[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:rbsK

[Show Plain Result]

#ERROR : Can't open dsspfile "1rkdA.bssp"
#ERROR : Can't open dsspfile "1gqtB.bssp"
#ERROR : Can't open dsspfile "1gqtA.bssp"
#ERROR : Can't open dsspfile "1vm7B.bssp"
#ERROR : Can't open dsspfile "1vm7A.bssp"
#ERROR : Can't open dsspfile "2fv7A.bssp"
#ERROR : Can't open dsspfile "3ikhA.bssp"
#ERROR : Can't open dsspfile "3ikhC.bssp"
#ERROR : Can't open dsspfile "3i3yB.bssp"
#ERROR : Can't open dsspfile "3ikhB.bssp"
#ERROR : Can't open dsspfile "3in1A.bssp"
#ERROR : Can't open dsspfile "3h49A.bssp"
#ERROR : Can't open dsspfile "3cqdB.bssp"
#ERROR : Can't open dsspfile "3cqdA.bssp"
#ERROR : Can't open dsspfile "3h49B.bssp"
#ERROR : Can't open dsspfile "1tz6B.bssp"
#ERROR : Can't open dsspfile "1tz6A.bssp"
#ERROR : Can't open dsspfile "2v78A.bssp"
#ERROR : Can't open dsspfile "3iq0B.bssp"
#ERROR : Can't open dsspfile "3iq0A.bssp"
#ERROR : Can't open dsspfile "2c4eA.bssp"
#ERROR : Can't open dsspfile "2c49B.bssp"
#ERROR : Can't open dsspfile "2c49A.bssp"
#ERROR : Can't open dsspfile "2nwhA.bssp"
#ERROR : Can't open dsspfile "3ie7A.bssp"
#ERROR : Can't open dsspfile "3hicA.bssp"
#ERROR : Can't open dsspfile "2rbcA.bssp"
#ERROR : Can't open dsspfile "3ewmA.bssp"
#ERROR : Can't open dsspfile "1tz3A.bssp"
#ERROR : Can't open dsspfile "3ih0A.bssp"
#ERROR : Can't open dsspfile "3gbuA.bssp"
#ERROR : Can't open dsspfile "1tz3B.bssp"
#ERROR : Can't open dsspfile "1tyyA.bssp"
#ERROR : Can't open dsspfile "3julA.bssp"
#ERROR : Can't open dsspfile "1tyyB.bssp"
#ERROR : Can't open dsspfile "2qcvA.bssp"
#ERROR : Can't open dsspfile "2i6aA.bssp"
#ERROR : Can't open dsspfile "1bx4A.bssp"
#ERROR : Can't open dsspfile "1lioA.bssp"
#ERROR : Can't open dsspfile "1dh2A.bssp"
#ERROR : Can't open dsspfile "1j5vB.bssp"
#ERROR : Can't open dsspfile "1liiA.bssp"
#ERROR : Can't open dsspfile "1dgyA.bssp"
#ERROR : Can't open dsspfile "2afbB.bssp"
#ERROR : Can't open dsspfile "1lijA.bssp"
#ERROR : Can't open dsspfile "1dh1A.bssp"
#ERROR : Can't open dsspfile "2afbA.bssp"
#ERROR : Can't open dsspfile "1v1bA.bssp"
#ERROR : Can't open dsspfile "1v19A.bssp"
#ERROR : Can't open dsspfile "2absA.bssp"
#ERROR : Can't open dsspfile "2abqA.bssp"
#ERROR : Can't open dsspfile "2jg5A.bssp"
#ERROR : Can't open dsspfile "2a9yA.bssp"
#ERROR : Can't open dsspfile "1j5vD.bssp"
#ERROR : Can't open dsspfile "1dgmA.bssp"
#ERROR : Can't open dsspfile "2i6bA.bssp"
#ERROR : Can't open dsspfile "2i6bB.bssp"
#ERROR : Can't open dsspfile "1lhpA.bssp"
#ERROR : Can't open dsspfile "1j5vA.bssp"
#ERROR : Can't open dsspfile "1lhrA.bssp"
#ERROR : Can't open dsspfile "1yhjA.bssp"
#ERROR : Can't open dsspfile "1rfuA.bssp"
#ERROR : Can't open dsspfile "1lhpB.bssp"
#ERROR : Can't open dsspfile "2q5rC.bssp"
#ERROR : Can't open dsspfile "2yxuB.bssp"
#ERROR : Can't open dsspfile "2yxuA.bssp"
#ERROR : Can't open dsspfile "2yxtB.bssp"
#ERROR : Can't open dsspfile "2yxtA.bssp"
#ERROR : Can't open dsspfile "3fhyB.bssp"
#ERROR : Can't open dsspfile "3fhyA.bssp"
#ERROR : Can't open dsspfile "3fhxB.bssp"
#ERROR : Can't open dsspfile "3fhxA.bssp"
#ERROR : Can't open dsspfile "2f7kA.bssp"
#ERROR : Can't open dsspfile "2ajpB.bssp"
#ERROR : Can't open dsspfile "2ajpA.bssp"
#ERROR : Can't open dsspfile "2i5bB.bssp"
#ERROR : Can't open dsspfile "2i5bD.bssp"
#ERROR : Can't open dsspfile "2i5bC.bssp"
#ERROR : Can't open dsspfile "2i5bA.bssp"
#ERROR : Can't open dsspfile "2q5rD.bssp"
#ERROR : Can't open dsspfile "2q5rB.bssp"
#ERROR : Can't open dsspfile "2q5rA.bssp"
#ERROR : Can't open dsspfile "2jgvD.bssp"
#ERROR : Can't open dsspfile "2jgvC.bssp"
#ERROR : Can't open dsspfile "2jgvB.bssp"
#ERROR : Can't open dsspfile "2jgvA.bssp"
#ERROR : Can't open dsspfile "2jg1D.bssp"
#ERROR : Can't open dsspfile "2jg1C.bssp"
#ERROR : Can't open dsspfile "2jg1A.bssp"
#ERROR : Can't open dsspfile "3ewmB.bssp"
#ERROR : Can't open dsspfile "2f02B.bssp"
#ERROR : Can't open dsspfile "2f02A.bssp"
#ERROR : Can't open dsspfile "2awdB.bssp"
#ERROR : Can't open dsspfile "2awdA.bssp"

## Summary of PDB Search
:307
    4e-57  41%  1rkdA  [c.72.1 (1gqtC)] RIBOKINASE
    4e-57  41%  1gqtB  [c.72.1] RIBOKINASE
    4e-57  41%  1gqtA  [c.72.1] RIBOKINASE
    1e-49  38%  1vm7B  [c.72.1] RIBOKINASE
    1e-49  38%  1vm7A  [c.72.1] RIBOKINASE
    9e-38  35%  2fv7A  [x.x.x] RIBOKINASE
    3e-24  30%  3ikhA  [x.x.x] CARBOHYDRATE KINASE
    3e-24  30%  3ikhC  [x.x.x] CARBOHYDRATE KINASE
    7e-22  30%  3i3yB  [x.x.x] CARBOHYDRATE KINASE
    1e-21  30%  3ikhB  [x.x.x] CARBOHYDRATE KINASE
    5e-17  30%  3in1A  [x.x.x] UNCHARACTERIZED SUGAR KINASE YDJH
    9e-17  30%  3h49A  [x.x.x] RIBOKINASE
    1e-15  26%  3cqdB  [x.x.x] 6-PHOSPHOFRUCTOKINASE ISOZYME 2
    3e-15  26%  3cqdA  [x.x.x] 6-PHOSPHOFRUCTOKINASE ISOZYME 2
    1e-14  30%  3h49B  [x.x.x] RIBOKINASE
    2e-14  28%  1tz6B  [c.72.1] PUTATIVE SUGAR KINASE
    3e-14  28%  1tz6A  [c.72.1] PUTATIVE SUGAR KINASE
    8e-13  29%  2v78A  [x.x.x] FRUCTOKINASE
    1e-12  28%  3iq0B  [x.x.x] PUTATIVE RIBOKINASE II
    1e-12  28%  3iq0A  [x.x.x] PUTATIVE RIBOKINASE II
    5e-12  24%  2c4eA  [x.x.x] SUGAR KINASE MJ0406
    5e-12  24%  2c49B  [x.x.x] SUGAR KINASE MJ0406
    5e-12  24%  2c49A  [x.x.x] SUGAR KINASE MJ0406
    8e-12  27%  2nwhA  [x.x.x] CARBOHYDRATE KINASE
    1e-11  25%  3ie7A  [x.x.x] LIN2199 PROTEIN
    1e-11  25%  3hicA  [x.x.x] LIN2199 PROTEIN
    1e-11  26%  2rbcA  [x.x.x] SUGAR KINASE
    4e-11  28%  3ewmA  [x.x.x] UNCHARACTERIZED SUGAR KINASE PH1459
    5e-11  28%  1tz3A  [c.72.1] PUTATIVE SUGAR KINASE
    7e-11  28%  3ih0A  [x.x.x] UNCHARACTERIZED SUGAR KINASE PH1459
    7e-11  28%  3gbuA  [x.x.x] UNCHARACTERIZED SUGAR KINASE PH1459
    9e-11  29%  1tz3B  [c.72.1] PUTATIVE SUGAR KINASE
    2e-10  28%  1tyyA  [c.72.1] PUTATIVE SUGAR KINASE
    4e-10  25%  3julA  [x.x.x] LIN2199 PROTEIN
    6e-10  27%  1tyyB  [c.72.1] PUTATIVE SUGAR KINASE
    7e-09  26%  2qcvA  [x.x.x] PUTATIVE 5-DEHYDRO-2-DEOXYGLUCONOKINASE
    3e-08  27%  2i6aA  [x.x.x] ADENOSINE KINASE
    3e-08  27%  1bx4A  [c.72.1] PROTEIN (ADENOSINE KINASE)
    6e-08  23%  1lioA  [c.72.1] ADENOSINE KINASE
    2e-07  23%  1dh2A  [x.x.x] ADENOSINE KINASE APO FORM
    2e-07  26%  1j5vB  [c.72.1] 2-KETO-3-DEOXYGLUCONATE KINASE
    3e-07  22%  1liiA  [c.72.1] ADENOSINE KINASE
    3e-07  23%  1dgyA  [x.x.x] ADENOSINE KINASE
    5e-07  28%  2afbB  [x.x.x] 2-KETO-3-DEOXYGLUCONATE KINASE
    6e-07  24%  1lijA  [c.72.1] ADENOSINE KINASE
    6e-07  23%  1dh1A  [x.x.x] ADENOSINE KINASE
    6e-07  28%  2afbA  [x.x.x] 2-KETO-3-DEOXYGLUCONATE KINASE
    1e-06  23%  1v1bA  [c.72.1] 2-KETO-3-DEOXYGLUCONATE KINASE
    1e-06  23%  1v19A  [c.72.1] 2-KETO-3-DEOXYGLUCONATE KINASE
    1e-06  24%  2absA  [x.x.x] ADENOSINE KINASE
    1e-06  21%  2abqA  [x.x.x] FRUCTOSE 1-PHOSPHATE KINASE
    1e-06  24%  2jg5A  [x.x.x] FRUCTOSE 1-PHOSPHATE KINASE
    1e-06  24%  2a9yA  [x.x.x] ADENOSINE KINASE
    2e-06  27%  1j5vD  [c.72.1] 2-KETO-3-DEOXYGLUCONATE KINASE
    2e-06  24%  1dgmA  [c.72.1] ADENOSINE KINASE
    2e-06  26%  2i6bA  [x.x.x] ADENOSINE KINASE
    4e-06  26%  2i6bB  [x.x.x] ADENOSINE KINASE
    7e-06  31%  1lhpA  [c.72.1] PYRIDOXAL KINASE
    9e-06  27%  1j5vA  [c.72.1] 2-KETO-3-DEOXYGLUCONATE KINASE
    1e-05  33%  1lhrA  [c.72.1] PYRIDOXAL KINASE
    3e-05  43%  1yhjA  [x.x.x] PYRIDOXAL KINASE
    3e-05  43%  1rfuA  [c.72.1] PYRIDOXAL KINASE
    3e-05  43%  1lhpB  [c.72.1] PYRIDOXAL KINASE
    4e-05  28%  2q5rC  [x.x.x] TAGATOSE-6-PHOSPHATE KINASE
    8e-05  38%  2yxuB  [x.x.x] PYRIDOXAL KINASE
    8e-05  38%  2yxuA  [x.x.x] PYRIDOXAL KINASE
    8e-05  38%  2yxtB  [x.x.x] PYRIDOXAL KINASE
    8e-05  38%  2yxtA  [x.x.x] PYRIDOXAL KINASE
    8e-05  38%  3fhyB  [x.x.x] PYRIDOXAL KINASE
    8e-05  38%  3fhyA  [x.x.x] PYRIDOXAL KINASE
    8e-05  38%  3fhxB  [x.x.x] PYRIDOXAL KINASE
    8e-05  38%  3fhxA  [x.x.x] PYRIDOXAL KINASE
    8e-05  38%  2f7kA  [x.x.x] PYRIDOXAL KINASE
    8e-05  38%  2ajpB  [x.x.x] PYRIDOXAL KINASE
    8e-05  38%  2ajpA  [x.x.x] PYRIDOXAL KINASE
    1e-04  29%  2i5bB  [x.x.x] PHOSPHOMETHYLPYRIMIDINE KINASE
    1e-04  32%  2i5bD  [x.x.x] PHOSPHOMETHYLPYRIMIDINE KINASE
    1e-04  32%  2i5bC  [x.x.x] PHOSPHOMETHYLPYRIMIDINE KINASE
    1e-04  32%  2i5bA  [x.x.x] PHOSPHOMETHYLPYRIMIDINE KINASE
    3e-04  28%  2q5rD  [x.x.x] TAGATOSE-6-PHOSPHATE KINASE
    3e-04  26%  2q5rB  [x.x.x] TAGATOSE-6-PHOSPHATE KINASE
    3e-04  26%  2q5rA  [x.x.x] TAGATOSE-6-PHOSPHATE KINASE
    3e-04  26%  2jgvD  [x.x.x] TAGATOSE-6-PHOSPHATE KINASE
    3e-04  26%  2jgvC  [x.x.x] TAGATOSE-6-PHOSPHATE KINASE
    3e-04  26%  2jgvB  [x.x.x] TAGATOSE-6-PHOSPHATE KINASE
    3e-04  26%  2jgvA  [x.x.x] TAGATOSE-6-PHOSPHATE KINASE
    3e-04  29%  2jg1D  [x.x.x] TAGATOSE-6-PHOSPHATE KINASE
    3e-04  29%  2jg1C  [x.x.x] TAGATOSE-6-PHOSPHATE KINASE
    3e-04  29%  2jg1A  [x.x.x] TAGATOSE-6-PHOSPHATE KINASE
    4e-04  29%  3ewmB  [x.x.x] UNCHARACTERIZED SUGAR KINASE PH1459
    8e-04  31%  2f02B  [x.x.x] TAGATOSE-6-PHOSPHATE KINASE
    8e-04  31%  2f02A  [x.x.x] TAGATOSE-6-PHOSPHATE KINASE
    8e-04  31%  2awdB  [x.x.x] TAGATOSE-6-PHOSPHATE KINASE
    8e-04  31%  2awdA  [x.x.x] TAGATOSE-6-PHOSPHATE KINASE
:307

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xSNKVTVLGSLNVDTILRIPRLPQPGETLKMDDIGVAGGGKGANQAISAARSKSHVTFIGGVGNDVQGEM
1rkdA           -AGSLVVLGSINADHILNLQSFPTPGETVTGNHYQVAFGGKGANQAVAAGRSGANIAFIACTGDDSIGES
1gqtB           -AGSLVVLGSINADHILNLQSFPTPGETVTGNHYQVAFGGKGANQAVAAGRSGANIAFIACTGDDSIGES
1gqtA           -AGSLVVLGSINADHILNLQSFPTPGETVTGNHYQVAFGGKGANQAVAAGRSGANIAFIACTGDDSIGES
1vm7B           ----ISVVGSSNIDIVLKVDHFTKPGETQKAIEMNVFPGGKGANQAVTVAKGEKGCRFVTCIGNDDYSDL
1vm7A           ----ISVVGSSNIDIVLKVDHFTKPGETQKAIEMNVFPGGKGANQAVTVAKGEKGCRFVTCIGNDDYSDL
2fv7A           ----VVVVGSCMTDLVSLTSRLPKTGETXXXXXXXXXXXXXXANQCVQAARLGAMTSMVCKVGKDSFGND
3ikhA           -SLRVYVTGNITVDETWSIPDIPKKGASIHGVKVSQDIGGKGANQAIILSRCGIETRLIAATGNDSNGAW
3ikhC           ---RVYVTGNITVDETWSIPDIPKKGASIHGVKVSQDIGGKGANQAIILSRCGIETRLIAATGNDSNGAW
3i3yB           ---RVYVTGNITVDETWSIPDIPKKGASIHGVKVSQDIGGKGANQAIILSRCGIETRLIAATGNDSNGAW
3ikhB           ---RVYVTGNITVDETWSIPDIPKKGASIHGVKVSQDIGGKGANQAIILSRCGIETRLIAATGNDSNGAW
3in1A           --------------------------------------GGDAINEATIISRL-GHRTALSRIGKDAAGQF
3h49A           --------------------------------------GGDAINEATIISRL-GHRTALSRIGKDAAGQF
3cqdB           --------------------------------------GGGGINVARAIAHLGGSATAIFPAGG-ATGEH
3cqdA           --------------------------------------GGGGINVARAIAHLGGSATAIFPAGG-ATGEH
3h49B           --------------------------------------GGDAINEATIISRL-GHRTALSRIGKDAAGQF
1tz6B           --NKVWVIGDASVDLV------PE-----KQNSYLKCPGGASANVGVCVARLGGECGFIGCLGDDDAGRF
1tz6A           --NKVWVIGDASVDLV------PE-----KQNSYLKCPGGASANVGVCVARLGGECGFIGCLGDDDAGRF
2v78A           ---------------------------------------GSELNFCIAVVRNHLSCSLIARVGNDEFGKN
3iq0B           ----------------------------------------------------------ISCVGNDGFGDI
3iq0A           ----------------------------------------------------------ISCVGNDGFGDI
2c4eA           ---KITCVGHTALDYIFNVEKFPEPNTSIQIPSARKYYGGAAANTAVGIKKLGVNSELLSCVGYDFKNSG
2c49B           ---KITCVGHTALDYIFNVEKFPEPNTSIQIPSARKYYGGAAANTAVGIKKLGVNSELLSCVGYDFKNSG
2c49A           ---KITCVGHTALDYIFNVEKFPEPNTSIQIPSARKYYGGAAANTAVGIKKLGVNSELLSCVGYDFKNSG
2nwhA           ---KILVLGGAHIDRRGMIETETAPGASNPGSWMEEAGGG-GFNAARNLSRLGFEVRIIAPRGGDVTGEV
3ie7A           --------------------------------------GGKGLH--VSGVLSKFGIKALGIAGSD-NLDK
3hicA           --------------------------------------GGKGLH--VSGVLSKFGIKALGIAGSD-NLDK
2rbcA           ----VLCVGAAVLDTLFRVADPKGEGKVLPYEVLQIA---EGASSAAYAVHRGGRASLWGAVGDDETGTR
3ewmA           --------------------------------------GGAPANVAVGVSRLGVKSSLISKVGNDPFGEY
1tz3A           --NKVWVIGDASVDLV------PE-----KQNSYLKCPGGASANVGVCVARLGGECGFIGCLGDDDAGRF
3ih0A           --------------------------------------GGAPANVAVGVSRLGVKSSLISKVGNDPFGEY
3gbuA           --------------------------------------GGAPANVAVGVSRLGVKSSLISKVGNDPFGEY
1tz3B           --NKVWVIGDASVDLV------PE-----KQNSYLKCPGGASANVGVCVARLGGECGFIGCLGDDDAGRF
1tyyA           --NKVWVIGDASVDLV------PE-----KQNSYLKCPGGASANVGVCVARLGGECGFIGCLGDDDAGRF
3julA           --------------------------------------GGKGLH--VSGVLSKFGIKALGIAGSD-NLDK
1tyyB           --NKVWVIGDASVDLV------PE-----KQNSYLKCPGGASANVGVCVARLGGECGFIGCLGDDDAGRF
2qcvA           --------------------------------------GGSPANIVIGSSKLGLKAGFIGKIADDQHGRF
2i6aA           --------------------------------------------------------TFFGCIGIDKFGEI
1bx4A           --------------------------------------------------------TFFGCIGIDKFGEI
1lioA           --------------------------------------------------RKPGSAGYMGAIGDDPRGQV
1dh2A           --------------------------------------------------RKPGSAGYMGAIGDDPRGQV
1j5vB           ----------------------PDHKRIFQTDSFDVTYGGAEANVAAFLAQGLD-AYFVTKLPNNPLGDA
1liiA           --------------------------------------------------RKPGSAGYMGAIGDDPRGQV
1dgyA           --------------------------------------------------RKPGSAGYMGAIGDDPRGQV
2afbB           ----------------------PDHKRIFQTDSFDVTYGGAEANVAAFLAQGLD-AYFVTKLPNNPLGDA
1lijA           --------------------------------------------------RKPGSAGYMGAIGDDPRGQV
1dh1A           --------------------------------------------------RKPGSAGYMGAIGDDPRGQV
2afbA           ----------------------PDHKRIFQTDSFDVTYGGAEANVAAFLAQGLD-AYFVTKLPNNPLGDA
1v1bA           -----------------------EPGHLRGKRLLEVYVGGAEVNVAVALARLGVKVGFVGRVGEDELGAM
1v19A           -----------------------EPGHLRGKRLLEVYVGGAEVNVAVALARLGVKVGFVGRVGEDELGAM
2absA           --------------------------------------------------RKPGSAGYMGAIGDDPRGQV
2abqA           -----TVTLNPSIDYIVQVENFQQ-GVVNRSERDRKQPGGKGINVSRVLKRLGHETKALGFLGG-FTGAY
2jg5A           --------------------------------------GGKGINVSRVLKTLDVESTALGFAGG-FPGKF
2a9yA           --------------------------------------------------RKPGSAGYMGAIGDDPRGQV
1j5vD           ----------------------PDHKRIFQTDSFDVTYGGAEANVAAFLAQGLD-AYFVTKLPNNPLGDA
1dgmA           --------------------------------------------------RKPGSAGYMGAIGDDPRGQV
2i6bA           --------------------------------------------------------TFFGCIGIDKFGEI
2i6bB           --------------------------------------------------------TFFGCIGIDKFGEI
1lhpA           ----------------------------------------------------------------------
1j5vA           ----------------------PDHKRIFQTDSFDVTYGGAEANVAAFLAQGLD-AYFVTKLPNNPLGDA
1lhrA           ----------------------------------------------------------------------
1yhjA           ----------------------------------------------------------------------
1rfuA           ----------------------------------------------------------------------
1lhpB           ----------------------------------------------------------------------
2q5rC           ------------------------PLTALKLDDVNKTAGGKGLNVTRVLAQVGEPVLASGFIGGEL-GQF
2yxuB           ----------------------------------------------------------------------
2yxuA           ----------------------------------------------------------------------
2yxtB           ----------------------------------------------------------------------
2yxtA           ----------------------------------------------------------------------
3fhyB           ----------------------------------------------------------------------
3fhyA           ----------------------------------------------------------------------
3fhxB           ----------------------------------------------------------------------
3fhxA           ----------------------------------------------------------------------
2f7kA           ----------------------------------------------------------------------
2ajpB           ----------------------------------------------------------------------
2ajpA           ----------------------------------------------------------------------
2i5bB           ----------------------------------------------------------------------
2i5bD           ----------------------------------------------------------------------
2i5bC           ----------------------------------------------------------------------
2i5bA           ----------------------------------------------------------------------
2q5rD           ------------------------PLTALKLDDVNKTAGGKGLNVTRVLAQVGEPVLASGFIGGEL-GQF
2q5rB           ------------------------PLTALKLDDVNKTAGGKGLNVTRVLAQVGEPVLASGFIGGEL-GQF
2q5rA           ------------------------PLTALKLDDVNKTAGGKGLNVTRVLAQVGEPVLASGFIGGEL-GQF
2jgvD           ------------------------PLTALKLDDVNKTAGGKGLNVTRVLAQVGEPVLASGFIGGEL-GQF
2jgvC           ------------------------PLTALKLDDVNKTAGGKGLNVTRVLAQVGEPVLASGFIGGEL-GQF
2jgvB           ------------------------PLTALKLDDVNKTAGGKGLNVTRVLAQVGEPVLASGFIGGEL-GQF
2jgvA           ------------------------PLTALKLDDVNKTAGGKGLNVTRVLAQVGEPVLASGFIGGEL-GQF
2jg1D           ------------------------PLTALKLDDVNKTAGGKGLNVTRVLAQVGEPVLASGFIGGEL-GQF
2jg1C           ------------------------PLTALKLDDVNKTAGGKGLNVTRVLAQVGEPVLASGFIGGEL-GQF
2jg1A           ------------------------PLTALKLDDVNKTAGGKGLNVTRVLAQVGEPVLASGFIGGEL-GQF
3ewmB           --------------------------------------GGAPANVAVGVSRLGVKSSLISKVGNDPFGEY
2f02B           ----------------------------------------------------------------------
2f02A           ----------------------------------------------------------------------
2awdB           ----------------------------------------------------------------------
2awdA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           MLKLLKEDGININNVAKLNEGTGQAFILLQESGENSIVIYGGANQAIKTTVIQNAMNDIKDSDFLVAQFE
1rkdA           VRQQLATDNIDITPVSVIKESTGVALIFVNGEGENVIGIHAGANAALSPALVEAQRERIANASALLMQLE
1gqtB           VRQQLATDNIDITPVSVIKESTGVALIFVNGEGENVIGIHAGANAALSPALVEAQRERIANASALLMQLE
1gqtA           VRQQLATDNIDITPVSVIKESTGVALIFVNGEGENVIGIHAGANAALSPALVEAQRERIANASALLMQLE
1vm7B           LIE--NYEKLGITGYIRVSLPTGRAFIEVDKTGQNRIIIFPGANAELKKELID--WNTLSESDILLLQNE
1vm7A           LIE--NYEKLGITGYIRVSLPTGRAFIEVDKTGQNRIIIFPGANAELKKELID--WNTLSESDILLLQNE
2fv7A           YIENLKQNDISTEFTYQTKDATGTASIIVNNEGQNIIVIVAGANLLLNTEDLRAAANVISRAKVMVCQLE
3ikhA           IRQQIKNEPLLLPD-GHFNQHSDTSIILNSADGDNXXXXXXXXXXXFSLDEIPHA--DAVAGDILLQQGN
3ikhC           IRQQIKNEPLLLPD-GHFNQHSDTSIILNSADGDNXXXXXXXXXXXFSLDEIPHA--DAVAGDILLQQGN
3i3yB           IRQQIKNEPLLLPD-GHFNQHSDTSIIL---ADGNXXXXXXXXXXXFSLDEIPHA--DAVAGDILLQQGN
3ikhB           IRQQIKNEPLLLPD-GHFNQHSDTSIIL--NSXXXXXXXXXXXXXXFSLDEIPHA--DAVAGDILLQQGN
3in1A           ILDHCRKENIDIQSLKQVSIDTSINVGLVTEDGERTFVTNNGSLWKLNIDDVDFARFSQAKLLSLASIFN
3h49A           ILDHCRKENIDIQSLKQVSIDTSINVGLVTEDGERTFVTNNGSLWKLNIDDVDFARFSQAKLLSLASIFN
3cqdB           LVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQRFVMPGAALNEDEFRQLEEQVLEIESGAILVISGS
3cqdA           LVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQRFVMPGAALNEDEFRQLEEQVLEIESGAILVISGS
3h49B           ILDHCRKENIDIQSLKQVSIDTSINVGLVTEDGERTFVTNNGSLWKLNIDDVDFARFSQAKLLSLASIFN
1tz6B           LRQVFQDNGVDVTFL-RLDADLTSAVLIVNFT----YLVHPGAD----TYVSPQDLPPFRQYEWFIGLTD
1tz6A           LRQVFQDNGVDVTFL-RLDADLTSAVLIVNSF---TYLVHPGAD----TYVSPQDLPPFRQYEWFIGLTD
2v78A           IIEYSRAQGIDTSHIKVDNESTGIYFI---QRGKSELVYYGSAGSRLSPEDIENYVRNVHSTGITLAISD
3iq0B           NIHRLAADGVDIRGISVLPEATGSAFVTYGDRDFIFNIKNAACGKLSAQHVDENILKDCTHFHIGSSLFS
3iq0A           NIHRLAADGVDIRGISVLPEATGSAFVTYHNRDFIFNIKNAACGKLSAQHVDENILKDCTHFHIGSSLFS
2c4eA           YERYLKNLDINISKLYSEEEETPKAWIFTDKDNNQITFFLWGAAKHYKELNPPNFNTEIGDPEFNLKCAK
2c49B           YERYLKNLDINISKLYSEEEETPKAWIFTDKDNNQITFFLWGAAKHYKELNPPNFNTEIGDPEFNLKCAK
2c49A           YERYLKNLDINISKLYSEEEETPKAWIFTDKDNNQITFFLWGAAKHYKELNPPNFNTEIGDPEFNLKCAK
2nwhA           VAEAARQAGVEDTPFTFLDRRTPSYTAILERDG-NLVIALADMDRRLKVRAVREA---IIASDFLLCDAN
3ie7A           LYAILKEKHINHDFLVEAGTSTRECFVVLSDDTNGSTIPEAGVSQTNKDNLLKQIAKKVKKEDVVIAGSP
3hicA           LYAILKEKHINHDFLVEAGTSTRECFVVLSDDTNGSTIPEAGVSQTNKDNLLKQIAKKVKKEDVVIAGSP
2rbcA           ILRDLSESGIDTSGTVAPGARSALSTIIIDNRGERLIVPFYDHRLHEKKRAC--TPEDIALFDAVLVDVR
3ewmA           LIEELSKENVDTRGIVKEKKHTGIVFVQL-KGASPSFLLY-------DDVAYFNTLNDINVEEAKIVNFG
1tz3A           LRQVFQDNGVDVTFL-RLDADLTSAVLIVNSF---TYLVHPGAD----TYVSPQDLPPFRQYEWF---YF
3ih0A           LIEELSKENVDTRGIVKEKKHTGIVFVQL-KGASPSFLLY-------DDVAYFNTLNDINVEEAKIVNFG
3gbuA           LIEELSKENVDTRGIVKEKKHTGIVFVQL-KGASPSFLLY-------DDVAYFNTLNDINVEEAKIVNFG
1tz3B           LRQVFQDNGVDVTFL-RLDADLTSAVLIVNFT----YLVHPGAD----TYVSPQDLPPFRQYEWF---YF
1tyyA           LRQVFQDNGVDVTFL-RLDADLTSAVLIVNSF---TYLVHPGAD----TYVSPQDLPPFRQYEWF---YF
3julA           LYAILKEKHINHDFLVEAGTSTRECFVVLSDDTNGSTIPEAGVSQTNKDNLLKQIAKKVKKEDVVIAGSP
1tyyB           LRQVFQDNGVDVTFL-RLDADLTSAVLIVNFT----YLVHPGAD----TYVSPQDLPPFRQYEWF---YF
2qcvA           -IESYRGVGVDTSNLVVDQEGTGLAFTEIKSPEECSILYRQDADLYLSPEEVNEAY--IRRSKLLLALSK
2i6aA           LKRKAAEAHVDAHYYEQNEQPTGTCAACITGDNRSLIANLAAANCYKKEKLVEKARVCYIAGFFLTVSPE
1bx4A           LKRKAAEAHVDAHYYEQNEQPTGTCAACITGDNRSLIANLAAANCYKKEKLVEKARVCYIAGFFLTVSPE
1lioA           LKELCDKEGLATRFMVAPGQSTGTCAVLINEK-ERTLCTHLGACGSFRTTFASGALIFYATAYTLTATPK
1dh2A           LKELCDKEGLATRFMVAPGQSTGTCAVLINEK-ERTLCTHLGACGSFRTTFASGALIFYATAYTLTATPK
1j5vB           AAGHLRKFGVKTDYIARGGNRIGIYFLEIGASQRPSKVVYDRAHSAISEAKREDFWEKILDGAFHFSGIT
1liiA           LKELCDKEGLATRFMVAPGQSTGTCAVLINEK-ERTLCTHLGACGSFRTTFASGALIFYATAYTLTATPK
1dgyA           LKELCDKEGLATRFMVAPGQSTGTCAVLINEK-ERTLCTHLGACGSFRTTFASGALIFYATAYTLTATPK
2afbB           AAGHLRKFGVKTDYIARGGNRIGIYFLEIGASQRPSKVVYDRAHSAISEAKREDFWEKILDGAFHFSGIT
1lijA           LKELCDKEGLATRFMVAPGQSTGTCAVLINEK-ERTLCTHLGACGSFRTTFASGALIFYATAYTLTATPK
1dh1A           LKELCDKEGLATRFMVAPGQSTGTCAVLINEK-ERTLCTHLGACGSFRTTFASGALIFYATAYTLTATPK
2afbA           AAGHLRKFGVKTDYIARGGNRIGIYFLEIGASQRPSKVVYDRAHSAISEAKREDFWEKILDGAFHFSGIT
1v1bA           VEERLRAEGVDLTHFRRAPGFTGLYLREYLPLGQGRVFYYGSAGSALAPGAFD--PDYLEGVRFLHLSGI
1v19A           VEERLRAEGVDLTHFRRAPGFTGLYLREYLPLGQGRVFYYGSAGSALAPGAFD--PDYLEGVRFLHLSGI
2absA           LKELCDKEGLATRFMVAPGQSTGVCAVLINEK-ERTLCTHLGACGSFRTTFASGALIFYATAYTLTATPK
2abqA           VRNALEKEEIGLSFI----EVEGDTRINVKIKGKQETELNGTAPLIKKEHVLLEQLTELEKGDVLVLAGS
2jg5A           IIDTLNNSAIQ-SNFIEVDEDT-RINVKLKTGQETEINAPG---PHITSTQFEQLLQQIKNTDIVIVAGS
2a9yA           LKELCDKEGLATRFMVAPGQSTGVCAVLINEK-ERTLCTHLGACGSFRTTFASGALIFYATAYTLTATPK
1j5vD           AAGHLRKFGVKTDYIARGGNRIGIYFLEIGASQRPSKVVYDRAHSAISEAKREDFWEKILDGAFHFSGIT
1dgmA           LKELCDKEGLATRFMVAPGQSTGVCAVLINEK-ERTLCTHLGACGSFRTTFASGALIFYATAYTLTATPK
2i6bA           LKRKAAEAHVDAHYYEQNEQPTGTCAACITGDNRSLIANLAAANCYKKEKLVEKARVCYIAGFFLTVSPE
2i6bB           LKRKAAEAHVDAHYYEQNEQPTGTCAACITGDNRSLIANLAAANCYKKEKLVEKARVCYIAGFFLTVSPE
1lhpA           ----------------------------------------------------------------------
1j5vA           AAGHLRKFGVKTDYIARGGNRIGIYFLEIGASQRPSKVVYDRAHSAISEAKREDFWEKILDGAFHFSGIT
1lhrA           ----------------------------------------------------------------------
1yhjA           ----------------------------------------------------------------------
1rfuA           ----------------------------------------------------------------------
1lhpB           ----------------------------------------------------------------------
2q5rC           IAKKL--DHADIKHAFYNIKGETRNCIAILHEGQQTEILEQGPE-----IDNQEAAGFIKHFEQLLEKVE
2yxuB           ----------------------------------------------------------------------
2yxuA           ----------------------------------------------------------------------
2yxtB           ----------------------------------------------------------------------
2yxtA           ----------------------------------------------------------------------
3fhyB           ----------------------------------------------------------------------
3fhyA           ----------------------------------------------------------------------
3fhxB           ----------------------------------------------------------------------
3fhxA           ----------------------------------------------------------------------
2f7kA           ----------------------------------------------------------------------
2ajpB           ----------------------------------------------------------------------
2ajpA           ----------------------------------------------------------------------
2i5bB           ----------------------------------------------------------------------
2i5bD           ----------------------------------------------------------------------
2i5bC           ----------------------------------------------------------------------
2i5bA           ----------------------------------------------------------------------
2q5rD           IAKKL--DHADIKHAFYNIKGETRNCIAILHEGQQTEILEQGPE-----IDNQEAAGFIKHFEQLLEKVE
2q5rB           IAKKL--DHADIKHAFYNIKGETRNCIAILHEGQQTEILEQGPE-----IDNQEAAGFIKHFEQLLEKVE
2q5rA           IAKKL--DHADIKHAFYNIKGETRNCIAILHEGQQTEILEQGPE-----IDNQEAAGFIKHFEQLLEKVE
2jgvD           IAKKL--DHADIKHAFYNIKGETRNCIAILHEGQQTEILEQGPE-----IDNQEAAGFIKHFEQLLEKVE
2jgvC           IAKKL--DHADIKHAFYNIKGETRNCIAILHEGQQTEILEQGPE-----IDNQEAAGFIKHFEQLLEKVE
2jgvB           IAKKL--DHADIKHAFYNIKGETRNCIAILHEGQQTEILEQGPE-----IDNQEAAGFIKHFEQLLEKVE
2jgvA           IAKKL--DHADIKHAFYNIKGETRNCIAILHEGQQTEILEQGPE-----IDNQEAAGFIKHFEQLLEKVE
2jg1D           IAKKLDHADININCIAILHEGQ-QTEILEQDNQEAAGFIKHFEQEKVEAVAISGSLPKGLNQDYYAQIIE
2jg1C           IAKKLDHADININCIAILHEGQ-QTEILEQDNQEAAGFIKHFEQEKVEAVAISGSLPKGLNQDYYAQIIE
2jg1A           IAKKLDHADININCIAILHEGQ-QTEILEQDNQEAAGFIKHFEQEKVEAVAISGSLPKGLNQDYYAQIIE
3ewmB           LIEELSKENVDTRGIVKEKKHTGIVFVQL-KGASPSFLLY-------DDVAYFNTLNDINVEEAKIVNFG
2f02B           -----------------------QAFTSIKEETRDSIAILHEGNQAGPTVSPEEISNFLENFDQLIKQAE
2f02A           -----------------------QAFTSIKEETRDSIAILHEGNQAGPTVSPEEISNFLENFDQLIKQAE
2awdB           -----------------------QAFTSIKEETRDSIAILHEGNQAGPTVSPEEISNFLENFDQLIKQAE
2awdA           -----------------------QAFTSIKEETRDSIAILHEGNQAGPTVSPEEISNFLENFDQLIKQAE


                         +         .         .         .         .         *         .:210
query           TPLEVTNEAFKLARELNVKTILNPAPATDILDELKKNIDLIIPNETEAELLTGIKVVDEDTCRQAADKLI
1rkdA           SPLESVMAAAKIAHQNKTIVALNPAPARELPDELLALVDIITPNETEAEKLTGIRVENDEDAAKAAQVLH
1gqtB           SPLESVMAAAKIAHQNKTIVALNPAPARELPDELLALVDIITPNETEAEKLTGIRVENDEDAAKAAQVLH
1gqtA           SPLESVMAAAKIAHQNKTIVALNPAPARELPDELLALVDIITPNETEAEKLTGIRVENDEDAAKAAQVLH
1vm7B           IPFETTLEC---AKRFNGIVIFDPAPAQGINEEIFQYLDYLTPNEKEIEALSKDFFGEFLTVEKAAEKFL
1vm7A           IPFETTLEC---AKRFNGIVIFDPAPAQGINEEIFQYLDYLTPNEKEIEALSKDFFGEFLTVEKAAEKFL
2fv7A           ITPATSLEALTMARRSGVKTLFNPAPAIADLDQFYTLSDVFCCNESEAEILTGLTVGSAADAGEAALVLL
3ikhA           FSLDKTRALFQYARSRGT-TVFNPSPVNPDFCHLWPLIDIAVVNESEAELLQ------------------
3ikhC           FSLDKTRALFQYARSRGT-TVFNPSPVNPDFCHLWPLIDIAVVNESEAELLQ------------------
3i3yB           FSLDKTRALFQYARSRGT-TVFNPSPVNPDFCHLWPLIDIAVVNESEAELLQ------------------
3ikhB           FSLDKTRALFQYARSRGT-TVFNPSPVNPDFCHLWPLIDIAVVNESEAELLQ------------------
3in1A           SPLKALTEIFTQAKAADIKPRLNET--LDDICEALSYVDYLFPNFAEAKLLTGKETLDE-----IADCFL
3h49A           SPLKALTEIFTQAKAADIKPRLNET--LDDICEALSYVDYLFPNFAEAKLLTGKETLDE-----IADCFL
3cqdB           LPLEKLTQLISAAQKQGIRCIVDSSGEALSAALAIGNIELVKPNQKELSALVNRELTQPDDVRKAAQEIV
3cqdA           LPLEKLTQLISAAQKQGIRCIVDSSGEALSAALAIGNIELVKPNQKELSALVNRELTQPDDVRKAAQEIV
3h49B           SPLKALTEIFTQAKAADIKPRLNET--LDDICEALSYVDYLFPNFAEAKLLTGKETLDE-----IADCFL
1tz6B           RPAEACLEGARRMREAGGYVLFD----VNLRSKMWGNTDEIPELIARSAALASIKVSADELCQDARYYLR
1tz6A           RPAEACLEGARRMREAGGYVLFD----VNLRSKMWGNTDEIPELIARSAALASIKVSADELCQDARYYLR
2v78A           NAKEAVIKAFELAKSRSLDTNIRPKAKETILSILKKDIEVLITDPDDTKIL--LDVTDPD---EAYRKYK
3iq0B           FHVDAVKKAVTIVKDPNIRKELD-IPERDALHFVLELTD-IYPSEGEVLLLS-----PHSTPERAIAGFL
3iq0A           FHVDAVKKAVTIVKDPNIRKELD-IPERDALHFVLELTD-IYPSEGEVLLLS-----PHSTPERAIAGFL
2c4eA           KAYGNNLVSFDPGQDL-------PQYSKEMLLEIIEHTNFLFMNKHEFERASNLLNFEIDDYLERVDAL-
2c49B           KAYGNNLVSFDPGQDL-------PQYSKEMLLEIIEHTNFLFMNKHEFERASNLLNFEIDDYLERVDAL-
2c49A           KAYGNNLVSFDPGQDL-------PQYSKEMLLEIIEHTNFLFMNKHEFERASNLLNFEIDDYLERVDAL-
2nwhA           LPEDTLTALGLIARACEAAIAISPAKAVKLKAAL-GDIDILFMNEAEARALTGV--------RDWPNILR
3ie7A           PPHYTLSDFKELLRTVKATAFLGCDNSGEYLNLAVEGVDFIKPNEDEV-----IAILDEKTNSLEENRTL
3hicA           PPHYTLSDFKELLRTVKATAFLGCDNSGEYLNLAVEGVDFIKPNEDEV-----IAILDEKTNSLEENRTL
2rbcA           WP-ELALDVLTVARALGKPAILDGDVAVETLEGLAPAATHIVFSEPAATRLTGLETVKDLPVLHAR----
3ewmA           SVILARNP----SRE-TVKVIKKIKGSSLIAFDVNLRLDLWRGQEEEIKVLESIKLADVKASEEEVLYLE
1tz3A           SSIGLTDRP---AREACLEGARRREAGGYVLFDV--NLRSKWGNTDEIPELIARSAALASICKVSADELC
3ih0A           SVILARNP----SRE-TVKVIKKIKGSSLIAFDVNLRLDLWRGQEEEIKVLESIKLADVKASEEEVLYLE
3gbuA           SVILARNP----SRE-TVKVIKKIKGSSLIAFDVNLRLDLWRGQEEEIKVLESIKLADVKASEEEVLYLE
1tz3B           SSIGLTDRP---AREACLEGARRREAGGYVLFDV--NLRSKWGNTDEIPELIARSAALASICKVSADELC
1tyyA           SSIGLTDRP---AREACLEGARRREAGGYVLFDV--NLRSKWGNTDEIPELIARSAALASICKVSADELC
3julA           PPHYTLSDFKELLRTVKATAFLGCDNSGEYLNLAVEGVDFIKPNEDEV-----IAILDEKTNSLEENRTL
1tyyB           SSIGLTDRP---AREACLEGARRREAGGYVLFDV--NLRSKWGNTDEIPELIARSAALASICKVSADELC
2qcvA           SPSEAVLKAIRLAKRNDVKVVFEPEETAVYYSLVAEQSDIVIGTREEFDVLENRKGDNDETIRY----LF
2i6aA           SVLKVAHHASENNRTLNLSAPFISQFYKESLMKVMPYVDILFGNETEAATFADIKEIAKKT--QALPKMN
1bx4A           SVLKVAHHASENNRTLNLSAPFISQFYKESLMKVMPYVDILFGNETEAATFADIKEIAKKT--QALPKMN
1lioA           NALEVAGYAHGIPNTLNLSAPFCVELYKDAMQSLLLHTNILFGNEEEAHLAKVHNLVADKTALSTANKAV
1dh2A           NALEVAGYAHGIPNTLNLSAPFCVELYKDAMQSLLLHTNILFGNEEEFAHLAKVHVAADKTALSTANKAV
1j5vB           PPLGILEDALKVANEVTVSCDLNYRARLWTKEEAQKVIDVLIANEEDIEKVLGISVENREAYAKIAEEVT
1liiA           NALEVAGYAHGIPNTLNLSAPFCVELYKDAMQSLLLHTNILFGNEEEFAHLAKVHNLVAKVALSVANKAV
1dgyA           NALEVAGYAHGIPNTLNLSAPFCVELYKDAMQSLLLHTNILFGNEEEFAHLAKVHVAAEKVALSVANKAV
2afbB           PPLGILEDALKVANEVTVSCDLNYRARLWTKEEAQKVIDVLIANEEDIEKVLGISVEGLDN-REAYAKIA
1lijA           NALEVAGYAHGIPNTLNLSAPFCVELYKDAMQSLLLHTNILFGNEEEFAHLVALSVANKEHAVTGATKLV
1dh1A           NALEVAGYAHGIPNTLNLSAPFCVELYKDAMQSLLLHTNILFGNEEEFAHLAKVHVAAEKVALSVANKAV
2afbA           PPLGILEDALKVANEVTVSCDLNYRARLWTKEEAQKVIDVLIANEEDIEKVLGISV--EGLNREAYAKIA
1v1bA           TPAEAKRRGVRVSLDVNYRTLWSPEEARGFLERALPGVDXXXXXXXXXXXXXG----------RVEEALR
1v19A           TPAEAKRRGVRVSLDVNYRTLWSPEEARGFLERALPGVDXXXXXXXXXXXXXG----------RVEEALR
2absA           NALEVAGYAHGIPNTLNLSAPFCVELYKDAMQSLLLHTNILFGNEEEAHLAKVHNLVNKEHAVEGALRLL
2abqA           VPQQTIYRSTQIAKERGAFVAVDTSGEA-LHEVLAAKPSFIKPNHHELSELVSKPIASIEDAIPHVQRLI
2jg5A           VPSSIPSDAYXXXXXXXXXX--GAKLVVDAEKELAESVLFIKPNKDELEVMFNTTVNSDADVIKYGRLLV
2a9yA           NALEVAGYAHGIPNTLNLSAPFCVELYKDAMQSLLLHTNILFGNEEEFAHLAKVHVAAEKTALSTANKLL
1j5vD           PPLGILEDALKVANEVTVSCDLNYRARLWTKEEAQKVIDVLIANEEDIEKVLGISVEGN---REAYAKIA
1dgmA           NAFEVAGYAHGIPNTLNLSAPFCVELYKDAMQSLLLHTNILFGNEEEHNLVTANKEHAVEVCTGAL-RLL
2i6bA           SVLKVAHHASENNRTLNLSAPFISQFYKESLMKVMPYVDILFGNETEAATFADIKEIAKKT--QALPKMN
2i6bB           SVLKVAHHASENNRTLNLSAPFISQFYKESLMKVMPYVDILFGNETEAATFADIKEIAKKT--QALPKMN
1lhpA           --------------------------------------DIITPNQFEAELLTGRKIHSQEEALEVMDMLH
1j5vA           PPLGILEDALKVANEVTVSCDLNYRARLWTKEEAQKVIDVLIANEEDIEKVLGI------SNREAYAKIA
1lhrA           --------------------------------------DIITPNQFEAELLTGRKIHSQEEALEVMDMLH
1yhjA           --------------------------------------DIITPNQFEAELLTGRKIHSQEEALEVMDMLH
1rfuA           --------------------------------------DIITPNQFEAELLTGRKIHSQEEALEVMDMLH
1lhpB           --------------------------------------DIITPNQFEAELLTGRKIHSQEEALEVMDMLH
2q5rC           APKGLNQDYYERCQNKGVPVILDCSGATTVLENPYKPT-VIKPNISELYQLLN-QPLDEESLKQAVSQPL
2yxuB           ----------------------------DLLPVYKEKVDIITPNQFEAELLSGRKIHSQEEALRVMDMLH
2yxuA           ----------------------------DLLPVYKEKVDIITPNQFEAELLSGRKIHSQEEALRVMDMLH
2yxtB           ----------------------------DLLPVYKEKVDIITPNQFEAELLSGRKIHSQEEALRVMDMLH
2yxtA           ----------------------------DLLPVYKEKVDIITPNQFEAELLSGRKIHSQEEALRVMDMLH
3fhyB           ----------------------------DLLPVYKEKVDIITPNQFEAELLSGRKIHSQEEALRVMDMLH
3fhyA           ----------------------------DLLPVYKEKVDIITPNQFEAELLSGRKIHSQEEALRVMDMLH
3fhxB           ----------------------------DLLPVYKEKVDIITPNQFEAELLSGRKIHSQEEALRVMDMLH
3fhxA           ----------------------------DLLPVYKEKVDIITPNQFEAELLSGRKIHSQEEALRVMDMLH
2f7kA           ----------------------------DLLPVYKEKVDIITPNQFEAELLSGRKIHSQEEALRVMDMLH
2ajpB           ----------------------------DLLPVYKEKVDIITPNQFEAELLSGRKIHSQEEALRVMDMLH
2ajpA           ----------------------------DLLPVYKEKVDIITPNQFEAELLSGRKIHSQEEALRVMDMLH
2i5bB           ----------KQLKNVVIDPVMYPEHAQALREQLAPLATVITPNLFEASQLSGLKTVDD--MIEAAKKIH
2i5bD           --------------------VLYPEHAQALREQLAPLATVITPNLFEASQLSGLKTVDD--MIEAAKKIH
2i5bC           --------------------VLYPEHAQALREQLAPLATVITPNLFEASQLSGLKTVDD--MIEAAKKIH
2i5bA           --------------------VLYPEHAQALREQLAPLATVITPNLFEASQLSGLKTVDD--MIEAAKKIH
2q5rD           APKGLNQDYYERCQNKGVPVILDCSGATTVLENPYKPT-VIKPNISELYQLLN-QPLDEESLKQAVSQPL
2q5rB           APKGLNQDYYERCQNKGVPVILDCSGATTVLENPYKPT-VIKPNISELYQLLN-QPLDEESLKQAVSQPL
2q5rA           APKGLNQDYYERCQNKGVPVILDCSGATTVLENPYKPT-VIKPNISELYQLLN-QPLDEESLKQAVSQPL
2jgvD           APKGLNQDYYERCQNKGVPVILDCSGATTVLENPYKPT-VIKPNISELYQLLN-QPLDEESLKQAVSQPL
2jgvC           APKGLNQDYYERCQNKGVPVILDCSGATTVLENPYKPT-VIKPNISELYQLLN-QPLDEESLKQAVSQPL
2jgvB           APKGLNQDYYERCQNKGVPVILDCSGATTVLENPYKPT-VIKPNISELYQLLN-QPLDEESLKQAVSQPL
2jgvA           APKGLNQDYYERCQNKGVPVILDCSGATTVLENPYKPT-VIKPNISELYQLLN-QPLDEESLKQAVSQPL
2jg1D           R-----------CQNKGVPVILDCSGATTVLENPYKPT-VIKPNISELYQLLN-QPLDEESLKQAVSQPL
2jg1C           R-----------CQNKGVPVILDCSGATTVLENPYKPT-VIKPNISELYQLLN-QPLDEESLKQAVSQPL
2jg1A           R-----------CQNKGVPVILDCSGATTVLENPYKPT-VIKPNISELYQLLN-QPLDEESLKQAVSQPL
3ewmB           SVILARNP----SRE-TVKVIKKIKGSSLIAFDVNLRLDLWRGQEEEIKVLESIKLADVKASEEEVLYLE
2f02B           IPSDFYQELVQKAHAQEVKVLLDTSG-----DSLRQVLQLIKPNLEELEGLLGQDFSENPLAAQTALTKP
2f02A           IPSDFYQELVQKAHAQEVKVLLDTSG-----DSLRQVLQLIKPNLEELEGLLGQDFSENPLAAQTALTKP
2awdB           IPSDFYQELVQKAHAQEVKVLLDTSG-----DSLRQVLQLIKPNLEELEGLLGQDFSENPLAAQTALTKP
2awdA           IPSDFYQELVQKAHAQEVKVLLDTSG-----DSLRQVLQLIKPNLEELEGLLGQDFSENPLAAQTALTKP


                         .         .         .         +         .         .         .:280
query           DQGINNVIITLGKQGAYYKTKDGVCELVPAFKVKAIDTTAAGDTFIGALVSKLDTSFSNLREAIIYASKA
1rkdA           EKGIRTVLITLGSRGV-WASVNGEGQRVPGFRVQAVDTIAAGDTFNGALITAL-LEEKPLPEXXXXXXXX
1gqtB           EKGIRTVLITLGSRGV-WASVNGEGQRVPGFRVQAVDTIAAGDTFNGALITAL-LEEKPLPEXXXXXXXX
1gqtA           EKGIRTVLITLGSRGV-WASVNGEGQRVPGFRVQAVDTIAAGDTFNGALITAL-LEEKPLPEXXXXXXXX
1vm7B           ELGVKNVIVKLGDKGVLLVNKNEK-KHFPTFKVKAVDTTAAGDVFNGAFAVALSEG-KNPEEAVIFGTAA
1vm7A           ELGVKNVIVKLGDKGVLLVNKNEK-KHFPTFKVKAVDTTAAGDVFNGAFAVALSEG-KNPEEAVIFGTAA
2fv7A           KRGCQVVIITLGAEGCVVLSQEPEPKHIPTEKVKAVDTTGAGDSFVGALAFYL-AYYPNLEDMLNRSNFI
3ikhA           PYGVKTLVITQGAAGAWL-VQEGQRQFCPAVPAEALDTTGAGDTFLAVLASALLRGVXXXXXXXXXXXXX
3ikhC           PYGVKTLVITQGAAGAWL-VQEGQRQFCPAVPAEALDTTGAGDTFLAVLASALLRGVXXXXXXXXXXXXX
3i3yB           PYGVKTLVITQGAAGAWL-VQEGQRQFCPAVPAEALDTTGAGDTFLAVLASALLRGVXXXXXXXXXXXXX
3ikhB           PYGVKTLVITQGAAGAWL-VQEGQRQFCPAVPAEALDTTGAGDTFLAVLASALLRGVXXXXXXXXXXXXX
3in1A           ACGVKTVVIKTGKDGCFIKRGD---TKVPAVAITAIDTIGAGDNFASGFIAAL-LEGKNLRECARFANAT
3h49A           ACGVKTVVIKTGKDGCFIKRGD---TKVPAVAITAIDTIGAGDNFASGFIAAL-LEGKNLRECARFANAT
3cqdB           NSGAKRVVVSLGPQGALGVDSENCIQVVPP-PVKSQSTVGAGDSMVGAMTLKLAEN-ASLEEMVRFGVAA
3cqdA           NSGAKRVVVSLGPQGALGVDSENCIQVVPP-PVKSQSTVGAGDSMVGAMTLKLAEN-ASLEEMVRFGVAA
3h49B           ACGVKTVVIKTGKDGCFIKRGD---TKVPA-------TIGAGDNFASGFIAAL-LEGKNLRECARFANAT
1tz6B           DLGCDTTIISLGADGALLITAEGEFHF-PAPRVDVVDTTGAGDAFVGGLLFTLSRAHALLAEAISNANAC
1tz6A           DLGCDTTIISLGADGALLITAEGEFHF-PAPRVDVVDTTGAGDAFVGGLLFTLSRAHALLAEAISNANAC
2v78A           ELGVKVLLYKLGSKGAI-AYKDNVKAFKDAYKVPVEDPTGAGDAMAGTFVS-LYLQGKDIEYSLAHGIAA
3iq0B           EEGVKEVIVKRGNQGASYYSANEQFH-VESYPVEEVDPTGAGDCFGGAWIACRQLGF-DAHRALQYANAC
3iq0A           EEGVKEVIVKRGNQGASYYSANEQFH-VESYPVEEVDPTGAGDCFGGAWIACRQLGF-DAHRALQYANAC
2c4eA           -------IVTKGSKGSVIYTKDKKIE-IPCIKAKVIDPTGAGDSYRAGFLSAYVKGY-DLEKCGLIGAAT
2c49B           -------IVTKGSKGSVIYTKDKKIE-IPCIKAKVIDPTGAGDSYRAGFLSAYVKGY-DLEKCGLIGAAT
2c49A           -------IVTKGSKGSVIYTKDKKIE-IPCIKAKVIDPTGAGDSYRAGFLSAYVKGY-DLEKCGLIGAAT
2nwhA           KAGLSGGVVTRGASEAFNGTEKAI--LHPPLIREVKDVTGAGDAMASGYLAAI-AEGKTIREALRQGXXX
3ie7A           AEKIPYLVVSLGAKGSICAHNGKLYQVIPP-KVQERNDTGAGDVFVGAFIAGL---ANPITETLKVATGC
3hicA           AEKIPYLVVSLGAKGSICAHNGKLYQVIPP-KVQERNDTGAGDVFVGAFIAGL---ANPITETLKVATGC
2rbcA           -YPQTFIAVTAGPAGCWWTEADDPTVHFQTTQVEAVDTLAAGDIFHG-----------------------
3ewmA           NQGVSLTAITLGPKGCRLIKNETVVD-VPSYNVNPLDTTGAGDAFAAXXXXXXXXXXXXXXXXXXFANLV
1tz3A           DLGCDTTIISLGADGALLITAEGEFHF-PAPRVDVVDTTGAGDAFVGGLLFTLSRAHALLAEAISNAN-A
3ih0A           NQGVSLTAITLGPKGFRLIKNETVVD-VPSYNVNPLDTTGAGDAFAAXXXXXXXXXXXXXXXXXXFANLV
3gbuA           NQGVSLTAITLGPKGFRLIKNETVVD-VPSYNVNPLDTTGAGDAFAAXXXXXXXXXXXXXXXXXXFANLV
1tz3B           DLGCDTTIISLGADGALLITAEGEFHF-PAPRVDVVDTTGAGDAFVGGLLFTLSRAHALLAEAISNAN-A
1tyyA           DLGCDTTIISLGADGALLITAEGEFHF-PAPRVDVVDTTGAGDAFVGGLLFTLSRAHALLAEAISNAN-A
3julA           AEKIPYLVVSLGAKGSICAHNGKLYQVIPP--------TGAGDVFVGAFIAGL---ANPITETLKVATGC
1tyyB           DLGCDTTIISLGADGALLITAEGEFHF-PAPRVDVVDTTGAGDAFVGGLLFTLSRAHALLAEAISNANAC
2qcvA           KHSPELIVIKHGVEGSFAYTKAGEAYRGYAYKTKVLKTFGAGDSYASAFLYAL-ISGKGIETALKYGSAS
2i6aA           SKRQRIVIFTQGRDDTIMATESEVTAVLDQDQKEIIDTNGAGDAFVGGFLSQL-VSDKPLTECIRAGHYA
1bx4A           SKRQRIVIFTQGRDDTIMATESEVTAVLDQDQKEIIDTNGAGDAFVGGFLSQL-VSDKPLTECIRAGHYA
1lioA           EGATKLVVMTRGHNPAAEQTADGTXXXXXXXXXKIVDTNGAGDAFVGGFLYGLSQG-KTVKQCIMCGNAC
1dh2A           EGATKLVVMTRGHNPAAEQTADGTXXXXXXXXXKIVDTNGAGDAFVGGFLYGLSQG-KTVKQCIMCGNAC
1j5vB           RKNFKTVGITLRESISYWSVENGQPHFSNRYEIHIVDRVGAGDSFAGALI--------------------
1liiA           EGATKLVVMTRGHNPAAEQTADGTXXXXXXXXXKIVDTNGAGDAFVGGFLYGLSQG-KTVKQCIMCGNAC
1dgyA           EGATKLVVMTRGHNPAAEQTADGTXXXXXXXXXKIVDTNGAGDAFVGGFLYGLSQG-KTVKQCIMCGNAC
2afbB           EENFKTVGITLRESISYWSVENGQPHFSNRYEIHIVDRVGAGDSFAGALI--------------------
1lijA           TRGHNPVI-------AAEQTADGTXXXXXXXXXKIVDTNGAGDAFVGGFLYGLSQG-KTVKQCIMCGNAC
1dh1A           TGATKLVVMTRGHNPAAEQTADGTXXXXXXXXXKIVDTNGAGDAFVGGFLYGLSQG-KTVKQCIMCGNAC
2afbA           EENFKTVGITLRESISYWSVENGQPHFSNRYEIHIVDRVGAGDSFAGALI--------------------
1v1bA           ALSAPEVVLKRGAKGA-WAFVDGRRVEGSAFAVEAVDPVGAGDAFAAGYLAGAVWGLP-VEERLRLANLL
1v19A           ALSAPEVVLKRGAKGA-WAFVDGRRVEGSAFAVEAVDPVGAGDAFAAGYLAGAVWGLP-VEERLRLANLL
2absA           TAGQNTVVMTRGHNPAAEQTADGTXXXXXXXXXKIVDTNGAGDAFVGGFLYALSQG-KTVKQCIMCGNAC
2abqA           GEGIESILVSFAGDGALFASAEGFHVNVPSGEVR--NSVGAGDSVVAGFLAALQEG-KSLEDAVPFAVAA
2jg5A           DKGAQSVIVSLGGDGAIYIDKEISIKAVNP-QGKVVNTVGSGDSTVAGMVAGIASGLS------------
2a9yA           TAGQNTVVMTRGHNPAAEQTADGTXXXXXXXXXKIVDTNGAGDAFVGGFLYALSQG-KTVKQCIMCGNAC
1j5vD           EENFKTVGITLRESISYWSVENGQPHFSNRYEIHIVDRVGAGDSFAGALI--------------------
1dgmA           TAGQNTVVMTRGHNPAAEQTADGTXXXXXXXXXKIVDTNGAGDAFVGGFLYALSQG-KTVKQCIMCGNAC
2i6bA           SKRQRIVIFTQGRDDTIMATESEVTAVLDQDQKEIIDTNGAGDAFVGGFLSQL-VSDKPLTECIRAGHYA
2i6bB           SKRQRIVIFTQGRDDTIMATESEVTAVLDQDQKEIIDTNGAGDAFVGGFLSQL-----------------
1lhpA           SMGPDTVVITLSPRGSDYRTRGSVVTQRIRMEMHKVDAVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSA
1j5vA           EENFKTVGITLRESISYWSVENGQPHFSNRYEIHIVDRVGAGDSFAGALI--------------------
1lhrA           SMGPDTVVITLSPRGSDYRTRAVVTQRIEMHKVDAV-FVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSA
1yhjA           SMGPDTVVIT------------------------------------------------------------
1rfuA           SMGPDTVVIT------------------------------------------------------------
1lhpB           SMGPDTVVIT------------------------------------------------------------
2q5rC           FEGIEWIIVSLGAQGAFAKHNHTFYRVIPTIPVGSGDSTVAGIT--------------------------
2yxuB           SMGPDTVVIT------------------------------------------------------------
2yxuA           SMGPDTVVIT------------------------------------------------------------
2yxtB           SMGPDTVVIT------------------------------------------------------------
2yxtA           SMGPDTVVIT------------------------------------------------------------
3fhyB           SMGPDTVVIT------------------------------------------------------------
3fhyA           SMGPDTVVIT------------------------------------------------------------
3fhxB           SMGPDTVVIT------------------------------------------------------------
3fhxA           SMGPDTVVIT------------------------------------------------------------
2f7kA           SMGPDTVVIT------------------------------------------------------------
2ajpB           SMGPDTVVIT------------------------------------------------------------
2ajpA           SMGPDTVVIT------------------------------------------------------------
2i5bB           ALGAQYVVITGGGKLKHEKAVDVLYETAEVLESEMIDTPGAGCTFSAAVTAEL-AKGAEVKEAIYAAKEF
2i5bD           ALGAQYVVITGGGKLKHEKAVDVLYETAEVLESEMIDTPGAGCTFSAAVTAEL-AKGAEVKEAIYAAKEF
2i5bC           ALGAQYVVITGGGKLKHEKAVDVLYETAEVLESEMIDTPGAGCTFSAAVTAEL-AKGAEVKEAIYAAKEF
2i5bA           ALGAQYVVITGGGKLKHEKAVDVLYETAEVLESEMIDTPGAGCTFSAAVTAEL-AKGAEVKEAIYAAKEF
2q5rD           FEGIEWIIVSLGAQGAFAKHNHTFYRVNIPTPVGSGDSTVAGIT--------------------------
2q5rB           FEGIEWIIVSLGAQGAFAKHNHTFYRVIPTISV--LNPVGSGDSTVAGITSAI-----------------
2q5rA           FEGIEWIIVSLGAQGAFAKHNHTFYRVIPTISV--LNPVGSGDSTVAGITSAI-----------------
2jgvD           FEGIEWIIVSLGAQGAFAKHNHTFYRVIPTISV--LNPVGSGDSTVAGITSAI-----------------
2jgvC           FEGIEWIIVSLGAQGAFAKHNHTFYRVIPTISV--LNPVGSGDSTVAGITSAI-----------------
2jgvB           FEGIEWIIVSLGAQGAFAKHNHTFYRVIPTISV--LNPVGSGDSTVAGITSAI-----------------
2jgvA           FEGIEWIIVSLGAQGAFAKHNHTFYRVIPTISV--LNPVGSGDSTVAGITSAI-----------------
2jg1D           FEGIEWIIVSLGAQGAFAKHNHTFYRVIPTISV--LNPVGSGDSTVAGITSAI-----------------
2jg1C           FEGIEWIIVSLGAQGAFAKHNHTFYRVIPTISV--LNPVGSGDSTVAGITSAI-----------------
2jg1A           FEGIEWIIVSLGAQGAFAKHNHTFYRVIPTISV--LNPVGSGDSTVAGITSAI-----------------
3ewmB           NQGVSLTAITLGPKG---------CRLIKNETVVDV-PSGAGDAF-------------------------
2f02B           FAGIEWIVISLGKDGAIAKHHDQFYRVIPTIQAK--NPVGSGDATIAGL---------------------
2f02A           FAGIEWIVISLGKDGAIAKHHDQFYRVIPTIQAK--NPVGSGDATIAGL---------------------
2awdB           FAGIEWIVISLGKDGAIAKHHDQFYRVIPTIQAK--NPVGSGDATIAGL---------------------
2awdA           FAGIEWIVISLGKDGAIAKHHDQFYRVIPTIQAK--NPVGSGDATIAGL---------------------


                         .         *         .         .         .         .         +:350
query           SSLAVQRLGAIPSIPYKDDVEKQLNSx
1rkdA           XXXXVTRKGAQPSVPWREEIDAFLD--
1gqtB           XXXXVTRKGAQPSVPWREEIDAFLD--
1gqtA           XXXXVTRKGAQPSVPWREEIDAFLD--
1vm7B           AAISVTRLGAQSSIPAREEVEAFLKN-
1vm7A           AAISVTRLGAQSSIPAREEVEAFLKN-
2fv7A           AAVSVQAAGTQSSYPYKKDL-------
3ikhA           XXITVSRRGTLSAFP------------
3ikhC           XXITVSRRGTLSAFP------------
3i3yB           XXITVSRRGTLSAFP------------
3ikhB           XXITVSRRGTLSAFP------------
3in1A           AAISVLSVGATTGVKNRKLVEQLL---
3h49A           AAISVLSVGATTGVKNRKLVEQ-----
3cqdB           GSAATLNQGT--RLCSHDDTQK-----
3cqdA           GSAA-----------------------
3h49B           AAISVLSVGATTGVKNRKLVEQLL---
1tz6B           GAMAVTAKGAMTALPFPDQLNTFLSS-
1tz6A           GAMAVTAKGAMTALPFPDQLNTFLS--
2v78A           STLVITVRGDNELTPTLEDAERFLN--
3iq0B           GALAVTRRG------------------
3iq0A           GALAVTRRG------------------
2c4eA           ASFVVEAKGCQTNLPTWDKVVERL---
2c49B           ASFVVEAKGCQTNLPTWDKVVERL---
2c49A           ASFVVEAKGCQTNLPTWDKVVERL---
2nwhA           XXITVQSSFATSQDLSKDSVEAML---
3ie7A           SASKVQQ--------------------
3hicA           SASKVQQ--------------------
2rbcA           ---------------------------
3ewmA           AALSTQKRGAW-STPRKDELLK-----
1tz3A           CGAAVTAKGA-TALPFPDQLNTFLSS-
3ih0A           AALSTQKRGAW-STPRKDELLK-----
3gbuA           AALSTQKRGAW-STPRKDELLK-----
1tz3B           CGAAVTAKGA-TALPFPDQLNTFLSS-
1tyyA           CGAAVTAKGA-TALPFPDQLNTFLS--
3julA           SASKVQQ--------------------
1tyyB           GAAVT----AKTALPFPDQLNTFLSS-
2qcvA           ASIVVSKAPSVEEI-------------
2i6aA           ASIIIRRTGC--TFPEKPD--------
1bx4A           ASIIIRRTGC--TFPEKPD--------
1lioA           AQDVIQHVG------------------
1dh2A           AQDVIQHVG------------------
1j5vB           ---------------------------
1liiA           AQDVIQHVG------------------
1dgyA           AQDVIQHVG------------------
2afbB           ---------------------------
1lijA           AQDVIQHVG------------------
1dh1A           AQDVIQHVG------------------
2afbA           ---------------------------
1v1bA           GASVAASRGDHEGAPYREDLE------
1v19A           GASVAASRGDHEGAPYREDLE------
2absA           AQDVIQHVG------------------
2abqA           GS-------------------------
2jg5A           ---------------------------
2a9yA           AQDVIQHVG------------------
1j5vD           ---------------------------
1dgmA           AQDVIQHVG------------------
2i6bA           ASI------------------------
2i6bB           ---------------------------
1lhpA           MHHVLQR--------------------
1j5vA           ---------------------------
1lhrA           MHHVLQR--------------------
1yhjA           ---------------------------
1rfuA           ---------------------------
1lhpB           ---------------------------
2q5rC           ---------------------------
2yxuB           ---------------------------
2yxuA           ---------------------------
2yxtB           ---------------------------
2yxtA           ---------------------------
3fhyB           ---------------------------
3fhyA           ---------------------------
3fhxB           ---------------------------
3fhxA           ---------------------------
2f7kA           ---------------------------
2ajpB           ---------------------------
2ajpA           ---------------------------
2i5bB           ITAAIK---------------------
2i5bD           ITAAIK---------------------
2i5bC           ITAAIK---------------------
2i5bA           ITAAIK---------------------
2q5rD           ---------------------------
2q5rB           ---------------------------
2q5rA           ---------------------------
2jgvD           ---------------------------
2jgvC           ---------------------------
2jgvB           ---------------------------
2jgvA           ---------------------------
2jg1D           ---------------------------
2jg1C           ---------------------------
2jg1A           ---------------------------
3ewmB           ---------------------------
2f02B           ---------------------------
2f02A           ---------------------------
2awdB           ---------------------------
2awdA           ---------------------------