[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:rpmE

[Show Plain Result]

#ERROR : Can't open dsspfile "2hgu3.bssp"
#ERROR : Can't open dsspfile "1yl34.bssp"
#ERROR : Can't open dsspfile "1vs6Z.bssp"
#ERROR : Can't open dsspfile "2j014.bssp"

## Summary of PDB Search
:82
    5e-10  52%  2hgu3  [x.x.x] 50S RIBOSOMAL PROTEIN L31
    4e-09  48%  1yl34  [i.1.1 (1vor1)] 50S RIBOSOMAL PROTEIN L31
    1e-08  39%  1vs6Z  [x.x.x] 50S RIBOSOMAL PROTEIN L31
    1e-04  56%  2j014  [x.x.x] 50S RIBOSOMAL PROTEIN L31
:82

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKQGIHPDYHEVVFMDSATGYKFLSGSTKNSEETIEWEDGNTYPLIRVEISSDSHPFYTGRQKFTQADGR
2hgu3           -------------------------------------ETYSTKPEIYVEVCSKCHPFYTGQQRFVDTEGR
1yl34           -------------------------------------ETMSTRPEIHVDVWSGVHPFWTGEERFLDTEGR
1vs6Z           MKKDIHPKYEEITASCSC-------GNVMKIRSTVGHD-------LNLDVCSKCHPFFTGKQRDVATGGR
2j014           -------------------------------------ETYSTKPEIYVEVCSKCHPFYTGQQRF------


                         .         .         *         .         .         .         .:140
query           VDRFNKKYGxxx
2hgu3           VERFQRRYG---
1yl34           VDKFNKRFG---
1vs6Z           VDRFNKRF----
2j014           ------------