLLEARXXXXXXXXXXXX
1cs1A           -KQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNEPRAHDYSRRGNPTRDVVQRXXXXXXXXXXXVL
1y4iA           --FNTQIVHAGQQPDPSTGALSTPIFQTSTFDSAEQGAESGYIYTRLGNPTTDALEKKLAVLERGAGLXX
1qgnA           -----------------TPVVNTSAYKTSELIDFKEKRRASFEYGRYGNPTTVVLEEKISALEGAESTLL
1i41A           -----------------TPVVNTSAYKTSELIDFKEKRRASFEYGRYGNPTTVVLEEKISALEGAESTLL
3elpB           -----------------------------------------------GNPTRNCLEKAVAALDGAKYCLA
1gc0C           --FATRAIHHGYDPQDHGGALVPPVYQTATFT------------FPTSNPTLNLLEARXXXXXXXXXXXX
1gc0D           --FATRAIHHGYDPQDHGGALVPPVYQTATF-------------TFPSNPTLNLLEARXXXXXXXXXXXX
1gc0A           --FATRAIHHGYDPQDHGGALVPPVYQTATF-------------TFPSNPTLNLLEARXXXXXXXXXXXX
1gc0B           --FATRAIHHGYDPQDHGGALVPPVYQTATFTF------PTVE----SNPTLNLLEARXXXXXXXXXXXX
2fq6B           -KLDTQLVNAGRSKKYTLGAVNSVIQRASSLHATRNRANGELFYGRRGTLTHFSLQQAMCELEGGAGCVL
2fq6A           -KLDTQLVNAGRSKKYTLGAVNSVIQRASSLHATRNRANGELFYGRRGTLTHFSLQQAMCELEGGAGCVL
1cl1B           -KLDTQLVNAGRSKKYTLGAVNSVIQRASSLHATRNRANGELFYGRRGTLTHFSLQQAMCELEGGAGCVL
1cl1A           -KLDTQLVNAGRSKKYTLGAVNSVIQRASSLHATRNRANGELFYGRRGTLTHFSLQQAMCELEGGAGCVL
2ctzA           MRFETLQLHAGYEPEPTTLSRQVPIYPTTSYHAANLFALKEFGYSRIMNPTVDVLEKRXXXXXXXXXXXX
2cb1A           MEYTTLAVLAGLPEDPH-GAVGLPIYAVAAYGQERFATGEGYVYARQKDPTAKALEEXXXXXXXXXXXXX


                         .         .         *         .         .         .         .:140
query           XXXXXXXIHATFSMYSAHDHFIVGSDVYGGTFRLINKVLKRFGLEFTVVDIQDLAAVENAIQDNTVAIYF
3e6gA           FASGMAATSTVMELLDAGSHVVAMDDLYGGTFRLFERVRRRTGLDFSFVDLTDPAAFKAAIRADTKMVWI
3e6gB           FASGMAATSTVMELLDAGSHVVAMDDLYGGTFRLFERVRRRTGLDFSFVDLTDPAAFKAAIRADTKMVWI
3e6gD           FASGMAATSTVMELLDAGSHVVAMDDLYGGTFRLFERVRRRTGLDFSFVDLTDPAAFKAAIRADTKMVWI
1n8pA           FSSGSATTATILQSLPQGSHAVSIGDVYGGTHRYFTKVANAHGVEFTNDLLNDLPQL---IKENTKLVWI
3cogD           FASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWI
2nmpC           FASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWI
2nmpD           FASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWI
1e5eB           TSSGMGAIAATLTILKAGDHLISDECLYGCTHALFEHALTKFGIQVDFINTAIPGEVKKHMKPNTKIVYF
1e5eA           TSSGMGAIAATLTILKAGDHLISDECLYGCTHALFEHALTKFGIQVDFINTAIPGEVKKHMKPNTKIVYF
1ibjA           FTSGMAALSAVTHLIKNGEEIVAGDDVYGGSDRLLSQXXXXXXXXXXXXNTTKLDEVAAAIGPQTKLVWL
1pg8A           XXXXXXXITSTWTLLRPGDEVLLGNTLYGCTFAFLHHGIGEFGVKLRHVDMADLQALEAAMTPATRVIYF
2nmpA           FASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWI
1pffA           ---------SVWTFLKAGDHLISDDCLYGCTHALFEHQLRKFGVEVDFIDMAVPGNIEKHLKPNTRIVYF
2nmpB           FASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWI
3cogB           FASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWI
1ukjA           XXXXXXXITSTWTLLRPGDEVLLGNTLYGCTFAFLHHGIGEFGVKLRHVDMADLQALEAAMTPATRVIYF
1gc2A           XXXXXXXITSTWTLLRPGDEVLLGNTLYGCTFAFLHHGIGEFGVKLRHVDMADLQALEAAMTPATRVIYF
1gc2C           XXXXXXXITSTWTLLRPGDEVLLGNTLYGCTFAFLHHGIGEFGVKLRHVDMADLQALEAAMTPATRVIYF
2rfvA           XXXXXXXXXXLLTLCQQGDHIVSASAIYGCTHAFLSHSMPKFGINVRFVDAAKPEEIRAAMRPETKVVYI
1gc2B           XXXXXXXITSTWTLLRPGDEVLLGNTLYGCTFAFLHHGIGEFGVKLRHVDMADLQALEAAMTPATRVIYF
1cs1A           TNTGMSAIHLVTTVFKPGDLLVAPHDCYGGSYRLFDSLAKRGCYRVLFVDQGDEQALRAALAEKPKLVLV
1y4iA           XXXXXXXXXXLLTLCQQGDHIVSASAIYGCTHAFLSHSMPKFGINVRFVDAGKPEEIRAAMRPETKVVYI
1qgnA           MASGMCASTVMLALVPAGGHIVTTTDCYRKTRIFIETILPKMGITATVIDPADVGALELALNQKKVNLFF
1i41A           MASGMCASTVMLALVPAGGHIVTTTDCYRKTRIFIETILPKMGITATVIDPADVGALELALNQKKVNLFF
3elpB           FASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWI
1gc0C           XXXXXXXITSTWTLLRPGDEVLLGNTLYGCTFAFLHHGIGEFGVKLRHVDMADLQALEAAMTPATRVIYF
1gc0D           XXXXXXXITSTWTLLRPGDEVLLGNTLYGCTFAFLHHGIGEFGVKLRHVDMADLQALEAAMTPATRVIYF
1gc0A           XXXXXXXITSTWTLLRPGDEVLLGNTLYGCTFAFLHHGIGEFGVKLRHVDMADLQALEAAMTPATRVIYF
1gc0B           XXXXXXXITSTWTLLRPGDEVLLGNTLYGCTFAFLHHGIGEFGVKLRHVDMADLQALEAAMTPATRVIYF
2fq6B           FPCGAAAVNSILAFIEQGDHVLMTNTAYEPSQDFCSKILSKLGVTTSWFDPLIGADIVKHLQPNTKIVFL
2fq6A           FPCGAAAVNSILAFIEQGDHVLMTNTAYEPSQDFCSKILSKLGVTTSWFDPLIGADIVKHLQPNTKIVFL
1cl1B           FPCGAAAVNSILAFIEQGDHVLMTNTAYEPSQDFCSKILSKLGVTTSWFDPLIGADIVKHLQPNTKIVFL
1cl1A           FPCGAAAVNSILAFIEQGDHVLMTNTAYEPSQDFCSKILSKLGVTTSWFDPLIGADIVKHLQPNTKIVFL
2ctzA           XXSGHXXXXXXXXXXXXXDNIVSTPNLYGGTFNQFKVTLKRLGIEVRFTSREERPEEFLALTDETRAWWV
2cb1A           XXXXXXXXXXXXXXXRPGDEVVAAKGLFGQTIGLFGQVLSLMGVTVRYVDPEP-EAVREALSAKTRAVFV


                         +         .         .         .         .         *         .:210
query           ETPTNPLLQXXXXXXXXXXXXXXXXXXXVDNTFATPYNQRPLELGADIVVHSATKYLGGHSDVVAGLAVT
3e6gA           ETPTNPMLKLVDIAAIAVIARKHGLLTVVDNTFASPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIAVV
3e6gB           ETPTNPMLKLVDIAAIAVIARKHGLLTVVDNTFASPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIAVV
3e6gD           ETPTNPMLKLVDIAAIAVIARKHGLLTVVDNTFASPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIAVV
1n8pA           ETPTNPTLKVTDIQKVADLIKKHAAGQDVDNTFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLAT
3cogD           ETPTNPTQKVIDIEGCAHIVHKHGDIILVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSV
2nmpC           ETPTNPTQKVIDIEGCAHIVHKHGDIILVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSV
2nmpD           ETPTNPTQKVIDIEGCAHIVHKHGDIILVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSV
1e5eB           ETPANPTLKIIDMERVCKDAHSQEGVLVIDNTFCSPMITNPVDFGVDVVVHSATKYINGHTDVVAGLICG
1e5eA           ETPANPTLKIIDMERVCKDAHSQEGVLVIDNTFCSPMITNPVDFGVDVVVHSATKYINGHTDVVAGLICG
1ibjA           ESPTNPRQQISDIRKISEMAHAQGALVLVDNSIMSPVLSRPLELGADIVMHSATKFIAGHSDVMAGVLAV
1pg8A           ESPANPNMHMADIAGVAKIARKHGATVVVDNTYCTPYLQRPLELGADLVVHSATKYLSGHGDITAGIVVG
2nmpA           ETPTNPTQKVIDIEGCAHIVHKHGDIILVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSV
1pffA           ETPANPTLKVIDIEDAVKQARKQKDILVVDNTFASPILTNPLDLGVDIVVHSATKYINGHTDVVAGLVCS
2nmpB           ETPTNPTQKVIDIEGCAHIVHKHGDIILVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSV
3cogB           ETPTNPTQKVIDIEGCAHIVHKHGDIILVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSV
1ukjA           ESPANPNMHMADIAGVAKIARKHGATVVVDNTYCTPYLQRPLELGADLVVHSAT-YLSGHGDITAGIVVG
1gc2A           ESPANPNMHMADIAGVAKIARKHGATVVVDNTYCTPYLQRPLELGADLVVHSAT-YLSGHGDITAGIVVG
1gc2C           ESPANPNMHMADIAGVAKIARKHGATVVVDNTYCTPYLQRPLELGADLVVHSAT-YLSGHGDITAGIVVG
2rfvA           ETPANPTLSLVDIETVAGIAHQQGALLVVDNTFMSPYCQQPLQLGADIVVHSVT-YXXXXXXXXXXXXXX
1gc2B           ESPANPNMHMADIAGVAKIARKHGATVVVDNTYCTPYLQRPLELGADLVVHSAT-YLSGHGDITAGIVVG
1cs1A           ESPSNPLLRVVDIAKICHLAREVGAVSVVDNTFLSPALQNPLALGADLVLHSCT-YLNGHSDVVAGVVIA
1y4iA           ETPANPTLSLVDIETVAGIAHQQGALLVVDNTFMSPYCQQPLQLGADIVVHSVT-YXXXXXXXXXXXXXX
1qgnA           ESPTNPFLRCVDIELVSKLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFLGGHNDVLAG-CIS
1i41A           ESPTNPFLRCVDIELVSKLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFLGGHNDVLAG-CIS
3elpB           ETPTNPTQKVIDIEGCAHIVHKHGDIILVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSV
1gc0C           ESPANPNMHMADIAGVAKIARKHGATVVVDNTYCTPYLQRPLELGADLVVHSAT-YLSGHGDITAGIVVG
1gc0D           ESPANPNMHMADIAGVAKIARKHGATVVVDNTYCTPYLQRPLELGADLVVHSAT-YLSGHGDITAGIVVG
1gc0A           ESPANPNMHMADIAGVAKIARKHGATVVVDNTYCTPYLQRPLELGADLVVHSAT-YLSGHGDITAGIVVG
1gc0B           ESPANPNMHMADIAGVAKIARKHGATVVVDNTYCTPYLQRPLELGADLVVHSAT-YLSGHGDITAGIVVG
2fq6B           ESPGSITMEVHDVPAIVAAVRSVVPDAIIDNTWAAGVLFKALDFGIDVSIQAATKYLVGHSDAMIGTAVC
2fq6A           ESPGSITMEVHDVPAIVAAVRSVVPDAIIDNTWAAGVLFKALDFGIDVSIQAATKYLVGHSDAMIGTAVC
1cl1B           ESPGSITMEVHDVPAIVAAVRSVVPDAIIDNTWAAGVLFKALDFGIDVSIQAAT-YLVGHSDAMIGTAVC
1cl1A           ESPGSITMEVHDVPAIVAAVRSVVPDAIIDNTWAAGVLFKALDFGIDVSIQAAT-YLVGHSDAMIGTAVC
2ctzA           ESIGNPALNIPDLEALAQAAREKGVALIVDNTFGMGYLLRPLAWGAALVTHSLTKWXGGRYPLLTGLRLT
2cb1A           ETVANPALLVPDXXXXXXXXXXXXXXXXXDNTFAAGALCRPLAWGAHVVVESLT-WASGHGSVLGGAVLS


                         .         .         .         +         .         .         .:280
query           SDEKIAEKLAFLQNSIGSTLGPDDSWLIQRGIKTLGARMRVHHANTEAIIKFLENDDRVARILYPGLPDF
3e6gA           GDNELAEQMAFLQNSIGGVQGPFDSFLALRGLKTLPLRMRAHCENALALAQWLETHPAIEKVIYPGLASH
3e6gB           GDNELAEQMAFLQNSIGGVQGPFDSFLALRGLKTLPLRMRAHCENALALAQWLETHPAIEKVIYPGLASH
3e6gD           GDNELAEQMAFLQNSIGGVQGPFDSFLALRGLKTLPLRMRAHCENALALAQWLETHPAIEKVIYPGLASH
1n8pA           NNKPLYERLQFLQNAIGAIPSPFDAWLTHRGLKTLHLRVRQAALSANKIAEFLAADENVVAVNYPGLKTH
3cogD           NCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSH
2nmpC           NCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSH
2nmpD           NCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSH
1e5eB           KADLLQQRMVGIKDITGSVISPHDAWLITRGLSTLNIRMKAESENAMKVAEYLKSHPAVEKVYYPGFEDH
1e5eA           KADLLQQRMVGIKDITGSVISPHDAWLITRGLSTLNIRMKAESENAMKVAEYLKSHPAVEKVYYPGFEDH
1ibjA           KGEKLAKEVYFLQNSEGSGLAPFDCWLCLRGIKTMALRIEKQQENARKIAMYLSSHPRVKKVYYAGLPDH
1pg8A           SQALVDRRLQGLKDMTGAVLSPHDAALLMRGIKTLNLRMDRHCANAQVLAEFLARQPQVELIHYPGLASF
2nmpA           NCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSH
1pffA           RADIIAKKSQGIKDITGAIISPHDAWLITRGTLTLDMRVKRAAENAQKVAEFLHEHKAVKKVYYPGLPDH
2nmpB           NCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSH
3cogB           NCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSH
1ukjA           SQALVDRRLQGLKDMTGAVLSPHDAALLMRGIKTLNLRMDRHCANAQVLAEFLARQPQVELIHYPGLASF
1gc2A           SQALVDRRLQGLKDMTGAVLSPHDAALLMRGIKTLNLRMDRHCANAQVLAEFLARQPQVELIHYPGLASF
1gc2C           SQALVDRRLQGLKDMTGAVLSPHDAALLMRGIKTLNLRMDRHCANAQVLAEFLARQPQVELIHYPGLASF
2rfvA           KQEFIDQRFVGLKDITGGCMSPFNAWLTLRGVKTLGIRMERHCENALKIARFLEGHPSITRVYYPGLSSH
1gc2B           SQALVDRRLQGLKDMTGAVLSPHDAALLMRGIKTLNLRMDRHCANAQVLAEFLARQPQVELIHYPGLASF
1cs1A           KDPDVVTELAWWANNIGVTGGAFDSYLLLRGLRTLVPRMELAQRNAQAIVKYLQTQPLVKKLYHPSLPEN
1y4iA           KQEFIDQRFVGLKDITGGCMSPFNAWLTLRGVKTLGIRMERHCENALKIARFLEGHPSITRVYYPGLSSH
1qgnA           GPLKLVSEIRNLHHILGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEILEAHPKVRHVYYPGLQSH
1i41A           GPLKLVSEIRNLHHILGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEILEAHPKVRHVYYPGLQSH
3elpB           NCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSH
1gc0C           SQALVDRRLQGLKDMTGAVLSPHDAALLMRGIKTLNLRMDRHCANAQVLAEFLARQPQVELIHYPGLAS-
1gc0D           SQALVDRRLQGLKDMTGAVLSPHDAALLMRGIKTLNLRMDRHCANAQVLAEFLARQPQVELIHYPGQP--
1gc0A           SQALVDRRLQGLKDMTGAVLSPHDAALLMRGIKTLNLRMDRHCANAQVLAEFLARQPQVELIHYP-----
1gc0B           SQALVDRRLQGLKDMTGAVLSPHDAALLMRGIKTLNLRMDRHCANAQVLAEFLARQPQVELIHYPP----
2fq6B           N-ARCWEQLRENAYLMGQMVDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNHPALPGS
2fq6A           N-ARCWEQLRENAYLMGQMVDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNHPALPGS
1cl1B           N-ARCWEQLRENAYLMGQMVDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNHPALPGS
1cl1A           N-ARCWEQLRENAYLMGQMVDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNHPALPGS
2ctzA           --EAFGE-LAFIVKARGQALGPFEAWVVLLGMETLSLRAERHVENTLHLAHWLLEQPQVAWVNYPGLPHH
2cb1A           RETELPERVRTLGLSLGMALSPFNAYLLFQGLETVALRVARMSETARFLAERLQGHPKVKALRYPGLPED


                         .         *         .         .         .         .         +:350
query           PGHEVAKKQMDHFGAMISFELQEGLDTKKFVESLKVISLAESLGGIESLIEVPSVMTHGSIPREIRLENG
3e6gA           PQHVLAKRQMSGFGGIVSIVLKGGFDAKRFCEKTELFTLAESLGGVESLVNHPAVMTHASIPVARREQLG
3e6gB           PQHVLAKRQMSGFGGIVSIVLKGGFDAKRFCEKTELFTLAESLGGVESLVNHPAVMTHEQL--------G
3e6gD           PQHVLAKRQMSGFGGIVSIVLKGGFDAKRFCEKTELFTLAESLGGVESLVNHPAVMT--------REQLG
1n8pA           PNYDVVLKQHRDAGGMISFRIKGGAEASKFASSTRLFTLAESLGGIESLLEVPAVMTHGGIPKEAREASG
3cogD           PQHELVKRQCTGCTGMVTFYIKGTLQAEIFLKNLKLFTLAESLGGFESLAELPAIMTHASVLKNDRDVLG
2nmpC           PQHELVKRQCTGCTGMVTFYIKGTLQAEIFLKNLKLFTLAESLGGFESLAELPAIMTHASVLKNDRDVLG
2nmpD           PQHELVKRQCTGCTGMVTFYIKGTLQAEIFLKNLKLFTLAESLGGFESLAELPAIMTHAS--KNDRDVLG
1e5eB           EGHDIAKKQMRMYGSMITFILKSGFEAKKLLDNLKLITLAVSLGGCESLIQHPASMTHAVVPKEEREAAG
1e5eA           EGHDIAKKQMRMYGSMITFILKSGFEAKKLLDNLKLITLAVSLGGCESLIQHPASMTHAVVPKEEREAAG
1ibjA           PGHHLHFSQAKGAGSVFSFITGSVALSKHLVETTKYFSIAVSFGSVKSLISMPCFMSHASIPAEVREARG
1pg8A           PQYTLARQQMSQPGGMIAFELKGGIGARRFMNALQLFSRAVSLGDAESLAQHPASMTHSSYTPEERAHYG
2nmpA           PQHELVKRQCTGCTGMVTFYIKGTLQAEIFLKNLKLFTLAESLGGFESLAELPAIMTHASVLKNDRDVLG
1pffA           PGHEIAKKQMKMFGSMIAFDVDGLEKAKKVLDNCHVVSLAVSLGGPESLIQHPASMTHAGVPKEEREAAG
2nmpB           PQHELVKRQCTGCTGMVTFYIKGTLQAEIFLKNLKLFTLAESLGGFESLAELPAI---------------
3cogB           PQHELVKRQCTGCTGMVTFYIKGTLQAEIFLKNLKLFTLAESLGGFESLAELPS----------------
1ukjA           PQYTLARQQMSQPGGMIAFELKGGIGARRFMNALQLFSRAVSLGDAESLAQHPASMTHSSYTPEERAHYG
1gc2A           PQYTLARQQMSQPGGMIAFELKGGIGARRFMNALQLFSRAVSLGDAESLAQHPASMTHSSYTPEERAHYG
1gc2C           PQYTLARQQMSQPGGMIAFELKGGIGARRFMNALQLFSRAVSLGDAESLAQHPASMTHSSYTPEERAHYG
2rfvA           PQYELGQRQMSLPGGIISFEIAGGLEARRMINSVELCLLAVSLGDTETLIQHPASMTHSPVAPEERLKAG
1gc2B           PQYTLARQQMSQPGGMIAFELKGGIGARRFMNALQLFSRAVSLGDAESLAQHPASMTHSSYTPEERAHYG
1cs1A           QGHEIAARQQKGFGAMLSFELDGDEQTRRFLGGLSLFTLAESLGGVESLISHAATMTHXXXXXXXXXXXG
1y4iA           PQYELGQRQMSLPGGIISFEIAGGLEARRMINSVELCLLAVSLGDTETLIQHPASMTHSPVAPEERLKAG
1qgnA           PEHHIAKKQMTGFGGAVSFEVDDLLTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSDRAKYG
1i41A           PEHHIAKKQMTGFGGAVSFEVDDLLTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSDRAKYG
3elpB           PQHELVKRQCTGCTGMVTFYIKGTLQAEIFLKNLKLFTLAESLGGFESLAELPAIML------------G
1gc0C           --------QMSQPGGMIAFELKGGIGARRFMNALQLFSRAVSLGDAESLAQHPASMTHSSYTPEERAHYG
1gc0D           -------------GGMIAFELKGGIGARRFMNALQLFSRAVSLGDAESLAQHPASMTHSSYTPEERAHYG
1gc0A           -----------QPGGMIAFELKGGIGARRFMNALQLFSRAVSLGDAESLAQHPASMTHSSYTPEERAHYG
1gc0B           -------------GGMIAFELKGGIGARRFMNALQLFSRAVSLGDAESLAQHPASMTHSSYTPEERAHYG
2fq6B           KGHEFWKRDFTGSSGLFSFVLKKKLNNEEYLDNFSLFSMAYSWGGYESLIHIAAIRPQGEI--------D
2fq6A           KGHEFWKRDFTGSSGLFSFVLKKKLNNEEYLDNFSLFSMAYSWGGYESLIHIAAIRPQGEI--------D
1cl1B           KGHEFWKRDFTGSSGLFSFVLKKKLNNEEYLDNFSLFSMAYSWGGYESLIHIAAIRPQGEI--------D
1cl1A           KGHEFWKRDFTGSSGLFSFVLKKKLNNEEYLDNFSLFSMAYSWGGYESLIHIAAIRPQGEI--------D
2ctzA           PHHDRAQKYFKGKGAVLTFGLKGGYEAKRFISRLKLISHLANVGDTRTLAIHPASTTHSQLSPEEQAQAG
2cb1A           PAHRNARKYLASGGPILTLDLGDLERASRFLGAIRLLK-AANLGDARTLLVHPWTTTHSRLKEEARLQAG


                         .         .         .         .         *         .         .:420
query           IKDELIRLSVGIEDEEDLINDLKQALDKIx
3e6gA           ISDALVRLSVGIEDLGDLRGDLERA-----
3e6gB           ISDALVRLSVGIEDLGDLRGDLERA-----
3e6gD           ISDALVRLSVGIEDLGDLRGDLERA-----
1n8pA           VFDDLVRISVGIEDTDDLLEDIKQAL----
3cogD           ISDTLIRLSVGXXXXXXXXXXXXQAL----
2nmpC           ISDTLIRLSVGXXXXXXXXXXXXQAL----
2nmpD           ISDTLIRLSVGXXXXXXXXXXXXQAL----
1e5eB           ITDGMIRLSVGIEDADELIADFKQGLDAL-
1e5eA           ITDGMIRLSVGIEDADELIADFKQGLDAL-
1ibjA           LTEDLVRISAGIEDVDDLISDL--------
1pg8A           ISEGLVRLSVGLEDIDDLLADVQQAL----
2nmpA           ISDTLIRLSVGXXXXXXXXXXXXQAL----
1pffA           LTDNLIRLSVGCENVQDIIDDLKQALDLV-
2nmpB           ISDTLIRLSVGXXXXXXXXXXXXQAL----
3cogB           --DTLIRLSVGXXXXXXXXXXXXQAL----
1ukjA           ISEGLVRLSVGLEDIDDLLADVQQAL----
1gc2A           ISEGLVRLSVGLEDIDDLLADVQQAL----
1gc2C           ISEGLVRLSVGLEDIDDLLADVQQAL----
2rfvA           ITDGLIRLSVGLEDPEDIINDLEHAIRK--
1gc2B           ISEGLVRLSVGLEDIDDLLADVQQAL----
1cs1A           ISETLLRISTGIEDGEDLIADLE-------
1y4iA           ITDGLIRLSVGLEDPEDIINDLEHAIRK--
1qgnA           IMDNLVRFSFGVEDFDDLKADILQALDSI-
1i41A           IMDNLVRFSFGVEDFDDLKADILQALDSI-
3elpB           ISDTLIRLSVGXXXXXXXXXXXXQAL----
1gc0C           ISEGLVRLSVGLEDIDDLLADVQQAL----
1gc0D           ISEGLVRLSVGLEDIDDLLADVQQAL----
1gc0A           ISEGLVRLSVGLEDIDDLLADVQQAL----
1gc0B           ISEGLVRLSVGLEDIDDLLADVQQAL----
2fq6B           FSGTLIRLHIGLEDVDDLIADLDAGFARI-
2fq6A           FSGTLIRLHIGLEDVDDLIADLDAGFARI-
1cl1B           FSGTLIRLHIGLEDVDDLIADLDAGFARI-
1cl1A           FSGTLIRLHIGLEDVDDLIADLDAGFARI-
2ctzA           VSPEMVRLSVGLEHVEDLKAELKEAL----
2cb1A           VTPGLVRVSVG-------------------