[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:ABD98930.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2yyzA.bssp"
#ERROR : Can't open dsspfile "1z47B.bssp"
#ERROR : Can't open dsspfile "1z47A.bssp"
#ERROR : Can't open dsspfile "1g291.bssp"
#ERROR : Can't open dsspfile "2it1B.bssp"
#ERROR : Can't open dsspfile "2it1A.bssp"
#ERROR : Can't open dsspfile "1q12A.bssp"
#ERROR : Can't open dsspfile "3fh6A.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "2r6gB.bssp"
#ERROR : Can't open dsspfile "2r6gA.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "1v43A.bssp"
#ERROR : Can't open dsspfile "1oxvA.bssp"
#ERROR : Can't open dsspfile "1oxsC.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "2onkA.bssp"
#ERROR : Can't open dsspfile "3fvqB.bssp"
#ERROR : Can't open dsspfile "3fvqA.bssp"
#ERROR : Can't open dsspfile "1oxxK.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "2oukB.bssp"
#ERROR : Can't open dsspfile "2oljA.bssp"
#ERROR : Can't open dsspfile "1l2tB.bssp"
#ERROR : Can't open dsspfile "1l2tA.bssp"
#ERROR : Can't open dsspfile "3gfoA.bssp"
#ERROR : Can't open dsspfile "1f3oA.bssp"
#ERROR : Can't open dsspfile "2yz2B.bssp"
#ERROR : Can't open dsspfile "2yz2A.bssp"
#ERROR : Can't open dsspfile "2hydA.bssp"
#ERROR : Can't open dsspfile "1mv5D.bssp"
#ERROR : Can't open dsspfile "1mv5A.bssp"
#ERROR : Can't open dsspfile "3g60A.bssp"
#ERROR : Can't open dsspfile "3g5uA.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1gajA.bssp"
#ERROR : Can't open dsspfile "1g9xA.bssp"
#ERROR : Can't open dsspfile "1pf4A.bssp"
#ERROR : Can't open dsspfile "1jj7A.bssp"
#ERROR : Can't open dsspfile "2ghiA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "2pcjA.bssp"
#ERROR : Can't open dsspfile "2ghiC.bssp"
#ERROR : Can't open dsspfile "1mt0A.bssp"
#ERROR : Can't open dsspfile "2ff7A.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "2fgkA.bssp"
#ERROR : Can't open dsspfile "2ffbA.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "2ixfC.bssp"
#ERROR : Can't open dsspfile "2ixfA.bssp"
#ERROR : Can't open dsspfile "1xefA.bssp"
#ERROR : Can't open dsspfile "2ffaA.bssp"
#ERROR : Can't open dsspfile "2ixfD.bssp"
#ERROR : Can't open dsspfile "2ghiB.bssp"
#ERROR : Can't open dsspfile "2ixeA.bssp"
#ERROR : Can't open dsspfile "2ixeD.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "2nq2D.bssp"
#ERROR : Can't open dsspfile "2ixgA.bssp"
#ERROR : Can't open dsspfile "2nq2C.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "2ghiD.bssp"
#ERROR : Can't open dsspfile "2ihyA.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "2ihyB.bssp"
#ERROR : Can't open dsspfile "1yqtA.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "1xmiB.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "1q3hB.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "2pzgA.bssp"
#ERROR : Can't open dsspfile "2pzeB.bssp"
#ERROR : Can't open dsspfile "2pzeA.bssp"
#ERROR : Can't open dsspfile "1r10A.bssp"
#ERROR : Can't open dsspfile "1r0zD.bssp"
#ERROR : Can't open dsspfile "1r0zC.bssp"
#ERROR : Can't open dsspfile "1r0zB.bssp"
#ERROR : Can't open dsspfile "1r0zA.bssp"
#ERROR : Can't open dsspfile "1r0xD.bssp"
#ERROR : Can't open dsspfile "1r0xC.bssp"
#ERROR : Can't open dsspfile "1r0xB.bssp"
#ERROR : Can't open dsspfile "1r0xA.bssp"
#ERROR : Can't open dsspfile "1r0wC.bssp"
#ERROR : Can't open dsspfile "1r0wB.bssp"
#ERROR : Can't open dsspfile "1r0wA.bssp"
#ERROR : Can't open dsspfile "1q3hD.bssp"
#ERROR : Can't open dsspfile "1q3hC.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "2pzgB.bssp"
#ERROR : Can't open dsspfile "2pzfB.bssp"
#ERROR : Can't open dsspfile "2pzfA.bssp"
#ERROR : Can't open dsspfile "1xmiE.bssp"
#ERROR : Can't open dsspfile "1xmiC.bssp"
#ERROR : Can't open dsspfile "1xmiA.bssp"
#ERROR : Can't open dsspfile "2zu0C.bssp"
#ERROR : Can't open dsspfile "1xmiD.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "1xf9D.bssp"
#ERROR : Can't open dsspfile "1xf9C.bssp"
#ERROR : Can't open dsspfile "1xf9B.bssp"
#ERROR : Can't open dsspfile "1xf9A.bssp"
#ERROR : Can't open dsspfile "1xfaA.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "1z2rA.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "1xmjA.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "2ix3A.bssp"
#ERROR : Can't open dsspfile "2iwhB.bssp"
#ERROR : Can't open dsspfile "2pjzA.bssp"
#ERROR : Can't open dsspfile "2ix8A.bssp"
#ERROR : Can't open dsspfile "2iw3B.bssp"
#ERROR : Can't open dsspfile "2iw3A.bssp"
#ERROR : Can't open dsspfile "2qi9C.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "2r6fB.bssp"
#ERROR : Can't open dsspfile "2r6fA.bssp"
#ERROR : Can't open dsspfile "2vf8B.bssp"
#ERROR : Can't open dsspfile "2vf8A.bssp"
#ERROR : Can't open dsspfile "2vf7C.bssp"
#ERROR : Can't open dsspfile "2vf7B.bssp"
#ERROR : Can't open dsspfile "2vf7A.bssp"
#ERROR : Can't open dsspfile "1ii8B.bssp"
#ERROR : Can't open dsspfile "1f2uD.bssp"
#ERROR : Can't open dsspfile "1f2uB.bssp"
#ERROR : Can't open dsspfile "1f2tB.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"

## Summary of PDB Search
:362
    8e-67  42%  2yyzA  [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN
    2e-64  40%  1z47B  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    2e-64  40%  1z47A  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    1e-63  47%  1g291  [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK
    2e-61  46%  2it1B  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    2e-61  46%  2it1A  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    6e-60  47%  1q12A  [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING
    6e-60  47%  3fh6A  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    6e-60  47%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    6e-60  47%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-59  46%  2r6gB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-59  46%  2r6gA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-55  47%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-53  38%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    9e-53  49%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    1e-49  48%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-48  41%  1v43A  [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT
    4e-46  37%  1oxvA  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    4e-46  37%  1oxsC  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    4e-42  47%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-40  41%  2onkA  [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING
    7e-40  33%  3fvqB  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    7e-40  33%  3fvqA  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    1e-38  33%  1oxxK  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    3e-38  35%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    3e-34  33%  2oukB  [x.x.x] PROTEIN ARTP
    3e-34  33%  2oljA  [x.x.x] AMINO ACID ABC TRANSPORTER
    7e-32  35%  1l2tB  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    7e-32  35%  1l2tA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    5e-30  32%  3gfoA  [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1
    3e-28  36%  1f3oA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-28  38%  2yz2B  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-28  38%  2yz2A  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-27  39%  2hydA  [x.x.x] ABC TRANSPORTER HOMOLOG
    6e-27  34%  1mv5D  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    6e-27  34%  1mv5A  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    2e-26  35%  3g60A  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    2e-26  35%  3g5uA  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    5e-26  34%  1g6hA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    1e-25  34%  1gajA  [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID
    2e-25  34%  1g9xA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    2e-24  37%  1pf4A  [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA
    1e-22  34%  1jj7A  [c.37.1] PEPTIDE TRANSPORTER TAP1
    3e-22  36%  2ghiA  [x.x.x] TRANSPORT PROTEIN
    3e-22  33%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    4e-22  30%  2pcjA  [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN
    6e-22  35%  2ghiC  [x.x.x] TRANSPORT PROTEIN
    1e-21  34%  1mt0A  [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN
    1e-21  34%  2ff7A  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-21  48%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-21  33%  2fgkA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-21  33%  2ffbA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-21  33%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    5e-21  32%  2ixfC  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    5e-21  32%  2ixfA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    2e-20  33%  1xefA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-20  33%  2ffaA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    3e-20  31%  2ixfD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    3e-20  36%  2ghiB  [x.x.x] TRANSPORT PROTEIN
    6e-20  33%  2ixeA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    3e-19  31%  2ixeD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    4e-19  48%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    8e-19  31%  2nq2D  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-18  33%  2ixgA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    2e-18  30%  2nq2C  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-18  29%  1vplA  [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN
    5e-18  35%  2ghiD  [x.x.x] TRANSPORT PROTEIN
    1e-17  31%  2ihyA  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    2e-17  30%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    5e-17  31%  1ji0A  [c.37.1] ABC TRANSPORTER
    2e-16  33%  2ihyB  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    1e-15  32%  1yqtA  [x.x.x] RNASE L INHIBITOR
    6e-15  31%  2d2fA  [x.x.x] SUFC PROTEIN
    2e-14  30%  2d2eA  [x.x.x] SUFC PROTEIN
    3e-14  28%  1xmiB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-14  31%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-14  27%  1q3hB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-14  29%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    4e-14  30%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-14  32%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-14  32%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-14  31%  2pzgA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-14  31%  2pzeB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-14  31%  2pzeA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-14  27%  1r10A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-14  27%  1r0zD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-14  27%  1r0zC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-14  27%  1r0zB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-14  27%  1r0zA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-14  27%  1r0xD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-14  27%  1r0xC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-14  27%  1r0xB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-14  27%  1r0xA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-14  27%  1r0wC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-14  27%  1r0wB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-14  27%  1r0wA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-14  27%  1q3hD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-14  27%  1q3hC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-14  27%  1q3hA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-14  30%  2pzgB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-13  30%  2pzfB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-13  30%  2pzfA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-13  29%  1xmiE  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-13  29%  1xmiC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-13  29%  1xmiA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-13  30%  2zu0C  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    4e-13  30%  1xmiD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-13  30%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    5e-13  27%  1xf9D  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-13  27%  1xf9C  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-13  27%  1xf9B  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-13  27%  1xf9A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-13  27%  1xfaA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-13  26%  1sgwA  [c.37.1] PUTATIVE ABC TRANSPORTER
    1e-12  32%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    2e-12  32%  1z2rA  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    3e-12  29%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    3e-12  29%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    3e-12  29%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-12  28%  1xmjA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  29%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-10  32%  2ix3A  [x.x.x] ELONGATION FACTOR 3
    2e-10  32%  2iwhB  [x.x.x] ELONGATION FACTOR 3A
    2e-09  28%  2pjzA  [x.x.x] HYPOTHETICAL PROTEIN ST1066
    2e-08  32%  2ix8A  [x.x.x] ELONGATION FACTOR 3A
    2e-08  32%  2iw3B  [x.x.x] ELONGATION FACTOR 3A
    2e-08  32%  2iw3A  [x.x.x] ELONGATION FACTOR 3A
    4e-08  29%  2qi9C  [x.x.x] VITAMIN B12 IMPORT ATP-BINDING PROTEIN BTUD
    9e-08  29%  1l7vC  [c.37.1] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    4e-07  33%  2r6fB  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    4e-07  33%  2r6fA  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    4e-04  32%  2vf8B  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    4e-04  32%  2vf8A  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    4e-04  32%  2vf7C  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    4e-04  32%  2vf7B  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    4e-04  32%  2vf7A  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    8e-04  30%  1ii8B  [c.37.1] RAD50 ABC-ATPASE
    8e-04  30%  1f2uD  [c.37.1] RAD50 ABC-ATPASE
    8e-04  30%  1f2uB  [c.37.1] RAD50 ABC-ATPASE
    8e-04  30%  1f2tB  [c.37.1] RAD50 ABC-ATPASE
    2e-16  47%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 6->83)
    2e-16  47%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 6->83)
:362

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKQPLISFKHVVKSYDDDVQVLKDVSFDIEEGKFYTLLGPSGCGKTTILNIIAGLSDATSGDVYFDGKRI
2yyzA           -----------LKKYFGKVKAVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSGEIYFDDVLV
1z47B           -----IEFVGVEKIYPGGARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRV
1z47A           -----IEFVGVEKIYPGGARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRV
1g291           -----------------EVTAVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIGDKLV
2it1B           -----IKLENIVKKFGN-FTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDV
2it1A           -----IKLENIVKKFGN-FTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDV
1q12A           -----VQLQNVTKAWGE-VVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM
3fh6A           -----VQLQNVTKAWGE-VVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM
2awoA           -----VQLQNVTKAWGE-VVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM
2awnB           -----VQLQNVTKAWGE-VVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM
2r6gB           -----VQLQNVTKAWGE-VVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM
2r6gA           -----VQLQNVTKAWGE-VVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM
2awoC           -----------------NVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM
3d31A           ---------------------LDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGKDV
2d62A           -----------------DVTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLR-IAGLEEPTRGQIYIEDNLV
2awnC           -----------------NVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLG--------------
1v43A           IKMVEVKLENLTKRFGNFTAVNK-LNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDV
1oxvA           ------------------VVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLV
1oxsC           ------------------VVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLV
2awnA           -----VQLQNVTKAWGE-VVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM
2onkA           ------------------------LNVDFEMGRDYVLLGPTGAGKSVFLELIAGIVKPDRGEVRLNGADI
3fvqB           ---------HLSKSFQN-TPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTI
3fvqA           ---------HLSKSFQN-TPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTI
1oxxK           ------------------VVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLV
3dhwC           ------------------IQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQEL
2oukB           ---------HQLKKSFGSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFXXXXXXXXXXNL
2oljA           ---------HQLKKSFGSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFXXXXXXXXXXNL
1l2tB           ----MIKLKNVTKTYEEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKT
1l2tA           ----MIKLKNVTKTYEEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKT
3gfoA           -------------NYSDGTHALKGINMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSSGRILFDNKPI
1f3oA           -----IKLKNVTKTYEEIIYALKNVNLNIKEGEFVSI-GPSGSGKST-LNIIGCLDKPTEGEVYIDNIKT
2yz2B           -------------------KALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGERK
2yz2A           -------------------KALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGERK
2hydA           IKQGRIDIDHVSFQYNDEAPILKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNI
1mv5D           ----MLSARHVDFAYDDSEQILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPI
1mv5A           ----MLSARHVDFAYDDSEQILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPI
3g60A           -----VQFSGVVFNYPTSIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEI
3g5uA           -----VQFSGVVFNYPTSIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEI
1g6hA           ----ILRTENIVK-YFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDI
1gajA           ----ILRTENIVK-YFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDI
1g9xA           ----ILRTENIVK-YFGEFKALDGVSISVCKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDI
1pf4A           -----VDVKDVTFTYQGEKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDV
1jj7A           ----LVQFQDVSFAYPNDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPL
2ghiA           -----IEFSDVNFSYPKQTRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDA-EGDIKIGGKNV
1b0uA           -------------------EVLKGVSLQARAGDVXXXXXXXXXXKSTFLRCINFLEKPSEGAIIVNGQNI
2pcjA           ------NIKKVIRGYE----ILKGISLSVKKGEFVSIIGASGSGKSTLLYILGLLDAPTEGKVFLEGKEV
2ghiC           -----IEFSDVNFSYPKQTRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDA-EGDIKIGGKNV
1mt0A           -----ITFRNIRFRYKPDSPVILDINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDL
2ff7A           -----ITFRNIRFRYKPDSPVILDINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDL
2awnD           ----------------------------------------------------------------------
2fgkA           -----ITFRNIRFRYKPDSPVILDINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDL
2ffbA           -----ITFRNIRFRYKPDSPVILDINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDL
3b5jA           -----ITFRNIRFRYKPDSPVILDINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGHDL
2ixfC           ----LVKFQDVSFAYPNNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPL
2ixfA           ----LVKFQDVSFAYPNNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPL
1xefA           -----ITFRNIRFRYKPDSPVILDINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDL
2ffaA           -----ITFRNIRFRYKPDSPVILDINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDL
2ixfD           ----LVKFQDVSFAYPNNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPL
2ghiB           -----IEFSDVNFSYPKQTRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDA-EGDIKIGGKNV
2ixeA           ----LVKFQDVSFAYPNNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPL
2ixeD           ----LVKFQDVSFAYPNNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPL
2awoD           ----------------------------------------------------------------------
2nq2D           -------------------QAFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGEVY------
2ixgA           ----LVKFQDVSFAYPNNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPL
2nq2C           --------------YQAENFLFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGEVY------
1vplA           ---------------------------------------PNGAGKTTTLRIISTLIKPSSGIVTVFGKNV
2ghiD           -----IEFSDVNFSYH---RTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDA-EGDIKIGGKNV
2ihyA           --------------------ILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFGKPG
3bk7A           -RETLVEYPRLVKDYGSFK--LEVEPGEIRKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKVEWDL---
1ji0A           --------------YYGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDI
2ihyB           --------------------ILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFGKKV
1yqtA           -RETLVTYPRLVKDYGSFR--LEVEPGEIKKGEVIGIVGPNGIGKTTFVKL-AGVEEPTEGKIEWD----
2d2fA           ----------------DGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTRGEILLDGENI
2d2eA           ----------------DGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTRGEILLDGENI
1xmiB           --------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR--
2bbsA           --------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-RI
1q3hB           --EKVVSFSHLCLVGNP---VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR--
2cbzA           -----------------DPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGS-V
2bbtB           ------------KQNNNNTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-RI
2bbtA           --------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-RI
2bbsB           --------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-RI
2pzgA           --------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-RI
2pzeB           --------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-RI
2pzeA           --------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-RI
1r10A           --------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR--
1r0zD           --------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR--
1r0zC           --------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR--
1r0zB           --------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR--
1r0zA           --------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR--
1r0xD           --------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR--
1r0xC           --------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR--
1r0xB           --------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR--
1r0xA           --------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR--
1r0wC           --------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR--
1r0wB           --------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR--
1r0wA           --------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR--
1q3hD           --------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR--
1q3hC           --------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR--
1q3hA           --------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR--
2pzgB           --------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR--
2pzfB           --------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRIS
2pzfA           --------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRIS
1xmiE           --------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRIS
1xmiC           --------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRIS
1xmiA           --------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRIS
2zu0C           ----MLSIKDLHVSVEDKA-ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDVTGGTVEFKGKDL
1xmiD           --------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR--
2d3wA           ----MLSIKDLHVSVEDKA-ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDVTGGTVEFKGKDL
1xf9D           --------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRV-
1xf9C           --------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRV-
1xf9B           --------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRV-
1xf9A           --------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRV-
1xfaA           --------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRV-
1sgwA           -----------------DKPVLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPI
3b60A           -----LEFRNVTFTYPGEVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDL
1z2rA           -------FRNVTFTYPGEVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDL
2d3wC           ----MLSIKDLHVSVEDKA-ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDVTGGTVEFKGKDL
2d3wB           ----MLSIKDLHVSVEDKA-ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDVTGGTVEFKGKDL
2bboA           --------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-RI
1xmjA           -----------------ETPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRIS
2d3wD           ----MLSIKDLHVSVEDKA-ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDVTGGTVEFKGKDL
2ix3A           --------------------LLNKTQLRLKRARRYGICGPNGCGKSTLMRAIA------NGQV-------
2iwhB           --------------------LLNKTQLRLKRARRYGICGPNGCGKSTLMRAIA------NGQV-------
2pjzA           ---------------------LENINLEVN-GEKVIILGPNGSGKTTLLRAISGLL-PYSGNIFINGMEV
2ix8A           --------------------LLNKTQLRLKRARRYGICGPNGCGKSTLRAIANGQVDGFP----------
2iw3B           --------------------LLNKTQLRLKRARRYGICGPNGCGKSTLRAIANGQVDGFP----------
2iw3A           --------------------LLNKTQLRLKRARRYGICGPNGCGKSTLRAIANGQVDGFP----------
2qi9C           ---------------------LGPLSGEVRAGEILHLVGPNGAGKSTLL---ARAGTSGKGSIQFAGQPL
1l7vC           ---------------------LGPLSGEVRAGEILHLVGPNGAGKSTLL---ARAGTSGKGSIQFAGQPL
2r6fB           --------------------------------------------------------------VLVGGKHI
2r6fA           --------------------------------------------------------------VLVGGKHI
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1ii8B           ----------------------------------------------------------------------
1f2uD           ----------------------------------------------------------------------
1f2uB           ----------------------------------------------------------------------
1f2tB           ----------------------------------------------------------------------
2awnD           -----VQLQNVTKAWGE-VVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM
2awoD           -----VQLQNVTKAWGE-VVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM


                         .         .         *         .         .         .         .:140
query           NDVPANKRQVNTVFQDYALFQHLNVYDNIAFGLKIKKVPADKIKEKVTEALRMVRLDGYEDRAISEMSGG
2yyzA           NDIPPKYREVGMVFQNYALYPHMTVFENIAFPLRARRISKDEVEKRVVEIARKLLIDNLLDRKPTQLSGG
1z47B           TDLPPQKRNVGLVFQNYALFQHMTVYDNVSFGLREKRVPKDEMDARVRELLRFMRLESYANRFPHELSGG
1z47A           TDLPPQKRNVGLVFQNYALFQHMTVYDNVSFGLREKRVPKDEMDARVRELLRFMRLESYANRFPHELSGG
1g291           ADVPPKDRDIAMVFQSYALYPHMTVYDNIAFPLKLRKVPRQEIDQRVREVAELLGLTELLNRKPRELSGG
2it1B           TELPPKDRNVGLVFQNWALYPHMTVYKNIAFPLELRKAPREEIDKKVREVAKMLHIDKLLNRYPWQLSGG
2it1A           TELPPKDRNVGLVFQNWALYPHMTVYKNIAFPLELRKAPREEIDKKVREVAKMLHIDKLLNRYPWQLSGG
1q12A           NDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGG
3fh6A           NDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGG
2awoA           NDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGG
2awnB           NDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGG
2r6gB           NDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGG
2r6gA           NDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGG
2awoC           NDTPPAERGVGMV----ALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGG
3d31A           TDLSPEKHDIAFVYQNYSLFPHMNVKKNLEFGMRMKKI---KDPKRVLDTARDLKIEHLLDRNPLTLSGG
2d62A           ADVPPKERDV-AVFQSYALYPH-TVYDNIAFPLKLRKVPKQEIDKRVREVAEL-GLTELLNRKPRELSGG
2awnC           ---------VGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGG
1v43A           TYLPPKDRNISMVFQ------HMTVYENIAFPLK--KFPKDEIDKRVRWAAELLQIEELLNRYPAQLSGG
1oxvA           ASVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGG
1oxsC           ASVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGG
2awnA           NDTPPAERGVGMVFQSYAL---------------------EVINQRVNQVAEVL----------------
2onkA           TPLPPERRGIGFVPQDYALFPHLSVYRNIAYGLXXXXXXXXXXXXXMAEKLGIAHL---LDRKPARLSGG
3fvqB           TNLPVRERRLGYLVQEGVLFPHLTVYRNIAYGLGNGKGRTAQERQRIEAMLELTGISELAGRYPHELSGG
3fvqA           TNLPVRERRLGYLVQEGVLFPHLTVYRNIAYGLGNGKGRTAQERQRIEAMLELTGISELAGRYPHELSGG
1oxxK           ASVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGX
3dhwC           SELTKARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLVGLGDKHDSYPSNLSGG
2oukB           KAKDTNREEVGMVFQRFNLFPHMTVLNNITLAMKVRKWPREKAEAKAMELLDKVGLKDKAHAYPDSLSGG
2oljA           KAKDTNREEVGMVFQRFNLFPHMTVLNNITLAMKVRKWPREKAEAKAMELLDKVGLKDKAHAYPDSLSGG
1l2tB           NDLKIRRDKIGFVFQQFNLIPLLTALENVELPLIFKAMSGEERRKRALECLKMAELERFANHKPNQLSGG
1l2tA           NDLKIRRDKIGFVFQQFNLIPLLTALENVELPLIFKAMSGEERRKRALECLKMAELERFANHKPNQLSGG
3gfoA           DGIMKLRESIGIVFQDNQLFS-ASVYQDVSFGAVNMKLPEDEIRKRVDNALKRTGIEHLKDKPTHCLSFG
1f3oA           NDLDDDRDKIGFVFQQFNLIPLLTALENVELPLKYRGASGEERRKRALECLKAELEERFANHKPNQLSGG
2yz2B           KGYEI-RRNIGIAFQPEDQFFAERVFDEVAFAVKNFYPDRDPV-PLVKKAMEFVGLDSFKDRVPFFLSGG
2yz2A           KGYEI-RRNIGIAFQPEDQFFAERVFDEVAFAVKNFYPDRDPV-PLVKKAMEFVGLDSFKDRVPFFLSGG
2hydA           KDTGSLRNQIGLVQQDNILFSD-TVKENILLG---RPTATD---EEVVEAAKMANAQGYDERGV-KLSGG
1mv5D           DNISLERSQIGFVSQDSAIMAG-TIRENLTYGLEGDYTDED-LWQVLDLAFARSFVENMPDQLNTEISGG
1mv5A           DNISLERSQIGFVSQDSAIMAG-TIRENLTYGLEGDYTDED-LWQVLDLAFARSFVENMPDQLNTEISGG
3g60A           KQLNVQRAQLGIVSQEPILFD-CSIAENIAYGDNSRVVSYEEIVRAAKEANIHQFIDSLPDKYNTQLSGG
3g5uA           KQLNVQRAQLGIVSQEPILFD-CSIAENIAYGDNSRVVSYEEIVRAAKEANIHQFIDSLPDKYNTQLSGG
1g6hA           NKEPAELYHYGIVFQTPQPLKEMTVLENLLIGLFYKKIPEEEMVEKAFKILEFLKLSHLYDRKAGELSGG
1gajA           NKEPAELYHYGIVFQTPQPLKEMTVLENLLIGLFYKKIPEEEMVEKAFKILEFLKLSHLYDRKAGELSGG
1g9xA           NKEPAELYHYGIVFQTPQPLKEMTVLENLLIGLFYKKIPKEEMVEKAFKILEFLKLSHLYDRKAGELSGG
1pf4A           RDYKLTRRHFALVSQNVHLFND-TIANNIAYAAE-GEYTREQIEQAARQAHAMEFIENMPDTVIGELSGG
1jj7A           PQYEHRHRQVAAVGQEPQVFGR-SLQENIAYGLTQKEITAAAVKSGAHSFISGLP-QGYDDEAGSQLSGG
2ghiA           NKYNRNSIRIGIVPQDTILFNETIKY-NILYG------KLDATDEEVIKATKSAQLDTIVGNKGMKLSGG
1b0uA           NLVRADKNQLRLVFQHFNLWSHMTVLENVMEAIQVLGLSKHDARERALKYLAKV---GIDERAQGKLSGG
2pcjA           DYTNEKERKLGFVFQFHYLIPELTALENVIVPMLKMGKPKKEAKERGEYLLSELGLGDKLSRKPYELSGG
2ghiC           NKYNRNSIRIGIVPQDTILFNETIKY-NILYG----KLDATEEVIKATKSAQLYALPKKWDTIVGGMKLG
1mt0A           ALADPNRRQVGVVLQDNVLLNR-SIIDNISLGMSVEKVIYAAKLAGAHDFISELR-EGYNTIVGEQLSGG
2ff7A           ALADPNRRQVGVVLQDNVLLNR-SIIDNISLGMSVEKVIYAAKLAGAHDFISELR-EGYNTIVGEQLSGG
2awnD           ----------------------------------------------------------------------
2fgkA           ALADPNRRQVGVVLQDNVLLNR-SIIDNISLGMSVEKVIYAAKLAGAHDFISELR-EGYNTIVGEQLSGG
2ffbA           ALADPNRRQVGVVLQDNVLLNR-SIIDNISLGMSVEKVIYAAKLAGAHDFISELR-EGYNTIVGEQLSGG
3b5jA           ALADPNRRQVGVVLQDNVLLNR-SIIDNISLGMSVEKVIYAAKLAGAHDFISELR-EGYNTIVGEQLSGG
2ixfC           VQYDHHHTQVAAVGQEPLLFGR-SFRENIAYGLT-RTPTMEEITAVAMESGAHDFISGFPDTEVGELSGG
2ixfA           VQYDHHHTQVAAVGQEPLLFGR-SFRENIAYGLT-RTPTMEEITAVAMESGAHDFISGFPDTEVGELSGG
1xefA           ALADPNRRQVGVVLQDNVLLNR-SIIDNISLGMSVEKVIYAAKLAGAHDFISELR-EGYNTIVGEQLSGG
2ffaA           ALADPNRRQVGVVLQDNVLLNR-SIIDNISLGMSVEKVIYAAKLAGAHDFISELR-EGYNTIVGEQLSGG
2ixfD           VQYDHHYLHTQVAAVGQLLFGR-SFRENIAYGLT-RTPTMEEITAVAMESGAHDFISGFPDTEVGELSGG
2ghiB           NKYNRNSIRIGIVPQDTILFNETIKY-NILYG------KLDATDEEVIKATKSAQLYDFIEALPKKLSGG
2ixeA           VQYDHHHTQVAAVGQEPLLFGR-SFRENIAYGLT-RTPTMEEITAVAMESGAHDFISGFPDTEVGELSGG
2ixeD           VQYDHHYLHTQVAAVGPLLFGR-SFRENIAYGLT-RTPTMEEITAVAMESGAHDFISGFPQGYDTELSGG
2awoD           ----------------------------------------------------------------------
2nq2D           -------QSIGFVPQFFSSPFAYSVLDIVLMGINTFAKPKSHDYQVAMQALDYLNLTHLAKREFTSLSGG
2ixgA           YDHHYLHTQVAAVGQEPLLFGR-SFRENIAYGL-TRTPTMEEITAVAMESGAHDFISGFPDTEVGELAVG
2nq2C           -------QSIGFVPQFFSSPFAYSVLDIVLMGINTFAKPKSHDYQVAMQALDYLNLTHLAKREFTSLSGG
1vplA           VEEPHEVRKLISYLPEEAAYRNMQGIEYLRFVAGFYASSSSEIEEMVERATEIAGLGEKIKDRVSTYSKG
2ghiD           NKYNRNSIRIGIVPQDTILFNETIKY-NILYG------KLDATDEEVIKATKSAQLYDFIEALPKKLSGG
2ihyA           YSAETVRQHIG--FVSHSLLEKFQEGERV-IDVVISGAIDDEIRNEAHQLLKLVG-SAKAQQYIGYLSTG
3bk7A           --TVAYKPQYIKAEYEGTVYELLSKIDSSKLNSNFYK----------TELLKPLGIIDLYDRNVEDLSGG
1ji0A           TNKPAHNRGIALVPEGRRIFPELTVYENLAYNRKDK----EGIKRDLEWIFSLFRLKERLKQLGGTLSGG
2ihyB           GYSAETVRQ-HIGFVSHSLLEKFRVIDVVISGIGVYQDIDDEIRNEAHQLLKLVG-SAKAQQYIGYLSTG
1yqtA           ---------LTVAYKP----QYIKAYEGTVYEL-LSKIDASKLNSNFTELLKPLGIIDLYDREVNELSGG
2d2fA           LELSPDERARKGLF---LAFQYVTIANFLRLALQAKEVGVAEFWTKVKKALELLDWDSYLSRYLNEFSGG
2d2eA           LELSPDERARKGLFLQYPVVPGVTIANFLRLALQAKEVGVAEFWTKVKKALELLDWDSYLSRYLNE---G
1xmiB           ----------ISFCSQFSWIMPGTIKENIIAGVSYDEY-------RYRSVIKACQLEEDISKIVLTLSGG
2bbsA           SFCSQNSWIMPGTIKENIIGVS---YDEYRYRSVIKACQLEEDISKFAEKDNIV---------LITLSGG
1q3hB           ----------VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGELSGG
2cbzA           AYVPQQ-----------AWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGELSGG
2bbtB           SFCSQNSWIMPGTIKENIIGVS---YDEYRYRSVIKACQLEEDISKFAEKDNIV--------LGITLSGG
2bbtA           SFCSQNSWIMPGTIKENIIGVS---YDEYRYRSVIKACQLEEDISKFAEKDNIV-LGGI------TLSGG
2bbsB           SFCSQNSWIMPGTIKENIIGVS---YDEYRYRSVIKACQLEEDISKFAEKDNIV-LGGI------TLSGG
2pzgA           SFCSQFSWIMPGTIKENIIFG--VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGG-----ITLSGG
2pzeB           SFCSQFSWIMPGTIKENIIFG--VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGG-----ITLSGG
2pzeA           SFCSQFSWIMPGTIKENIIFG--VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGG-----ITLSGG
1r10A           ----------VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGELSGG
1r0zD           ----------VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGELSGG
1r0zC           ----------VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGELSGG
1r0zB           ----------VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGELSGG
1r0zA           ----------VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGELSGG
1r0xD           ----------VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGELSGG
1r0xC           ----------VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGELSGG
1r0xB           ----------VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGELSGG
1r0xA           ----------VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGELSGG
1r0wC           ----------VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGELSGG
1r0wB           ----------VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGELSGG
1r0wA           ----------VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGELSGG
1q3hD           ----------VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGELSGG
1q3hC           ----------VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGELSGG
1q3hA           ----------VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGELSGG
2pzgB           ----------ISFCSQFSWIMPGTIKENIIFGVSYDEIKACQLEEDISKFAE-------KDNIVITLSGG
2pzfB           FCSQFSWIMPGTIKENIIGVS----YDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGG-----ITLSGG
2pzfA           FCSQFSWIMPGTIKENIIGVS----YDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGG-----ITLSGG
1xmiE           FCSQFSWIMPGTIKENIIAGVS---YDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGG-----ITLSGG
1xmiC           FCSQFSWIMPGTIKENIIAGVS---YDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGG-----ITLSGG
1xmiA           FCSQFSWIMPGTIKENIIAGVS---YDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGG-----ITLSGG
2zu0C           LALSPEDREIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMP--EDLLTRSVNGFSGG
1xmiD           ----------ISFCSQFSWIMPGTIKENIIAGVSYDEIKACQLEEDIS---KFAEKDNIVLGEIT-LSGG
2d3wA           LALSPEDREIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMP--EDLLTRSVNGFSGG
1xf9D           -----------SFCSQFSWIMPGTIKENIISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGELSGG
1xf9C           -----------SFCSQFSWIMPGTIKENIISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGELSGG
1xf9B           -----------SFCSQFSWIMPGTIKENIISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGELSGG
1xf9A           -----------SFCSQFSWIMPGTIKENIISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGELSGG
1xfaA           -----------SFCSQFSWIMPGTIKENIIRGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGELSGG
1sgwA           TKV---KGKIFFLPEEIIVPRKISVEDYLLYGVKVN-------KNEIMDALESVEVLDLK-KKLGELSQG
3b60A           RELASLRNQVALVSQNVHLFND-TVANNIAYAR-----TEEYSREQIEEAARMAKMDNGLDTIIGELSXX
1z2rA           RELASLRNQVALVSQNVHLFND-TVANNIAYAR-----TEEYSREQIEEAARMAKMDNGLDTIIGELSXX
2d3wC           LALSPEDREIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMP--EDLLTRSVNGFSGG
2d3wB           LALSPEDREIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMP--EDLLTRSVNGFSGG
2bboA           SFCSQFSWIMPGTIKENIIFG--VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGG-----ITLSEG
1xmjA           FCSQFSWIMPGTIKENIIGVS----YDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGG-----ITLSEG
2d3wD           LALSPEDREIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMP--EDLLTRSVNGFSGG
2ix3A           -DGFPTQEECRTVYVEHDIDGTHSDTSVLDFVFESGVGTKEAIKDKLIEF-------GFTDEMISALSGG
2iwhB           -DGFPTQEECRTVYVEHDIDGTHSDTSVLDFVFESGVGTKEAIKDKLIEF-------GFTDEMISALSGG
2pjzA           RKIRNYIRYSTNLPEAYEI--GVTVNDIVYLYEELKGLDRDLFLE-MLKALKL----GEERRKLYKLSAG
2ix8A           -----TQEECRTVYVEHDIDGTHSDTSVLDFVFESGVGTKEAIKDKLIEF-------GFTDEIISALSGG
2iw3B           -----TQEECRTVYVEHDIDGTHSDTSVLDFVFESGVGTKEAIKDKLIEF-------GFTDEIISALSGG
2iw3A           -----TQEECRTVYVEHDIDGTHSDTSVLDFVFESGVGTKEAIKDKLIEF-------GFTDEIISALSGG
2qi9C           EAWSATKLALHRAYLSQPVWHYLTLHQH------------DKTRELLNDVAGALALDDKLGRSTNQLSGG
1l7vC           EAWSATKLALHRAYLSQPVWHYLTLHQH------------DKTRELLNDVAGALALDDKLGRSTNQLSGG
2r6fB           GEVTAS------VTEALAFFDGLELTEKEA---QIARLILREIRDRLG-FLQNVGLDYLTSRSAGTLSGG
2r6fA           GEVTAS------VTEALAFFDGLELTEKEA---QIARLILREIRDRLG-FLQNVGLDYLTSRSAGTLSGG
2vf8B           ----------------------------------------------------------------TELSGG
2vf8A           ----------------------------------------------------------------TELSGG
2vf7C           ----------------------------------------------------------------TELSGG
2vf7B           ----------------------------------------------------------------TELSGG
2vf7A           ----------------------------------------------------------------TELSGG
1ii8B           -----------------------------------------------------------KERPLTFLSGG
1f2uD           -----------------------------------------------------------KERPLTFLSGG
1f2uB           -----------------------------------------------------------KERPLTFLSGG
1f2tB           -----------------------------------------------------------KERPLTFLSGG
2awnD           NDTPPAERGVGMV---------------------------------------------------------
2awoD           NDTPPAERGVGMV---------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           QRQRVAIARAIVLDPKVLLLDEPLSALDQKLRAEMQYELRSLQKKLGITFIFITHDQEEALAMSDEIFVL
2yyzA           QQQRVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKHLQQELGITSVYVTHDQAEAMTMASRIAVF
1z47B           XXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVHDEMGVTSVFVTHDQEEALEVADRVLVL
1z47A           XXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVHDEMGVTSVFVTHDQEEALEVADRVLVL
1g291           QRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLQRQLGVTTIYVTHDQVEAMTMGDRIAVM
2it1B           QQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELGITTVYVTHDQAEALAMADRIAVI
2it1A           QQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELGITTVYVTHDQAEALAMADRIAVI
1q12A           QRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVL
3fh6A           QRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVL
2awoA           QRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVL
2awnB           QRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVL
2r6gB           QRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVL
2r6gA           QRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVL
2awoC           QRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVL
3d31A           EQQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKNKLTVLHITHDQTEARIMADRIAVV
2d62A           QRQRVALGRAIIRRPKV-FLDEPLSNLDAKLRVK-RAELKKLQRQLGVTTIYVTHDQVEA---TGDRIAV
2awnC           QRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVL
1v43A           XXXXXXXXXXXXXEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKVTTIYVTHDQVEAMTMGDRIAVM
1oxvA           QQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRXXXX
1oxsC           QQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRXXXX
2awnA           -----AIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVL
2onkA           ERQRVALARALVIQPRLLLLDEPLSAVDLKTKGVLMEELRFVQREFDVPILHVTHDLIEAAMLADEVAVM
3fvqB           XXXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREDMIAALRANGKSAVFVSHDREEALQYADRIAVM
3fvqA           XXXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREDMIAALRANGKSAVFVSHDREEALQYADRIAVM
1oxxK           XXXXXXXXXXXXKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRXXXX
3dhwC           QKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVI
2oukB           QAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANE-GMTMVVVTHEMGFAREVGDRVLFM
2oljA           QAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANE-GMTMVVVTHEMGFAREVGDRVLFM
1l2tB           QQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEEDGKTVVVVTHDINVA-RFGERIIYL
1l2tA           QQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEEDGKTVVVVTHDINVA-RFGERIIYL
3gfoA           QKKRVAIAGVLVMEPKVLILDEPTAGLDPMGVSEIMKLLVEMQKELGXXXXXXXXXXXXVPLYCDNVFVM
1f3oA           QQQRVAIARALANNPPIILADEPTGALDSKTGEKIQL-LKKLNEEDGKTVVVVTHDINVA-RFGERIIYL
2yz2B           EKRRVAIASVIVHEPDILILDEPLVGLDREGKTDL---LRIVEKTLGKTVILISHDIETVINHVDRVVVL
2yz2A           EKRRVAIASVIVHEPDILILDEPLVGLDREGKTDL---LRIVEKTLGKTVILISHDIETVINHVDRVVVL
2hydA           QKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLSKDR--TTLIVAH-RLSTITHADKIVVI
1mv5D           QRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMK--GRTTLVIAH-RLSTIVDADKIYFI
1mv5A           QRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMK--GRTTLVIAH-RLSTIVDADKIYFI
3g60A           QKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKARE--GRTCIVIAH-RLSTIQNADLIVVI
3g5uA           QKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKARE--GRTCIVIAH-RLSTIQNADLIVVI
1g6hA           QMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAK-GITFLIIEHRLDIVLNYIDHLYVM
1gajA           QMKLVEIGRALMTNPKMIVMDQPIAGVAPGLAHDIFNHVLELKAK-GITFLIIEHRLDIVLNYIDHLYVM
1g9xA           QMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAK-GITFLIIEHRLDIVLNYIDHLYVM
1pf4A           QRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDELQKNK--TVLVIAH-RLSTIEQADEILVV
1jj7A           QRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLIT-QHLSLVEQADHILFL
2ghiA           ERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRKNR--TLIIIAH-RLSTISSAESIILL
1b0uA           QQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEE-GKTMVVVTHEMGFARHVSSHVIFL
2pcjA           EQQRVAIARALANEPILLFADEPTGNLDSANTKRVMDIFLKINEG-GTSIVMVTHERELA-ELTHRTLEM
2ghiC           ERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRKNR--TLIIIAH-RLSTISSAESIILL
1mt0A           QRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK--GRTVIIIAH-RLSTVKNADRIIVM
2ff7A           QRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK--GRTVIIIAH-RLSTVKNADRIIVM
2awnD           -----------MVEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVL
2fgkA           QRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKICK--GRTVIIIAH-RLSTVKNADRIIVM
2ffbA           QRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKICK--GRTVIIIAH-RLSTVKNADRIIVM
3b5jA           QRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK--GRTVIIIAH-RLSTVKNADRIIVM
2ixfC           QRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPEWASRTVLLITH-QLSLAERAHHILFL
2ixfA           QRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPEWASRTVLLITH-QLSLAERAHHILFL
1xefA           QRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK--GRTVIIIA-ARLSTVKNADRIIVM
2ffaA           QRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK--GRTVIIIA-ARLSTVKNADRIIVM
2ixfD           QRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPEWASRTVLLITH-QLSLAERAHHILFL
2ghiB           ERQRIAIARCLLKDPKIVIFDEATS--DSKTEYLFQKAVEDLRKNR--TLIIIAH---RTISSAESIILL
2ixeA           QRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEWASRTVLLIT--QQLSLARAHHILFL
2ixeD           QRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEWASRTVLLIT--QQLSLARAHHILFL
2awoD           -----------MVEPSVFLLDEPL---DAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVL
2nq2D           QRQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDLAQSQNMTVVFTTHQPNQVVAIANKTLLL
2ixgA           QRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEWASRTVLLIT--QQLSLARAHHILFL
2nq2C           QRQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDLAQSQNMTVVFTTHQPNQVVAIANKTLLL
1vplA           MVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQE-GLTILVSSHNMLEVEFLCDRIALI
2ghiD           ERQRIAIARCLLKDPKIVIFD------DSKTEYLFQKAVEDNR-----TLIIIAH-RLSTISSAESIILL
2ihyA           EKQRV-IARALG-QPQVLILDEPAAGLDFIAREXXXXXXXXXXXXYPTLAIYVTHFIEEITANFSKILLL
3bk7A           ELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLMEKNEKTALVVEHDVLMIDYVSDRLIV-
1ji0A           E-QQLAIGRAL---SRPKLLDEPSLGLAPILVSEVFEVIQKINQE-GTTILLVEQNALGALKVAHYGYVL
2ihyB           EKQRV-IARALG-QPQVLILDEPAAGLDFIAREXXXXXXXXXXXXYPTLAIYVTHFIEEITANFSKILLL
1yqtA           ELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLEKN-EKTALVVEHD--------------
2d2fA           EKKRNEILQLLVLEPTYAVLDETDSGLDID---ALKVVARGVNAMRGPNFLVITHYQRILYIQPDKVHVM
2d2eA           EKKRNEILQLLVLEPTYAVLDETDSGLDID---ALKVVARGVNAMRGPNFLVITHYQRILYIQPDKVHVM
1xmiB           QRARISLARAVYKDADLYLLDSPFGYLDVLTEKEI-FESCVCKLMANKTRILVTSKMEH-LKKADKILIL
2bbsA           QRARISLARAVYKDADLYLLDSPFGYLDVLTEKEI-FESCVCKLMANKTRILVTSKMEH-LKKADKILIL
1q3hB           QRARISLARAVYKDADLYLLDSPFGYLD-VFTEEQVFESCVCKLMANKTRILVTSKMEH-LRKADKILIL
2cbzA           QKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLNKTRILVTHSM-SYLPQVDVIIVM
2bbtB           QRARISLARAVYKDADLYLLDSPFGYLDVLTEKEI-FESCVCKLMANKTRILVTSKMEH-LKKADKILIL
2bbtA           QRARISLARAVYKDADLYLLDSPFGYLDVLTEKEI-FESCVCKLMANKTRILVTSKMEH-LKKADKILIL
2bbsB           QRARISLARAVYKDADLYLLDSPFGYLDVLTEKEI-FESCVCKLMANKTRILVTSKMEH-LKKADKILIL
2pzgA           QRARISLARAVYKDADLYLLDSPFGYLDVLTEKEI-FESCVCKLMANKTRILVTSKMEH-LKKADKILIL
2pzeB           QRARISLARAVYKDADLYLLDSPFGYLDVLTEKEI-FESCVCKLMANKTRILVTSKMEH-LKKADKILIL
2pzeA           QRARISLARAVYKDADLYLLDSPFGYLDVLTEKEI-FESCVCKLMANKTRILVTSKMEH-LKKADKILIL
1r10A           QRARISLARAVYKDADLYLLDSPFGYLD-VFTEEQVFESCVCKLMANKTRILVTSKMEH-LRKADKILIL
1r0zD           QRARISLARAVYKDADLYLLDSPFGYLD-VFTEEQVFESCVCKLMANKTRILVTSKMEH-LRKADKILIL
1r0zC           QRARISLARAVYKDADLYLLDSPFGYLD-VFTEEQVFESCVCKLMANKTRILVTSKMEH-LRKADKILIL
1r0zB           QRARISLARAVYKDADLYLLDSPFGYLD-VFTEEQVFESCVCKLMANKTRILVTSKMEH-LRKADKILIL
1r0zA           QRARISLARAVYKDADLYLLDSPFGYLD-VFTEEQVFESCVCKLMANKTRILVTSKMEH-LRKADKILIL
1r0xD           QRARISLARAVYKDADLYLLDSPFGYLD-VFTEEQVFESCVCKLMANKTRILVTSKMEH-LRKADKILIL
1r0xC           QRARISLARAVYKDADLYLLDSPFGYLD-VFTEEQVFESCVCKLMANKTRILVTSKMEH-LRKADKILIL
1r0xB           QRARISLARAVYKDADLYLLDSPFGYLD-VFTEEQVFESCVCKLMANKTRILVTSKMEH-LRKADKILIL
1r0xA           QRARISLARAVYKDADLYLLDSPFGYLD-VFTEEQVFESCVCKLMANKTRILVTSKMEH-LRKADKILIL
1r0wC           QRARISLARAVYKDADLYLLDSPFGYLD-VFTEEQVFESCVCKLMANKTRILVTSKMEH-LRKADKILIL
1r0wB           QRARISLARAVYKDADLYLLDSPFGYLD-VFTEEQVFESCVCKLMANKTRILVTSKMEH-LRKADKILIL
1r0wA           QRARISLARAVYKDADLYLLDSPFGYLD-VFTEEQVFESCVCKLMANKTRILVTSKMEH-LRKADKILIL
1q3hD           QRARISLARAVYKDADLYLLDSPFGYLD-VFTEEQVFESCVCKLMANKTRILVTSKMEH-LRKADKILIL
1q3hC           QRARISLARAVYKDADLYLLDSPFGYLD-VFTEEQVFESCVCKLMANKTRILVTSKMEH-LRKADKILIL
1q3hA           QRARISLARAVYKDADLYLLDSPFGYLD-VFTEEQVFESCVCKLMANKTRILVTSKMEH-LRKADKILIL
2pzgB           QRARISLARAVYKDADLYLLDSPFGYLDVLTEKEI-FESCVCKLMANKTRILVTSKMEH-LKKADKILIL
2pzfB           QRARISLARAVYKDADLYLLDSPFGYLDVLTEKEI-FESCVCKLMANKTRILVTSKMEH-LKKADKILIL
2pzfA           QRARISLARAVYKDADLYLLDSPFGYLDVLTEKEI-FESCVCKLMANKTRILVTSKMEH-LKKADKILIL
1xmiE           QRARISLARAVYKDADLYLLDSPFGYLDVLTEKEI-FESCVCKLMANKTRILVTSKMEH-LKKADKILIL
1xmiC           QRARISLARAVYKDADLYLLDSPFGYLDVLTEKEI-FESCVCKLMANKTRILVTSKMEH-LKKADKILIL
1xmiA           QRARISLARAVYKDADLYLLDSPFGYLDVLTEKEI-FESCVCKLMANKTRILVTSKMEH-LKKADKILIL
2zu0C           EKKRNDILQMAVLEPELCILDESDSGLDLKVVADGVNSLRDGKR----SFIIVTHYQRILYIKPDYVHVL
1xmiD           QRARISLARAVYKDADLYLLDSPFGYLDVLTEKEI-FESCVCKLMANKTRILVTSKMEH-LKKADKILIL
2d3wA           EKKRNDILQMAVLEPELCILDESDSGLDLKVVADGVNSLRDGKR----SFIIVTHYQRILYIKPDYVHVL
1xf9D           QRARISLARAVYKDADLYLLDSPFGYLD-VFTEEQVFESCVCKLMANKTRILVTSKMEH-LRKADKILIL
1xf9C           QRARISLARAVYKDADLYLLDSPFGYLD-VFTEEQVFESCVCKLMANKTRILVTSKMEH-LRKADKILIL
1xf9B           QRARISLARAVYKDADLYLLDSPFGYLD-VFTEEQVFESCVCKLMANKTRILVTSKMEH-LRKADKILIL
1xf9A           QRARISLARAVYKDADLYLLDSPFGYLD-VFTEEQVFESCVCKLMANKTRILVTSKMEH-LRKADKILIL
1xfaA           QRARISLARAVYKDADLYLLDSPFGYLD-VFTEEQVFESCVCKLMANKTRILVTSKMEH-LRKADKILIL
1sgwA           TIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEKGIVII-------------------
3b60A           XXXXXXXXXXXXXDSPILILDEATSALDTESERAIQAALDELQKNR--TSLVIAH---------------
1z2rA           XXXXXXXXXXXXXDSPILILDEATSALDTESERAIQAALDELQKNR--TSLVIAH---------------
2d3wC           EKKRNDILQMAVLEPELCILDESDDIDALKVVADGVNSLRDGKR----SFIIVTHYQRILYIKPDYVHVL
2d3wB           EKKRNDILQMAVLEPELCILDES-DSLDLKVVADGVNSLRDGKR----SFIIVTHYRILDYIKPDYVHVL
2bboA           QQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEI-FESCVCKLMANKTRILVTSKMEH-LKKADKILIL
1xmjA           QQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEI-FESCVCKLMANKTRILVTSKMEH-LKKADKILIL
2d3wD           EKKRNDILQMAVLEPELCILDESLDIDALKVVADGVNSLRDGKR----SFIIVTHYQRILYIKPDYVHVL
2ix3A           WKMKLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYLNT----CGITSITISHD--------------
2iwhB           WKMKLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYLNT----CGITSITISHD--------------
2pjzA           QSVLVRTSLALASQPEIVGLDEPFENVD----AARRHVISRYIKEYGKEGILVTHE--------------
2ix8A           WK-KLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYLNT----CGITSITISHD--------------
2iw3B           WK-KLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYLNT----CGITSITISHD--------------
2iw3A           WK-KLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYLNT----CGITSITISHD--------------
2qi9C           EWQRVRLA-AVVLQGQLLLLDEP-NSLDVAQQSALDKILSALSQQ-GLA-IVSSHDLNHTLRHAHRAWLL
1l7vC           EWQRVRLA-AVVLQGQLLLLDEP-NSLDVAQQSALDKILSALCQQ-GLA-IVSSHDLNHTLRHAHRAWLL
2r6fB           EAQRIRLATQIRLTGVLYVLDEPSIGLHQRDNDRLIATLKS--RDLGNTLIVVEHD-EDTLAADYLIDII
2r6fA           EAQRIRLATQIRLTGVLYVLDEPSIGLHQRDNDRLIATLKS--RDLGNTLIVVEHD-EDTLAADYLIDII
2vf8B           EAQRIKLATELRRSGRVYVLDEPTTGLHPADVERLQRQLVKL-VDAGNTVIAVEH-KMQVVAASDWVLDI
2vf8A           EAQRIKLATELRRSGRVYVLDEPTTGLHPADVERLQRQLVKL-VDAGNTVIAVEH-KMQVVAASDWVLDI
2vf7C           EAQRIKLATELRRSGRVYVLDEPTTGLHPADVERLQRQLVKL-VDAGNTVIAVEH-KMQVVAASDWVLDI
2vf7B           EAQRIKLATELRRSGRVYVLDEPTTGLHPADVERLQRQLVKL-VDAGNTVIAVEH-KMQVVAASDWVLDI
2vf7A           EAQRIKLATELRRSGRVYVLDEPTTGLHPADVERLQRQLVKL-VDAGNTVIAVEH-KMQVVAASDWVLDI
1ii8B           ERIALGLAFRLAMEISLLILDEPTPYLDEERRRKLITIMERYLKKIP-QVILVSHDEELKDAADHVIRIL
1f2uD           ERIALGLAFRLAMEISLLILDEPTPYLDEERRRKLITIMERYLKKIP-QVILVSHDEELKDAADHVIRIL
1f2uB           ERIALGLAFRLAMEISLLILDEPTPYLDEERRRKLITIMERYLKKIP-QVILVSHDEELKDAADHVIRIL
1f2tB           ERIALGLAFRLAMEISLLILDEPTPYLDEERRRKLITIMERYLKKIP-QVILVSHDEELKDAADHVIRIL
2awnD           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           NNGNIVQSGTPVDIYDEPINHYVADFIGESNIVNGIMIKDELVEFAGQQFPCVDGGMKPNEPVEVVIRPE
2yyzA           NQGKLVQYGTPDEVYDSPKNMFVASFIGNTNFLRDFSVSVENKQTILKRDDVI---IKLPEPVDVKLK-E
1z47B           HEGNVEQFGTPEEVYEKPGTLFVASFIGESNVWTR-AVQNGRIEVAGAALP-VDPXXXXXXXXXXXXRPK
1z47A           HEGNVEQFGTPEEVYEKPGTLFVASFIGESNVWTR-AVQNGRIEVAGAALP-VDPXXXXXXXXXXXXRPK
1g291           NRGVLQQVGSPDEVYDKPANTFVAGFIGSMNFLDAIVTEDGFVDFGPDQFEVLGELGYVGREVIFGIRPE
2it1B           REGEILQVGTPDEVYYKPKYKFVGGFLGNMNFVEAKVEDGKLVITEKSKLPI------PKQYVEIV----
2it1A           REGEILQVGTPDEVYYKPKYKFVGGFLGNMNFVEAKVEDGKLVITEKSKLPI------PKQYVEIV----
1q12A           DAGRVAQVGKPLELYHYPADRFVAGFIG------------------------------------------
3fh6A           DAGRVAQVGKPLELYHYPADRFVAGFIG------------------------------------------
2awoA           DAGRVAQVGKPLELYHYPADRFVAGFIG------------------------------------------
2awnB           DAGRVAQVGKPLELYHYPADRFVAGFIG------------------------------------------
2r6gB           DAGRVAQVGKPLELYHYPADRFVAGFIG------------------------------------------
2r6gA           DAGRVAQVGKPLELYHYPADRFVAGFIG------------------------------------------
2awoC           DAGRVAQVGKPLELYHYPADRFVAGFIG------------------------------------------
3d31A           MDGKLIQVGKPEEIFEKPVEGRVASFVGFENVLKGRVISAELRIRVGEVVIDAAGDMEVGDQVYAFLRPE
2d62A           NKGELQQVGTPDEVYYKPVNTFVAGFIGSPNFLDATITDDGFLDFGQDQFEVLE---EENVGKEVIIRPE
2awnC           DAGRVAQVGKPLELYHYPADRFVAGFIG------------------------------------------
1v43A           NRGQLLQIGSPTEVYLRPNSVFVATFIGEMNILE-VSVGDGYLEGRG-----------------------
1oxvA           XXXXXXXXXXPEDLYDNPVSIQVASLIGEINELEG-KVTNEGVVIGSLRFPV----SVSSDRAIIGIRPE
1oxsC           XXXXXXXXXXPEDLYDNPVSIQVASLIGEINELEG-KVTNEGVVIGSLRFPV----SVSSDRAIIGIRPE
2awnA           DAGRVAQVGKPLELYHYPADRFVAGFIG------------------------------------------
2onkA           LNGRIVEKGKLKELFSAK-NGEVAEFLSARNLL-------------------------------------
3fvqB           KQGRILQTASPHELYRQPADLDAALFIGEGIVFPAALNADGTADCRLGRLP-VQSGAPAGTRGTLLIRPE
3fvqA           KQGRILQTASPHELYRQPADLDAALFIGEGIVFPAALNADGTADCRLGRLP-VQSGAPAGTRGTLLIRPE
1oxxK           XXXXXXXXXXPEDLYDNPVSIQVASLIGEINELEG-KVTNEGVVIGSLRFPV----SVSSDRAIIGIRPE
3dhwC           SNGELIEQDTVSEVFSHPKTPLAQKFI-------------------------------------------
2oukB           DGGYIIEEGKPEDLFDRPQHERTKAFLSK-----------------------------------------
2oljA           DGGYIIEEGKPEDLFDRPQHERTKAFLSK-----------------------------------------
1l2tB           KDGEV-----------------------------------------------------------------
1l2tA           KDGEV-----------------------------------------------------------------
3gfoA           KEGRVILQGNPKEVFAE-----------------------------------------------------
1f3oA           KDGEV-----------------------------------------------------------------
2yz2B           EKGKKVFDGTRMEFLEK-----------------------------------------------------
2yz2A           EKGKKVFDGTRMEFLEK-----------------------------------------------------
2hydA           ENGHIVETGT------------------------------------------------------------
1mv5D           EKGQITGSG-------------------------------------------------------------
1mv5A           EKGQITGSG-------------------------------------------------------------
3g60A           QNGKVKEHGT------------------------------------------------------------
3g5uA           QNGKVKEHGT------------------------------------------------------------
1g6hA           FNGQIIAEGRG----EEEIKNVLSDYIGE-----------------------------------------
1gajA           FNGQIIAEGRG----EEEIKNVLSDYIGE-----------------------------------------
1g9xA           FNGQIIAEG-------------------------------------------------------------
1pf4A           DEGEIIERGRHAD---------------------------------------------------------
1jj7A           EGGAIREGGT------------------------------------------------------------
2ghiA           NKGKIVEKGTHKDL--------------------------------------------------------
1b0uA           HQGKIEEEGDPEQVFGNPQSPRLQQFL-------------------------------------------
2pcjA           KDGKVVGEITRV----------------------------------------------------------
2ghiC           NKGKIVEKGTHKDL--------------------------------------------------------
1mt0A           EKGKIVEQG-------------------------------------------------------------
2ff7A           EKGKIVEQG-------------------------------------------------------------
2awnD           DAGRVAQVGKPLELYHYPADRFVAGFIG------------------------------------------
2fgkA           EKGKIVEQG-------------------------------------------------------------
2ffbA           EKGKIVEQG-------------------------------------------------------------
3b5jA           EKGKIVEQG-------------------------------------------------------------
2ixfC           KEGSVCEQGTHLQLME------------------------------------------------------
2ixfA           KEGSVCEQGTHLQLME------------------------------------------------------
1xefA           EKGKIVEQG-------------------------------------------------------------
2ffaA           EKGKIVEQG-------------------------------------------------------------
2ixfD           KEGSVCEQGTHLQLME------------------------------------------------------
2ghiB           NKGKIVEKGTHKDL--------------------------------------------------------
2ixeA           KEGSVCEQGTHLQLME------------------------------------------------------
2ixeD           KEGSVCEQGTHLQLME------------------------------------------------------
2awoD           DAGRVAQVGKPLELYHYPADRFVAGFIG------------------------------------------
2nq2D           NKQN------------------------------------------------------------------
2ixgA           KEGSVCEQGTHLQLME------------------------------------------------------
2nq2C           NKQN------------------------------------------------------------------
1vplA           HNGTIVETGT------------------------------------------------------------
2ghiD           NKGKIVEKGTHKDL--------------------------------------------------------
2ihyA           KDGQSIQQGAVEDI--------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1ji0A           ETGQIVLEGKASELLDNEV---------------------------------------------------
2ihyB           KDGQSIQQGAVEDI--------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
2d2fA           MDGRVVATGGP-----------------------------------------------------------
2d2eA           MDGRVVATGGP-----------------------------------------------------------
1xmiB           HEGSSYFYGT------------------------------------------------------------
2bbsA           HEGSSYFYGT------------------------------------------------------------
1q3hB           HQGSSYFYGT------------------------------------------------------------
2cbzA           SGGKISEMGS------------------------------------------------------------
2bbtB           HEGSSYFYGT------------------------------------------------------------
2bbtA           HEGSSYFYGT------------------------------------------------------------
2bbsB           HEGSSYFYGT------------------------------------------------------------
2pzgA           HEGSSYFYGT------------------------------------------------------------
2pzeB           HEGSSYFYGT------------------------------------------------------------
2pzeA           HEGSSYFYGT------------------------------------------------------------
1r10A           HQGSSYFYGT------------------------------------------------------------
1r0zD           HQGSSYFYGT------------------------------------------------------------
1r0zC           HQGSSYFYGT------------------------------------------------------------
1r0zB           HQGSSYFYGT------------------------------------------------------------
1r0zA           HQGSSYFYGT------------------------------------------------------------
1r0xD           HQGSSYFYGT------------------------------------------------------------
1r0xC           HQGSSYFYGT------------------------------------------------------------
1r0xB           HQGSSYFYGT------------------------------------------------------------
1r0xA           HQGSSYFYGT------------------------------------------------------------
1r0wC           HQGSSYFYGT------------------------------------------------------------
1r0wB           HQGSSYFYGT------------------------------------------------------------
1r0wA           HQGSSYFYGT------------------------------------------------------------
1q3hD           HQGSSYFYGT------------------------------------------------------------
1q3hC           HQGSSYFYGT------------------------------------------------------------
1q3hA           HQGSSYFYGT------------------------------------------------------------
2pzgB           HEGSSYFYGT------------------------------------------------------------
2pzfB           HEGSSYFYGT------------------------------------------------------------
2pzfA           HEGSSYFYGT------------------------------------------------------------
1xmiE           HEGSSYFYGT------------------------------------------------------------
1xmiC           HEGSSYFYGT------------------------------------------------------------
1xmiA           HEGSSYFYGT------------------------------------------------------------
2zu0C           YQGRIVKSG-------------------------------------------------------------
1xmiD           HEGSSYFYGT------------------------------------------------------------
2d3wA           YQGRIVKSG-------------------------------------------------------------
1xf9D           HQGSSYFYGT------------------------------------------------------------
1xf9C           HQGSSYFYGT------------------------------------------------------------
1xf9B           HQGSSYFYGT------------------------------------------------------------
1xf9A           HQGSSYFYGT------------------------------------------------------------
1xfaA           HQGSSYFYGT------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2d3wC           YQGRIVKSG-------------------------------------------------------------
2d3wB           YQGRIVKSG-------------------------------------------------------------
2bboA           HEGSSYFYGT------------------------------------------------------------
1xmjA           HEGSSYFYGT------------------------------------------------------------
2d3wD           YQGRIVKSG-------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2qi9C           KGGKLA-SGRREEVLTPP----------------------------------------------------
1l7vC           KGGKLA-SGRREEVLTPP----------------------------------------------------
2r6fB           HGGEVVAAGTPEEVND------------------------------------------------------
2r6fA           HGGEVVAAGTPEEVND------------------------------------------------------
2vf8B           DGGRLVAQGTPAEV--------------------------------------------------------
2vf8A           DGGRLVAQGTPAEV--------------------------------------------------------
2vf7C           DGGRLVAQGTPAEV--------------------------------------------------------
2vf7B           DGGRLVAQGTPAEV--------------------------------------------------------
2vf7A           DGGRLVAQGTPAEV--------------------------------------------------------
1ii8B           ENGS------------------------------------------------------------------
1f2uD           ENGS------------------------------------------------------------------
1f2uB           ENGS------------------------------------------------------------------
1f2tB           ENGS------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           DLVLTSPEKGQLKVKVDTQLFRGVHYEIRCTDALGNKWLVHSTKRAVPGENIGLSFGPEDIHVMRFNESE
2yyzA           VVVGIRPEHCRISRERVENSIPGVVYVV---EPLGRDIIVNTGKAPQPGENVFLVPDLRKIHL--FNPET
1z47B           DVELQPASEREAHAQVVRSAFKGSYSACWIRTKDGEVWEVH-----------------------------
1z47A           DVELQPASEREAHAQVVRSAFKGSYSACWIRTKDGEVWEVH-----------------------------
1g291           DL--------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
3d31A           NIALSSSIRNSLQGRVTEAWVLGVRVKVDCGVPLN----VLITRRSAPGVQIYARFKASSVHVLR-----
2d62A           DVHDASPEENTVKATVD-----------------------------------------------------
2awnC           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
1oxvA           DVKLS-----------------------------------------------------------------
1oxsC           DVKLS-----------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
3fvqB           QYSL------------------------------------------------------------------
3fvqA           QYSL------------------------------------------------------------------
1oxxK           DVKLS-----------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
3g60A           ----------------------------------------------------------------------
3g5uA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1ii8B           ----------------------------------------------------------------------
1f2uD           ----------------------------------------------------------------------
1f2uB           ----------------------------------------------------------------------
1f2tB           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           EDxxxxxxxxxx
2yyzA           EE----------
1z47B           ------------
1z47A           ------------
1g291           ------------
2it1B           ------------
2it1A           ------------
1q12A           ------------
3fh6A           ------------
2awoA           ------------
2awnB           ------------
2r6gB           ------------
2r6gA           ------------
2awoC           ------------
3d31A           ------------
2d62A           ------------
2awnC           ------------
1v43A           ------------
1oxvA           ------------
1oxsC           ------------
2awnA           ------------
2onkA           ------------
3fvqB           ------------
3fvqA           ------------
1oxxK           ------------
3dhwC           ------------
2oukB           ------------
2oljA           ------------
1l2tB           ------------
1l2tA           ------------
3gfoA           ------------
1f3oA           ------------
2yz2B           ------------
2yz2A           ------------
2hydA           ------------
1mv5D           ------------
1mv5A           ------------
3g60A           ------------
3g5uA           ------------
1g6hA           ------------
1gajA           ------------
1g9xA           ------------
1pf4A           ------------
1jj7A           ------------
2ghiA           ------------
1b0uA           ------------
2pcjA           ------------
2ghiC           ------------
1mt0A           ------------
2ff7A           ------------
2awnD           ------------
2fgkA           ------------
2ffbA           ------------
3b5jA           ------------
2ixfC           ------------
2ixfA           ------------
1xefA           ------------
2ffaA           ------------
2ixfD           ------------
2ghiB           ------------
2ixeA           ------------
2ixeD           ------------
2awoD           ------------
2nq2D           ------------
2ixgA           ------------
2nq2C           ------------
1vplA           ------------
2ghiD           ------------
2ihyA           ------------
3bk7A           ------------
1ji0A           ------------
2ihyB           ------------
1yqtA           ------------
2d2fA           ------------
2d2eA           ------------
1xmiB           ------------
2bbsA           ------------
1q3hB           ------------
2cbzA           ------------
2bbtB           ------------
2bbtA           ------------
2bbsB           ------------
2pzgA           ------------
2pzeB           ------------
2pzeA           ------------
1r10A           ------------
1r0zD           ------------
1r0zC           ------------
1r0zB           ------------
1r0zA           ------------
1r0xD           ------------
1r0xC           ------------
1r0xB           ------------
1r0xA           ------------
1r0wC           ------------
1r0wB           ------------
1r0wA           ------------
1q3hD           ------------
1q3hC           ------------
1q3hA           ------------
2pzgB           ------------
2pzfB           ------------
2pzfA           ------------
1xmiE           ------------
1xmiC           ------------
1xmiA           ------------
2zu0C           ------------
1xmiD           ------------
2d3wA           ------------
1xf9D           ------------
1xf9C           ------------
1xf9B           ------------
1xf9A           ------------
1xfaA           ------------
1sgwA           ------------
3b60A           ------------
1z2rA           ------------
2d3wC           ------------
2d3wB           ------------
2bboA           ------------
1xmjA           ------------
2d3wD           ------------
2ix3A           ------------
2iwhB           ------------
2pjzA           ------------
2ix8A           ------------
2iw3B           ------------
2iw3A           ------------
2qi9C           ------------
1l7vC           ------------
2r6fB           ------------
2r6fA           ------------
2vf8B           ------------
2vf8A           ------------
2vf7C           ------------
2vf7B           ------------
2vf7A           ------------
1ii8B           ------------
1f2uD           ------------
1f2uB           ------------
1f2tB           ------------
2awnD           ------------
2awoD           ------------