[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:ABD98951.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3gbhB.bssp"
#ERROR : Can't open dsspfile "3gbhA.bssp"
#ERROR : Can't open dsspfile "3ge6A.bssp"
#ERROR : Can't open dsspfile "3gagB.bssp"
#ERROR : Can't open dsspfile "3gagA.bssp"
#ERROR : Can't open dsspfile "1kqbA.bssp"
#ERROR : Can't open dsspfile "3gagC.bssp"
#ERROR : Can't open dsspfile "3hznH.bssp"
#ERROR : Can't open dsspfile "3hznA.bssp"
#ERROR : Can't open dsspfile "3hznC.bssp"
#ERROR : Can't open dsspfile "1v5yA.bssp"
#ERROR : Can't open dsspfile "2b67A.bssp"
#ERROR : Can't open dsspfile "1icvA.bssp"
#ERROR : Can't open dsspfile "3bemB.bssp"
#ERROR : Can't open dsspfile "3bemA.bssp"
#ERROR : Can't open dsspfile "1icuB.bssp"
#ERROR : Can't open dsspfile "1icrA.bssp"
#ERROR : Can't open dsspfile "3gh8D.bssp"
#ERROR : Can't open dsspfile "3gh8B.bssp"
#ERROR : Can't open dsspfile "3gh8A.bssp"
#ERROR : Can't open dsspfile "3gfdB.bssp"
#ERROR : Can't open dsspfile "3gfdA.bssp"
#ERROR : Can't open dsspfile "2hayD.bssp"
#ERROR : Can't open dsspfile "2hayC.bssp"
#ERROR : Can't open dsspfile "2hayB.bssp"
#ERROR : Can't open dsspfile "2hayA.bssp"
#ERROR : Can't open dsspfile "3ge5B.bssp"
#ERROR : Can't open dsspfile "3ge5A.bssp"
#ERROR : Can't open dsspfile "3gb5A.bssp"
#ERROR : Can't open dsspfile "1noxA.bssp"
#ERROR : Can't open dsspfile "3gr3A.bssp"
#ERROR : Can't open dsspfile "3e10A.bssp"
#ERROR : Can't open dsspfile "3eo8A.bssp"
#ERROR : Can't open dsspfile "2isjA.bssp"
#ERROR : Can't open dsspfile "1ywqA.bssp"

## Summary of PDB Search
:214
    2e-35  45%  3gbhB  [x.x.x] NAD(P)H-FLAVIN OXIDOREDUCTASE
    2e-35  45%  3gbhA  [x.x.x] NAD(P)H-FLAVIN OXIDOREDUCTASE
    3e-31  44%  3ge6A  [x.x.x] NITROREDUCTASE
    4e-15  36%  3gagB  [x.x.x] PUTATIVE NADH DEHYDROGENASE, NADPH
    4e-15  36%  3gagA  [x.x.x] PUTATIVE NADH DEHYDROGENASE, NADPH
    1e-13  33%  1kqbA  [d.90.1] OXYGEN-INSENSITIVE NAD(P)H NITROREDUCTASE
    4e-13  33%  3gagC  [x.x.x] PUTATIVE NADH DEHYDROGENASE, NADPH
    2e-12  30%  3hznH  [x.x.x] OXYGEN-INSENSITIVE NAD(P)H NITROREDUCTASE
    2e-12  30%  3hznA  [x.x.x] OXYGEN-INSENSITIVE NAD(P)H NITROREDUCTASE
    4e-12  30%  3hznC  [x.x.x] OXYGEN-INSENSITIVE NAD(P)H NITROREDUCTASE
    6e-10  23%  1v5yA  [d.90.1 (1vfrA)] MAJOR NAD(P)H-FLAVIN OXIDOREDUCTASE
    7e-10  27%  2b67A  [x.x.x] COG0778: NITROREDUCTASE
    9e-10  28%  1icvA  [d.90.1] OXYGEN-INSENSITIVE NAD(P)H NITROREDUCTASE
    2e-09  26%  3bemB  [x.x.x] PUTATIVE NAD(P)H NITROREDUCTASE YDFN
    2e-09  26%  3bemA  [x.x.x] PUTATIVE NAD(P)H NITROREDUCTASE YDFN
    2e-09  28%  1icuB  [d.90.1] OXYGEN-INSENSITIVE NAD(P)H NITROREDUCTASE
    2e-09  28%  1icrA  [d.90.1] OXYGEN-INSENSITIVE NAD(P)H NITROREDUCTASE
    6e-07  35%  3gh8D  [x.x.x] IODOTYROSINE DEHALOGENASE 1
    6e-07  35%  3gh8B  [x.x.x] IODOTYROSINE DEHALOGENASE 1
    6e-07  35%  3gh8A  [x.x.x] IODOTYROSINE DEHALOGENASE 1
    6e-07  35%  3gfdB  [x.x.x] IODOTYROSINE DEHALOGENASE 1
    6e-07  35%  3gfdA  [x.x.x] IODOTYROSINE DEHALOGENASE 1
    1e-06  30%  2hayD  [x.x.x] PUTATIVE NAD(P)H-FLAVIN OXIDOREDUCTASE
    1e-06  30%  2hayC  [x.x.x] PUTATIVE NAD(P)H-FLAVIN OXIDOREDUCTASE
    1e-06  30%  2hayB  [x.x.x] PUTATIVE NAD(P)H-FLAVIN OXIDOREDUCTASE
    1e-06  30%  2hayA  [x.x.x] PUTATIVE NAD(P)H-FLAVIN OXIDOREDUCTASE
    1e-05  52%  3ge5B  [x.x.x] PUTATIVE NAD(P)H:FMN OXIDOREDUCTASE
    1e-05  52%  3ge5A  [x.x.x] PUTATIVE NAD(P)H:FMN OXIDOREDUCTASE
    1e-05  34%  3gb5A  [x.x.x] IODOTYROSINE DEHALOGENASE 1
    2e-05  25%  1noxA  [x.x.x] NADH OXIDASE
    4e-05  29%  3gr3A  [x.x.x] NITROREDUCTASE
    5e-05  45%  3e10A  [x.x.x] PUTATIVE NADH OXIDASE
    2e-04  40%  3eo8A  [x.x.x] BLUB-LIKE FLAVOPROTEIN
    3e-04  26%  2isjA  [x.x.x] BLUB
    8e-04  26%  1ywqA  [x.x.x] NITROREDUCTASE FAMILY PROTEIN
:214

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxKNNDFESVMLGRHSVRKFDTSVKIPREELKEMVANAITAPSACNLQAWHFIVVDTPEGKDKLRSFF
3gbhB           ------NDFNEVLNSRKSVKVFDENYKIPREE-DEIITKATKAPSSVN-QPWRIAVVQSDE-KEKVKESF
3gbhA           ------NDFNEVLNSRKSVKVFDENYKIPREE-DEIITKATKAPSSVN-QPWRIAVVQSDE-KEKVKESF
3ge6A           -------DFE-IVKGRRSIRNYDTNVKISKEET-QILEEATLAPSSVN-QPWRFLVIDSEEGKATLAPL-
3gagB           ------NDYLNFLDGRVSVRRFDPDAVLPNDLIKDL-EHASYAPSGNNFQPWRVVVVKNKNKQEDLKK--
3gagA           ------NDYLNFLDGRVSVRRFDPDAVLPNDLIKDL-EHASYAPSGNNFQPWRVVVVKNKNKQEDLKK--
1kqbA           -------DIISVALKRHSTKAFDASKKLTAEEAEKIKTLLQYSPSSTNSQPWHFIVASTEEGKAKSAAGT
3gagC           ------NDYLNFLDGRVSVRRFDPDAVLPNDLIKDL-EHASYAPSGNNFQPWRVVVVKNKNKQEDLKK--
3hznH           -----NADIVSVALQRYSTKAFDPSKKLTAEEADKIKTLLQYSPSSTNSQPWHFIVASTEEGKARVKSAA
3hznA           -----NADIVSVALQRYSTKAFDPSKKLTAEEADKIKTLLQYSPSSTNSQPWHFIVASTEEGKARVKSAA
3hznC           -------DIVSVALQRYSTKAFDPSKKLTAEEADKIKTLLQYSPSSTNSQPWHFIVASTEEGKARVKSAA
1v5yA           ---------------RYTSKKYDPSKKVSQEDLAVLLEALRLSASSINSQPWKFIVIESDAAKQRMHDSF
2b67A           ---------------RHATKHFTDKLVDPKD-VRTAIEIATLAPSAHNSQPWKFVVV--REKNAELAKLA
1icvA           -------DIISVALKRHSTKAFDASKKLTPEQAEQIKTLLQYSPSSTNSQPWHFIVASTEEGKARVAKSA
3bemB           -------EFTHLVNERRSASNFLSGHPITKEDLNEFELVAL-APSAFNLQHTKYVTVLDQDVKEKLKQ--
3bemA           -------EFTHLVNERRSASNFLSGHPITKEDLNEFELVAL-APSAFNLQHTKYVTVLDQDVKEKLKQ--
1icuB           -------DIISVALKRHSTKAFDASKKLTPEQAEQIKTLLQYSPSSTNSQPWHFIVASTEEGKARVAKSA
1icrA           -------DIISVALKRHSTKAFDASKKLTPEQAEQIKTLLQYSPSSTNSQPWHFIVASTEEGKARVAKSA
3gh8D           ----RSQEFYELLNKRRSVR-FISSEHVPMEVIENVIKAAGTAPSGAHTEPWTFVVVKDPDMKHKIR---
3gh8B           ----RSQEFYELLNKRRSVR-FISSEHVPMEVIENVIKAAGTAPSGAHTEPWTFVVVKDPDMKHKIR---
3gh8A           ----RSQEFYELLNKRRSVR-FISSEHVPMEVIENVIKAAGTAPSGAHTEPWTFVVVKDPDMKHKIR---
3gfdB           ----RSQEFYELLNKRRSVR-FISSEHVPMEVIENVIKAAGTAPSGAHTEPWTFVVVKDPDMKHKIR---
3gfdA           ----RSQEFYELLNKRRSVR-FISSEHVPMEVIENVIKAAGTAPSGAHTEPWTFVVVKDPDMKHKIR---
2hayD           --------------------------KISDEDLALILDAAWLSPSSIGLEGWRFVVLDNKPIKEEIKPFA
2hayC           --------------------------KISDEDLALILDAAWLSPSSIGLEGWRFVVLDNKPIKEEIKPFA
2hayB           --------------------------KISDEDLALILDAAWLSPSSIGLEGWRFVVLDNKPIKEEIKPFA
2hayA           --------------------------KISDEDLALILDAAWLSPSSIGLEGWRFVVLDNKPIKEEIKPFA
3ge5B           ---------------RRSVRKF---IDRPVEEEKLAILEARIAPSAHNYQPWHFLVVREEEGRKRL----
3ge5A           ---------------RRSVRKF---IDRPVEEEKLAILEARIAPSAHNYQPWHFLVVREEEGRKRL----
3gb5A           ----RSQEFYELLNKRRSVR-FISSEHVPMEVIENVIKAAGTAPSGAHTEPWTFVVVKDPDMK-------
1noxA           -------DAKTAALKRRSIRRYRKD-PVPEGXXXXXXXXXXXXPSAWNLQPWRIVVVRDPATKRALRE--
3gr3A           --------FQSI-LSRKSIRAF-TDQPVTQETIREILKLAARAPSGTNLQPWQVIVL-TGKILQKVGQ--
3e10A           ---------------------------------------AAQAPSAGNQQPWEFIVLEDRENIDKLSNFS
3eo8A           -------ELQDTIFKRQSVRKFKNQDVSDEDILKIKAAGA--APSGKNIQNWHFVVI-------------
2isjA           ---------------RRDVRDEFLPEPLSEELIARLLGAAHQAPSVGFMQPWNFVLVRQDETREKVWQAF
1ywqA           -------NLKEAIVNRRSIRKVTKNDAITKERIEEVLKTALHAPTSFNMQSGRMVVL-------------


                         .         .         *         .         .         .         .:140
query           MKFNLPQLETSSAIVMLFGDTLAFKKYRALWENIYEQKQISKEELDRILNTFLPLYENADKQLLTADAMV
3gbhB           -GFNSRQLTTSSALI-IFGDLQNYEKAEQIYGDAVEQ-QLTEDIKAQLLDWILPYYKNLSREGKDI-VNI
3gbhA           -GFNSRQLTTSSALI-IFGDLQNYEKAEQIYGDAVEQ-QLTEDIKAQLLDWILPYYKNLSREGKDI-VNI
3ge6A           AKFNQVQVETSSAVIAVFGD-----KAIDQLENIYDEKGLPQEVRDRQVPA-IQGYENVPASALKDSILI
3gagB           LAALQPQVATASAVFLLFGDENAYD--LTWWQEFHVQKGITKDEAERIRQYFDLHPEDKETQGLRLDVGL
3gagA           LAALQPQVATASAVFLLFGDENAYD--LTWWQEFHVQKGITKDEAERIRQYFDLHPEDKETQGLRLDVGL
1kqbA           YVFNERKMLDASHVVVFCAKT--------AMDDAWLERVVDQEEADGRFNT--PEAKAANHKGRTVDLKD
3gagC           LAALQPQVATASAVFLLFGDENAYD--LTWWQEFHVQKXXXXXXXXXXXXQYFDLHEDKETQGLRLDVGL
3hznH           GNYTFNERKLDASHVVVFCAKTA--------DDAWLERVVDQEDADGRFATPEAKAANDKGRRFFADHRV
3hznA           GNYTFNERKLDASHVVVFCAKTA--------DDAWLERVVDQEDADGRFATPEAKAANDKGRRFFADHRV
3hznC           GNYTFNERKLDASHVVVFCAKTA--------DDAWLERVVDQEDADGRFATPEAKAANDKGRRFFADHRV
1v5yA           AQFNQPHIKACSHVI-LFANKLSYTRYDVVLSKAVADKRITEEQKEAAFASFLNCDENGEHKAWTKP---
2b67A           YGSNFEQVSSAPVTIALFTDTDLAKRARKI-ARVGGANNFSEEQLQYFKNLPAEFARYSEQQV--SDYXX
1icvA           YVFNERKLDASHVVVFCAKTA----------DDVWLKLVVDQEDADGRFATPEAKAANDKGRKFFADHRK
3bemB           AANGQYKXXXXXXXXXXXGDKQAYQQAADIYEGLKVLGILNKQEYDHVQDT-VSFYENRGEQFKRDEAIR
3bemA           AANGQYKXXXXXXXXXXXGDKQAYQQAADIYEGLKVLGILNKQEYDHVQDT-VSFYENRGEQFKRDEAIR
1icuB           YVFNERKMLDASHVVVFCAKT--------AMDDVWLKLVVDQEDADGRFATPEAKAANDKGRKFFADLHD
1icrA           YVFNERKMLDASHVVVFCAKT--------AMDDVWLKLVVDQEDADGRFATPEAKAANDKGRKFFADLHD
3gh8D           ----------------------------------------------------------------------
3gh8B           ----------------------------------------------------------------------
3gh8A           ----------------------------------------------------------------------
3gfdB           ----------------------------------------------------------------------
3gfdA           ----------------------------------------------------------------------
2hayD           WGAQY-QLETASHFILLIAEKHARYDSPAI-KNSLLRRGIKEGD---GLNSRLKLYESFQKEDDADNPRA
2hayC           WGAQY-QLETASHFILLIAEKHARYDSPAI-KNSLLRRGIKEGD---GLNSRLKLYESFQKEDDADNPRA
2hayB           WGAQY-QLETASHFILLIAEKHARYDSPAI-KNSLLRRGIKEGD---GLNSRLKLYESFQKEDDADNPRA
2hayA           WGAQY-QLETASHFILLIAEKHARYDSPAI-KNSLLRRGIKEGD---GLNSRLKLYESFQKEDDADNPRA
3ge5B           ----------------------------------------------------------------------
3ge5A           ----------------------------------------------------------------------
3gb5A           ----------------------------------------------------------------------
1noxA           AAFGQAHVEEAPVVLVLYADLEDALAH--LDEVIHPGVQGERREAQKIQRAFAAMGQEARK----AWASG
3gr3A           --------ELSQLVLSGIKGEREYHYYPRQWRDLYKSLGIQKEKLHQKAKNFL-FYGAPVGLLFTIDHDE
3e10A           KYAN--SLKTAPLAIVLLAD---------------EEKKISEWEQD------------------------
3eo8A           ----------------------------------------------------------------------
2isjA           QRAN------DEAAEMFSGERQA--KYRSLLEGIRKAPLSICVTCDRTRGGAVVLGRTHNPQM----DLY
1ywqA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           DSSLAAMQFMLAARAHGYDTNPIAGYDAKKAATALGLDPERYVPVMAIAVGKADSQSTDIKSTRYSVDDV
3gbhB           DSSLAQL---LTAKAHGYDTNPIGGFDKENIADIIGYDSDRYVPVLAIAIGKKAQDAHD--SVRLPIDDV
3gbhA           DSSLAQL---LTAKAHGYDTNPIGGFDKENIADIIGYDSDRYVPVLAIAIGKKAQDAHD--SVRLPIDDV
3ge6A           DSGLVSQ--LLVARAHGYDTNPIGGYEKDQIAEAFG-EKDRYVPVL-LSIGKA--VDAGYPSVRLPINDI
3gagB           FANLQVV------RVYGYDSVPRVDFDAIKTY----LDPNGWEPIL-LPVGKA-----------------
3gagA           FANLQVV------RVYGYDSVPRVDFDAIKTY----LDPNGWEPIL-LPVGKA-----------------
1kqbA           DDQWMAKQFLLGVGAMGLDAVPIEGFDAAILDEEFGLKEKGFTSLVVVPVG-------------------
3gagC           FANLQVV------RVYGYDSVPRVDFDAIKTY----LDPNGWEPIL-LPVGKA-----------------
3hznH           DHQWAKQVYLLLGVAAGLDAVPIEGFDAEVLDAEFGLKEKGYTSLVVVPVG-------------------
3hznA           DHQWAKQVYLLLGVAAGLDAVPIEGFDAEVLDAEFGLKEKGYTSLVVVPVG-------------------
3hznC           DHQWAKQVYLLLGVAAGLDAVPIEGFDAEVLDAEFGLKEKGYTSLVVVPVG-------------------
1v5yA           QAYLALGNALHTLARLNIDSTTMEGIDPELLSEIFADELKGYECHVALAIGPSEDYNASLPKSRKAFEDV
2b67A           XXXXXXXXXXXXXTDQGIGSNIILGFDKSKVNEVLEIE-DRFRPELLITVGYTDEKLE--PSYRLPVDEI
1icvA           DLHLNVGNFXXXXXXXXXXXXPIEGFDAAILDAEFGLKEKGYTSLVVVPVG-------------------
3bemB           N---XXXXXXXXXXXXGWDTCPI-GFDAEAVKRILNIDDQFEV---VITIGKEKTESRRPRGYRKPVNEF
3bemA           N---XXXXXXXXXXXXGWDTCPI-GFDAEAVKRILNIDDQFEV---VITIGKEKTESRRPRGYRKPVNEF
1icuB           DAEWMAKQFXXXXXXXXXXXXPIEGFDAAILDAEFGLKEKGYTSLVVVPVG-------------------
1icrA           DAEWMAKQFXXXXXXXXXXXXPIEGFDAAILDAEFGLKEKGYTSLVVVPVG-------------------
3gh8D           ----------------------------------------------------------------------
3gh8B           ----------------------------------------------------------------------
3gh8A           ----------------------------------------------------------------------
3gfdB           ----------------------------------------------------------------------
3gfdA           ----------------------------------------------------------------------
2hayD           LFDWTAKQTYIAAALLGIDTCPIEGFHYDK----------------------------------------
2hayC           LFDWTAKQTYIAAALLGIDTCPIEGFHYDK----------------------------------------
2hayB           LFDWTAKQTYIAAALLGIDTCPIEGFHYDK----------------------------------------
2hayA           LFDWTAKQTYIAAALLGIDTCPIEGFHYDK----------------------------------------
3ge5B           ----------------------------------------------------------------------
3ge5A           ----------------------------------------------------------------------
3gb5A           ----------------------------------------------------------------------
1noxA           QSXXXXXXXXXXXXXXXXXSVPMLGFDPERVRAILGLPSRAAIPAL-VALG-------------------
3gr3A           GSWLLGFQTILAARGFGLDTCAQAAFAHKQIRSLLSVPSDRHIICGALGY-RDNAPENNFETEREPIDNF
3e10A           ----------------------------------------------------------------------
3eo8A           ----------------------------------------------------------------------
2isjA           STVCAVQNLWLAARAEGVGVGWVSIFHESEIKAILGI-PDHVEIVAWLCLGFVD----------------
1ywqA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IEFQ
3gbhB           REF-
3gbhA           REF-
3ge6A           ADWK
3gagB           ----
3gagA           ----
1kqbA           ----
3gagC           ----
3hznH           ----
3hznA           ----
3hznC           ----
1v5yA           I---
2b67A           IE--
1icvA           ----
3bemB           VEY-
3bemA           VEY-
1icuB           ----
1icrA           ----
3gh8D           ----
3gh8B           ----
3gh8A           ----
3gfdB           ----
3gfdA           ----
2hayD           ----
2hayC           ----
2hayB           ----
2hayA           ----
3ge5B           ----
3ge5A           ----
3gb5A           ----
1noxA           ----
3gr3A           VHF-
3e10A           ----
3eo8A           ----
2isjA           ----
1ywqA           ----