[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:ABD99245.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2kl5A.bssp"
#ERROR : Can't open dsspfile "2oiwD.bssp"
#ERROR : Can't open dsspfile "2oiwC.bssp"
#ERROR : Can't open dsspfile "2oiwA.bssp"

## Summary of PDB Search
:194
    5e-26  51%  2kl5A  [x.x.x] UNCHARACTERIZED PROTEIN YUTD
    2e-04  29%  2oiwD  [x.x.x] PUTATIVE 4-HYDROXYBENZOYL-COA THIOESTERASE
    2e-04  29%  2oiwC  [x.x.x] PUTATIVE 4-HYDROXYBENZOYL-COA THIOESTERASE
    2e-04  29%  2oiwA  [x.x.x] PUTATIVE 4-HYDROXYBENZOYL-COA THIOESTERASE
:194

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxETRIKIDGRPYDLVENYHEGFSAERLGERFSQILTKYDY
2kl5A           -------------------------------EIMILIQNAEFELVHNFKDGFNEEAFKARYSDILNKYDY
2oiwD           ---------------------------------------------------FTPDLSFKRWRVIIREVDY
2oiwC           ---------------------------------------------------FTPDLSFKRWRVIIREVDY
2oiwA           ---------------------------------------------------FTPDLSFKRWRVIIREVDY


                         .         .         *         .         .         .         .:140
query           IVGDWGYDQLRLRGFYEIGSKKGSPYQSIERLDDYLYEYCNFGCSYFILHNLEVQTPEPIPANIRxxxxx
2kl5A           IVGDWGYGQLRLKGFFDDQNQKATFETKISTLDEYIYEYCNFGCAYFVLKRI------------------
2oiwD           VNQYYGQDVTVYTGIERIGNTSLTIYEEIHQNG----VVCAKGRSVYVNFNFDTGRPEPIPDDIR-----
2oiwC           VNQYYGQDVTVYTGIERIGNTSLTIYEEIHQNG----VVCAKGRSVYVNFNFDTGRPEPIPDDIR-----
2oiwA           VNQYYGQDVTVYTGIERIGNTSLTIYEEIHQNG----VVCAKGRSVYVNFNFDTGRPEPIPDDIR-----


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2kl5A           ------------------------------------------------------
2oiwD           ------------------------------------------------------
2oiwC           ------------------------------------------------------
2oiwA           ------------------------------------------------------