[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:ABD99260.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1jgsA.bssp"
#ERROR : Can't open dsspfile "3f3xA.bssp"

## Summary of PDB Search
:146
    2e-04  26%  1jgsA  [a.4.5] MULTIPLE ANTIBIOTIC RESISTANCE PROTEIN MARR
    7e-04  25%  3f3xA  [x.x.x] TRANSCRIPTIONAL REGULATOR, MARR FAMILY, PUTATIVE
:146

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDERYQVINDALEKIYADIVWIEESELRKSVFSDITIKEMHAINAISMYDHQTASQVAKKLHLTPGTLTA
1jgsA           ---------------------------------DITAAQFKVLCSIRCAACITPVELKKVLSVDLGALTR
3f3xA           IDEKLQLMN-TIAKIYRGS--IKEFNNRLGKLMNLSYLDFSILKATSE-EPRSMVYLANRYFVTQSAITA


                         .         .         *         .         .         .         .:140
query           TIDRLCRKGYAEXXXXXXXXXXXXXXLTKKGRLVYRAHDAFHRMMVKSFLKDLNPDEIKTIExxxxxxxx
1jgsA           MLDRLVCKGWVERLPNPNDKRGVLVKLTTGGAAIEQCHQLVGQDLHQELTKNLTADEVATLE--------
3f3xA           AVDKLEAKGLVRRIRDSKDRRIVIVEITPKGRQVLLEANEVLRNLVNEMLSD------------------


                         +         .         .         .         .         *         .:210
query           xxxxxx
1jgsA           ------
3f3xA           ------