[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:fabH.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3il5A.bssp"
#ERROR : Can't open dsspfile "3il5B.bssp"
#ERROR : Can't open dsspfile "3il4B.bssp"
#ERROR : Can't open dsspfile "3il4A.bssp"
#ERROR : Can't open dsspfile "3il6A.bssp"
#ERROR : Can't open dsspfile "2ebdB.bssp"
#ERROR : Can't open dsspfile "2ebdA.bssp"
#ERROR : Can't open dsspfile "1zowA.bssp"
#ERROR : Can't open dsspfile "3il7A.bssp"
#ERROR : Can't open dsspfile "1hndA.bssp"
#ERROR : Can't open dsspfile "3il3A.bssp"
#ERROR : Can't open dsspfile "3il9A.bssp"
#ERROR : Can't open dsspfile "1ub7A.bssp"
#ERROR : Can't open dsspfile "1eblA.bssp"
#ERROR : Can't open dsspfile "1hnhA.bssp"
#ERROR : Can't open dsspfile "3gweA.bssp"
#ERROR : Can't open dsspfile "3gwaA.bssp"
#ERROR : Can't open dsspfile "1mzjB.bssp"
#ERROR : Can't open dsspfile "1mzjA.bssp"
#ERROR : Can't open dsspfile "1m1mB.bssp"
#ERROR : Can't open dsspfile "1m1mA.bssp"
#ERROR : Can't open dsspfile "1hzpA.bssp"
#ERROR : Can't open dsspfile "2ahbA.bssp"
#ERROR : Can't open dsspfile "2qnxB.bssp"
#ERROR : Can't open dsspfile "1hnkA.bssp"
#ERROR : Can't open dsspfile "2aj9A.bssp"
#ERROR : Can't open dsspfile "2qnzA.bssp"
#ERROR : Can't open dsspfile "2qnzB.bssp"
#ERROR : Can't open dsspfile "2qnyA.bssp"
#ERROR : Can't open dsspfile "2qo0B.bssp"
#ERROR : Can't open dsspfile "2qnyB.bssp"
#ERROR : Can't open dsspfile "2qo0A.bssp"
#ERROR : Can't open dsspfile "1u6eA.bssp"
#ERROR : Can't open dsspfile "3h76A.bssp"
#ERROR : Can't open dsspfile "3h78B.bssp"
#ERROR : Can't open dsspfile "3h78A.bssp"
#ERROR : Can't open dsspfile "3h77B.bssp"
#ERROR : Can't open dsspfile "3h77A.bssp"
#ERROR : Can't open dsspfile "1u0vB.bssp"
#ERROR : Can't open dsspfile "1u0vA.bssp"
#ERROR : Can't open dsspfile "1i89A.bssp"
#ERROR : Can't open dsspfile "1jwxA.bssp"
#ERROR : Can't open dsspfile "1i8bA.bssp"
#ERROR : Can't open dsspfile "1i88A.bssp"
#ERROR : Can't open dsspfile "1i86A.bssp"
#ERROR : Can't open dsspfile "1cmlA.bssp"
#ERROR : Can't open dsspfile "1chwA.bssp"
#ERROR : Can't open dsspfile "1cgkA.bssp"
#ERROR : Can't open dsspfile "1bq6A.bssp"
#ERROR : Can't open dsspfile "1bi5A.bssp"
#ERROR : Can't open dsspfile "1u0mA.bssp"
#ERROR : Can't open dsspfile "1xesC.bssp"
#ERROR : Can't open dsspfile "1d6iA.bssp"
#ERROR : Can't open dsspfile "1d6hA.bssp"
#ERROR : Can't open dsspfile "2p0uB.bssp"
#ERROR : Can't open dsspfile "2p0uA.bssp"
#ERROR : Can't open dsspfile "1xetD.bssp"
#ERROR : Can't open dsspfile "1xetC.bssp"
#ERROR : Can't open dsspfile "1xesD.bssp"
#ERROR : Can't open dsspfile "1xesA.bssp"
#ERROR : Can't open dsspfile "1u0uA.bssp"
#ERROR : Can't open dsspfile "1qlvB.bssp"
#ERROR : Can't open dsspfile "1qlvA.bssp"
#ERROR : Can't open dsspfile "1ee0B.bssp"
#ERROR : Can't open dsspfile "1ee0A.bssp"
#ERROR : Can't open dsspfile "1z1eA.bssp"
#ERROR : Can't open dsspfile "1wl4A.bssp"
#ERROR : Can't open dsspfile "2d51B.bssp"
#ERROR : Can't open dsspfile "2d51A.bssp"
#ERROR : Can't open dsspfile "2d3mB.bssp"
#ERROR : Can't open dsspfile "2d3mA.bssp"

## Summary of PDB Search
:326
    5e-72  49%  3il5A  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 3
    3e-70  49%  3il5B  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 3
    3e-70  49%  3il4B  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 3
    3e-70  49%  3il4A  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 3
    5e-68  48%  3il6A  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 3
    5e-63  41%  2ebdB  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 3
    5e-63  41%  2ebdA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 3
    1e-58  40%  1zowA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE III
    1e-58  40%  3il7A  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 3
    3e-52  35%  1hndA  [c.95.1 - c.95.1] BETA-KETOACYL-ACYL CARRIER PROTEIN SYNTHASE
    1e-50  35%  3il3A  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 3
    8e-50  35%  3il9A  [c.95.1 - c.95.1 (1mzsA)] 3-OXOACYL-[ACYL-CARRIER-PROTEIN]
    4e-47  37%  1ub7A  [c.95.1 - c.95.1] 3-OXOACYL-[ACYL-CARRIER PROTEIN] SYNTHASE
    5e-47  35%  1eblA  [c.95.1 - c.95.1] BETA-KETOACYL-ACP SYNTHASE III
    2e-45  36%  1hnhA  [c.95.1 - c.95.1] BETA-KETOACYL-ACYL CARRIER PROTEIN SYNTHASE
    2e-40  33%  3gweA  [x.x.x] 3-OXOACYL-(ACYL-CARRIER-PROTEIN) SYNTHASE III
    2e-40  33%  3gwaA  [x.x.x] 3-OXOACYL-(ACYL-CARRIER-PROTEIN) SYNTHASE III
    3e-39  32%  1mzjB  [c.95.1 - c.95.1] BETA-KETOACYLSYNTHASE III
    3e-39  32%  1mzjA  [c.95.1 - c.95.1] BETA-KETOACYLSYNTHASE III
    5e-39  32%  1m1mB  [c.95.1 - c.95.1] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE
    5e-39  32%  1m1mA  [c.95.1 - c.95.1] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE
    5e-39  32%  1hzpA  [c.95.1 - c.95.1] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE
    1e-37  32%  2ahbA  [x.x.x] BETA- KETOACYL-ACP SYNTHASE III
    2e-37  33%  2qnxB  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 3
    2e-37  36%  1hnkA  [c.95.1 - c.95.1] BETA-KETOACYL-ACYL CARRIER PROTEIN SYNTHASE
    1e-36  32%  2aj9A  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE III
    2e-36  33%  2qnzA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 3
    4e-36  33%  2qnzB  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 3
    4e-36  32%  2qnyA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 3
    2e-35  32%  2qo0B  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 3
    2e-35  32%  2qnyB  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 3
    2e-34  32%  2qo0A  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 3
    4e-34  31%  1u6eA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE III
    1e-30  27%  3h76A  [x.x.x] PQS BIOSYNTHETIC ENZYME
    2e-29  27%  3h78B  [x.x.x] PQS BIOSYNTHETIC ENZYME
    2e-29  27%  3h78A  [x.x.x] PQS BIOSYNTHETIC ENZYME
    4e-28  27%  3h77B  [x.x.x] PQS BIOSYNTHETIC ENZYME
    4e-28  27%  3h77A  [x.x.x] PQS BIOSYNTHETIC ENZYME
    9e-07  30%  1u0vB  [c.95.1 - c.95.1] CHALCONE SYNTHASE 2
    9e-07  30%  1u0vA  [c.95.1 - c.95.1] CHALCONE SYNTHASE 2
    2e-06  30%  1i89A  [c.95.1 - c.95.1] CHALCONE SYNTHASE 2
    3e-06  30%  1jwxA  [c.95.1 - c.95.1] CHALCONE SYNTHASE 2
    3e-06  30%  1i8bA  [c.95.1 - c.95.1] CHALCONE SYNTHASE 2
    3e-06  30%  1i88A  [c.95.1 - c.95.1] CHALCONE SYNTHASE 2
    3e-06  30%  1i86A  [c.95.1 - c.95.1] CHALCONE SYNTHASE 2
    3e-06  30%  1cmlA  [c.95.1 - c.95.1] PROTEIN (CHALCONE SYNTHASE)
    3e-06  30%  1chwA  [c.95.1 - c.95.1] PROTEIN (CHALCONE SYNTHASE)
    3e-06  30%  1cgkA  [c.95.1 - c.95.1] PROTEIN (CHALCONE SYNTHASE)
    3e-06  30%  1bq6A  [c.95.1 - c.95.1] CHALCONE SYNTHASE
    3e-06  30%  1bi5A  [c.95.1 - c.95.1] CHALCONE SYNTHASE
    4e-06  32%  1u0mA  [c.95.1 - c.95.1] PUTATIVE POLYKETIDE SYNTHASE
    2e-05  25%  1xesC  [x.x.x] DIHYDROPINOSYLVIN SYNTHASE
    2e-05  29%  1d6iA  [c.95.1 - c.95.1] CHALCONE SYNTHASE
    2e-05  29%  1d6hA  [c.95.1 - c.95.1] CHALCONE SYNTHASE
    3e-05  35%  2p0uB  [x.x.x] STILBENECARBOXYLATE SYNTHASE 2
    3e-05  35%  2p0uA  [x.x.x] STILBENECARBOXYLATE SYNTHASE 2
    5e-05  29%  1xetD  [x.x.x] DIHYDROPINOSYLVIN SYNTHASE
    5e-05  29%  1xetC  [x.x.x] DIHYDROPINOSYLVIN SYNTHASE
    5e-05  29%  1xesD  [x.x.x] DIHYDROPINOSYLVIN SYNTHASE
    5e-05  29%  1xesA  [x.x.x] DIHYDROPINOSYLVIN SYNTHASE
    5e-05  29%  1u0uA  [c.95.1 - c.95.1] DIHYDROPINOSYLVIN SYNTHASE
    6e-05  24%  1qlvB  [c.95.1 - c.95.1] PYRONE SYNTHASE
    6e-05  24%  1qlvA  [c.95.1 - c.95.1] PYRONE SYNTHASE
    6e-05  24%  1ee0B  [c.95.1 - c.95.1] 2-PYRONE SYNTHASE
    6e-05  24%  1ee0A  [c.95.1 - c.95.1] 2-PYRONE SYNTHASE
    2e-04  35%  1z1eA  [x.x.x] STILBENE SYNTHASE
    3e-04  39%  1wl4A  [x.x.x] ACETYL-COENZYME A ACETYLTRANSFERASE 2
    3e-04  37%  2d51B  [x.x.x] PENTAKETIDE CHROMONE SYNTHASE
    3e-04  37%  2d51A  [x.x.x] PENTAKETIDE CHROMONE SYNTHASE
    3e-04  37%  2d3mB  [x.x.x] PENTAKETIDE CHROMONE SYNTHASE
    3e-04  37%  2d3mA  [x.x.x] PENTAKETIDE CHROMONE SYNTHASE
:326

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxNIEISYTARYVPPEVIDNQRLTEFMDTSDEWISQRTGIKKRHISLNESTADLAKKVAEKLLTKSGWNP
3il5A           -----ISCTSRYVPENCVTNHQLSEMMDTSDEWIHSRTGISERRIVTQENTSDLCHQVAKQLLEKSGKQA
3il5B           -----ISCTSRYVPENCVTNHQLSEMMDT-DEWIHSRTGISERRIVTQENTSDLCHQVAKQLLEKSGKQA
3il4B           --------TSRYVP-ENVTNHQLSEMMDTSDEWIHSRTGISERRIVTQENTSDLCHQVAKQLLEKSGKQA
3il4A           --------TSRYVP-ENVTNHQLSEMMDTSDEWIHSRTGISERRIVTQENTSDLCHQVAKQLLEKSGKQA
3il6A           -----ISCTSRYVPENCVTNHQLSEMMDTSAAWIHSRTGISERRIVTQENTSDLCHQVAKQLLEKSGKQA
2ebdB           --------TGVYLPKNVLTNFDLEKIVDTSDEWITTRTGIKERRIAKEETITYMATQAAKEALREANLSP
2ebdA           --------TGVYLPKNVLTNFDLEKIVDTSDEWITTRTGIKERRIAKEETITYMATQAAKEALREANLSP
1zowA           --NVGIKGFGAYAPEKIIDNAYFEQFLDTSDEWISKMTGIKERHADDDQDTSDLAYEASVKAIADAGIQP
3il7A           --NVGIKGFGAYAPEKIIDNAYFEQFLDTSDEWISKMTGIKERHADDDQDTSDLAYEASVKAIADAGIQP
1hndA           --------TGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAANETVSTMGFEAATRAIEMAGIEK
3il3A           --NSRILSTGSYLPSHIRTNADLEKMVDTSDEWIVTRSGIRERRIAAEDETATMGFEAAKNAIEAAQINP
3il9A           --------TGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAANETVSTMGFEAATRAIEMAGIEK
1ub7A           -----------YVPERVMTNADFEAYLDTSDEWIVTRTGIKERRVAADEYTSDLAFKAVEDLLRRHPGAL
1eblA           --------TGSYLPEQVRTNADL-EKVDTSDEWIVTRTGIRERHIAAPNETVSTGFEAATRAI-EAGIEK
1hnhA           --------TGSYLPEQVRTNADL-EKVDTSDEWIVTRTGIRERHIAAPNETVSTGFEAATRAI-EAGIEK
3gweA           -----IADIAGHLPEQVLTNDVLAQYPDWPAEKILAKTGIRERRIAARETAADLAYEAARKLFAQGAVGA
3gwaA           -----IADIAGHLPEQVLTNDVLAQYPDWPAEKILAKTGIRERRIAARETAADLAYEAARKLFAQGAVGA
1mzjB           -----------YRPRREVSNKEVCTWIDSTEEWIETRTGIRSRRIAEPDETIQVMGVAASRALEHAGVDP
1mzjA           -----------YRPRREVSNKEVCTWIDSTEEWIETRTGIRSRRIAEPDETIQVMGVAASRALEHAGVDP
1m1mB           -----------YRPERVVTNDEICQHIDSSDEWIYTRTGIKTRRFAADESAASMATEACRRALSNAGLSA
1m1mA           -----------YRPERVVTNDEICQHIDSSDEWIYTRTGIKTRRFAADESAASMATEACRRALSNAGLSA
1hzpA           -----------YRPERVVTNDEICQHIDSSDEWIYTRTGIKTRRFAADESAASMATEACRRALSNAGLSA
2ahbA           -----------YRPERVVTNDEICQHIDSSDEWIYTATGIKTRRFAADESAASMATEACRRALSNAGLSA
2qnxB           -----------YRPERVVTNDEIC--IDSSDEWIYTRTGIKTRRFAADESAASMATEACRRALSNAGLSA
1hnkA           --------TGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAANETVSTMGFEAATRAIEMAGIEK
2aj9A           -----------YRPERVVTNDEICQHIDSSDEAIYTRTGIKTRRFAADESAASMATEACRRALSNAGLSA
2qnzA           -----------YRPERVVTNDEICQ----SDEWIYTRTGIKTRRFAADESAASMATEACRRALSNAGLSA
2qnzB           -----------YRPERVVTNDEIC-----SDEWIYTRTGIKTRRFAADESAASMATEACRRALSNAGLSA
2qnyA           -----------YRPERVVTND---EICQSSDEWIYTRTGIKTRRFAADESAASMATEACRRALSNAGLSA
2qo0B           -----------YRPERVVTNDEICQHID---EWIYTRTGIKTRRFAADESAASMATEACRRALSNAGLSA
2qnyB           -----------YRPERVVTNDEIC-----SDEWIYTRTGIKTRRFAADESAASMATEACRRALSNAGLSA
2qo0A           -----------YRPERVVTNDEICQ------EWIYTRTGIKTRRFAADESAASMATEACRRALSNAGLSA
1u6eA           -----------YRPERVVTNDEICQHIDSSDEWIYTRTGIKTRRFAADESAASMATEACRRALSNAGLSA
3h76A           ------------LPKRQVSNHDLVGRINTSDEFIVERTGVRTRHVEPEQAVSALMVPAARQAIEAAGLLP
3h78B           ------------LPKRQVSNHDLVGRINTSDEFIVERTGVRTRHVEPEQAVSALMVPAARQAIEAAGLLP
3h78A           ------------LPKRQVSNHDLVGRINTSDEFIVERTGVRTRHVEPEQAVSALMVPAARQAIEAAGLLP
3h77B           ------------LPKRQVSNHDLVGRINTSDEFIVERTGVRTRHVEPEQAVSALMVPAARQAIEAAGLLP
3h77A           ------------LPKRQVSNHDLVGRINTSDEFIVERTGVRTRHVEPEQAVSALMVPAARQAIEAAGLLP
1u0vB           ----------------------------------------------------------------------
1u0vA           ----------------------------------------------------------------------
1i89A           ----------------------------------------------------------------------
1jwxA           ----------------------------------------------------------------------
1i8bA           ----------------------------------------------------------------------
1i88A           ----------------------------------------------------------------------
1i86A           ----------------------------------------------------------------------
1cmlA           ----------------------------------------------------------------------
1chwA           ----------------------------------------------------------------------
1cgkA           ----------------------------------------------------------------------
1bq6A           ----------------------------------------------------------------------
1bi5A           ----------------------------------------------------------------------
1u0mA           ----------------------------------------------------------------------
1xesC           -------------PPNAVDQSTYPDFYNEKFKRICERSAIKQRYMYLTEEILKLAKEAAEKAIQEWGQSK
1d6iA           ----------------------------------------------------------------------
1d6hA           ----------------------------------------------------------------------
2p0uB           ----------------------------------------------------------------------
2p0uA           ----------------------------------------------------------------------
1xetD           ----------------------------------------------------------------------
1xetC           ----------------------------------------------------------------------
1xesD           ----------------------------------------------------------------------
1xesA           ----------------------------------------------------------------------
1u0uA           ----------------------------------------------------------------------
1qlvB           ---------------------------------ICEKTAIKKRYLALTEDYLQLGKEAAVKAIDEWGLPK
1qlvA           ---------------------------------ICEKTAIKKRYLALTEDYLQLGKEAAVKAIDEWGLPK
1ee0B           ---------------------------------ICEKTAIKKRYLALTEDYLQLGKEAAVKAIDEWGLPK
1ee0A           ---------------------------------ICEKTAIKKRYLALTEDYLQLGKEAAVKAIDEWGLPK
1z1eA           ----------------------------------------------------------------------
1wl4A           ----------------------------------------------------------------------
2d51B           ----------------------------------------------------------------------
2d51A           ----------------------------------------------------------------------
2d3mB           ----------------------------------------------------------------------
2d3mA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           NSLDLIIVATMSPNSFTPATAAIVQGRISADNAVCFDISAACSGYIYGLSIVEAMLRNMNLKRAMLIGSE
3il5A           SEIDFILVATVTPDFNMPSVACQVQGAIGATEAFAFDISAACSGFVYALSMAEKLVLSGRYQTGLVIGGE
3il5B           SEIDFILVATVTPDFNMPSVACQVQGAIGATEAFAFDISAACSGFVYALSMAEKLVLSGRYQTGLVIGGE
3il4B           SEIDFILVATVTPDFNMPSVACQVQGAIGATEAFAFDISAACSGFVYALSMAEKLVLSGRYQTGLVIGGE
3il4A           SEIDFILVATVTPDFNMPSVACQVQGAIGATEAFAFDISAACSGFVYALSMAEKLVLSGRYQTGLVIGGE
3il6A           SEIDFILVATVTPDFNMPSVACQVQGAIGATEAFAFDISAA-SGFVYALSMAEKLVLSGRYQTGLVIGGE
2ebdB           EELDLIILATLTPQKRFPSTACLVQAQLKAKGVYAFDISAACSGFIYALDIADSFIKSGKAKNVLVIGAE
2ebdA           EELDLIILATLTPQKRFPSTACLVQAQLKAKGVYAFDISAACSGFIYALDIADSFIKSGKAKNVLVIGAE
1zowA           EDIDMIIVATATGDMPFPTVANMLQERLGTGKVASMDQLAACSGFMYSMITAKQYVQSGDYHNILVVGAD
3il7A           EDIDMIIVATATGDMPFPTVANMLQERLGTGKVASMDQLAACSGFMYSMITAKQYVQSGDYHNILVVGAD
1hndA           DQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSD
3il3A           QDIELIIVATTSHSHAYPSAACQVQGLLNIDDAISFDLAAA-TGFVYALSVADQFIRAGKVKKALVIGSD
3il9A           DQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAA-AGFTYALSVADQYVKSGAVKYALVVGSD
1ub7A           EGVDAVIVATNTPDALFPDTAALVQARFGL-KAFAYDLLAG-PGWIYALAQAHALVEAGLAQKVLAVGAE
1eblA           DQIGLIVVATTSATHAFPSAACQIQS-LGIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSD
1hnhA           DQIGLIVVATTSATHAFPSAACQIQS-LGIKGCPAFDVAAA-AGFTYALSVADQYVKSGAVKYALVVGSD
3gweA           DQVDFVILCTQAPDYVLPTSACMLQHRLGIPHAGALDVNLGCSGYVYGLSLAKGLVETGAARCVLLLTAD
3gwaA           DQVDFVILCTQAPDYVLPTSACMLQHRLGIPHAGALDVNLGCSGYVYGLSLAKGLVETGAARCVLLLTAD
1mzjB           AEIDLVVVSTMTNFVHTPPLSVAIAHELGADNAGGFDLSAACAGFCHALSIAADAVESGGSRHVLVVATE
1mzjA           AEIDLVVVSTMTNFVHTPPLSVAIAHELGADNAGGFDLSAACAGFCHALSIAADAVESGGSRHVLVVATE
1m1mB           ADIDGVIVTTNTHFLQTPPAAPMVAASLGAKGILGFDLSAGCAGFGYALGAAADMIRGGGAATMLVVGTE
1m1mA           ADIDGVIVTTNTHFLQTPPAAPMVAASLGAKGILGFDLSAGCAGFGYALGAAADMIRGGGAATMLVVGTE
1hzpA           ADIDGVIVTTNTHFLQTPPAAPMVAASLGAKGILGFDLSAGCAGFGYALGAAADMIRGGGAATMLVVGTE
2ahbA           ADIDGVIVTTNTHFLQTPPAAPMVAASLGAKGILGFDLSAGCAGFGYALGAAADMIRGGGAATMLVVGTE
2qnxB           ADIDGVIVTTNTHFLQTPPAAPMVAASLGAKGILGFDLSAGCAGFGYALGAAADMIRGGGAATMLVVGTE
1hnkA           DQIGLIVVAT---TSAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSD
2aj9A           ADIDGVIVTTNTHFLQTPPAAPMVAASLGAKGILGFDLSAGCAGFGYALGAAADMIRGGGAATMLVVGTE
2qnzA           ADIDGVIVTTNTHFLQTPPAAPMVAASLGAKGILGFDLSAGCAGFGYALGAAADMIRGGGAATMLVVGTE
2qnzB           ADIDGVIVTTNTHFLQTPPAAPMVAASLGAKGILGFDLSAGCAGFGYALGAAADMIRGGGAATMLVVGTE
2qnyA           ADIDGVIVTTNTHFLQTPPAAPMVAASLGAKGILGFDLSAGCAGFGYALGAAADMIRGGGAATMLVVGTE
2qo0B           ADIDGVIVTTNTHFLQTPPAAPMVAASLGAKGILGFDLSAGCAGFGYALGAAADMIRGGGAATMLVVGTE
2qnyB           ADIDGVIVTTNTHFLQTPPAAPMVAASLGAKGILGFDLSAGCAGFGYALGAAADMIRGGGAATMLVVGTE
2qo0A           ADIDGVIVTTNTHFLQTPPAAPMVAASLGAKGILGFDLSAGCAGFGYALGAAADMIRGGGAATMLVVGTE
1u6eA           ADIDGVIVTTNTHFLQTPPAAPMVAASLGAKGILGFDLSXXXXXXXXXXXXXXDMIRGGGAATMLVVGTE
3h76A           EDIDLLLVNTLSPDHHDPSQACLIQPLLGLRHIPVLDIRAQCSGLLYGLQMARGQILAGLARHVLVVCGE
3h78B           EDIDLLLVNTLSPDHHDPSQACLIQPLLGLRHIPVLDIRAQASGLLYGLQMARGQILAGLARHVLVVCGE
3h78A           EDIDLLLVNTLSPDHHDPSQACLIQPLLGLRHIPVLDIRAQASGLLYGLQMARGQILAGLARHVLVVCGE
3h77B           EDIDLLLVNTLSPDHHDPSQACLIQPLLGLRHIPVLDIRAQ-SGLLYGLQMARGQILAGLARHVLVVCGE
3h77A           EDIDLLLVNTLSPDHHDPSQACLIQPLLGLRHIPVLDIRAQ-SGLLYGLQMARGQILAGLARHVLVVCGE
1u0vB           ----------------------------------------------------------------------
1u0vA           ----------------------------------------------------------------------
1i89A           ----------------------------------------------------------------------
1jwxA           ----------------------------------------------------------------------
1i8bA           ----------------------------------------------------------------------
1i88A           ----------------------------------------------------------------------
1i86A           ----------------------------------------------------------------------
1cmlA           ----------------------------------------------------------------------
1chwA           ----------------------------------------------------------------------
1cgkA           ----------------------------------------------------------------------
1bq6A           ----------------------------------------------------------------------
1bi5A           ----------------------------------------------------------------------
1u0mA           ----------------------------------------------------------------------
1xesC           SGITLIFCSTTTPDGADFEVAKLLGLHPSVKRVGVFQHGCFAGGTV--LRMAKDLAENNRGARVLVICSE
1d6iA           ----------------------------------------------------------------------
1d6hA           ----------------------------------------------------------------------
2p0uB           ----------------------------------------------------------------------
2p0uA           ----------------------------------------------------------------------
1xetD           ----------------------------------------------------------------------
1xetC           ----------------------------------------------------------------------
1xesD           ----------------------------------------------------------------------
1xesA           ----------------------------------------------------------------------
1u0uA           ----------------------------------------------------------------------
1qlvB           SKITHLIFCTTAGVDMPGADYQLVKGLSPSVKRYMLYQQGAAGGTV--LRLAKDLAENNKGSRVLIVCSE
1qlvA           SKITHLIFCTTAGVDMPGADYQLVKGLSPSVKRYMLYQQGAAGGTV--LRLAKDLAENNKGSRVLIVCSE
1ee0B           SKITHLIFCTTAGVDMPGADYQLVKGLSPSVKRYMLYQQGAAGGTV--LRLAKDLAENNKGSRVLIVCSE
1ee0A           SKITHLIFCTTAGVDMPGADYQLVKGLSPSVKRYMLYQQGAAGGTV--LRLAKDLAENNKGSRVLIVCSE
1z1eA           ----------------------------------------------------------------------
1wl4A           ----------------------------------------------------------------------
2d51B           ----------------------------------------------------------------------
2d51A           ----------------------------------------------------------------------
2d3mB           ----------------------------------------------------------------------
2d3mA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           NLSKLIDWNDRSTAVLFGDGAAGALIELKEDTDSKFISSDLKTIGNEAEFLTAGITDPLEKFPDLDSIRK
3il5A           TFSKMLDWTDRSTAVLFGDGAAGVLIEAAE--TPHFLNEKLQADGQRWAALTSGYT--INESPFYQGHKQ
3il5B           TFSKMLDWTDRSTAVLFGDGAAGVLIEAAE--TPHFLNEKLQADGQRWAALTSGYT--INESPFYQGHKQ
3il4B           TFSKMLDWTDRSTAVLFGDGAAGVLIEAAE--TPHFLNEKLQADGQRWTALTSGYT--INESPFYQG-HK
3il4A           TFSKMLDWTDRSTAVLFGDGAAGVLIEAAE--TPHFLNEKLQADGQRWTALTSGYT--INESPFYQG-HK
3il6A           TFSKMLDWTDRSTAVLFGDGAAGVLIEAAE--TPHFLNEKLQADGQRWTALTSGYT--INESPFYQGHKQ
2ebdB           KLSEAVDWEDRSTCVLFGDG-AGAVVVTRSEDKSDILATRMYAEGSLEELLHAD---------------N
2ebdA           KLSEAVDWEDRSTCVLFGDG-AGAVVVTRSEDKSDILATRMYAEGSLEELLHAD---------------N
1zowA           KLSKITDLTDRSTAVLFGDGA-GAVIIGEVSEGRGIISYEMGSDGTGGKHL----------YLDKDTGK-
3il7A           KLSKITDLTDRSTAVLFGDGA-GAVIIGEVSEGRGIISYEMGSDGTGGKHL----------YLDKDTGK-
1hndA           VLARTCDPTDRGTIIIFGDGAGAAVLAASEEPG--IISTHLHADGSYGELLT---------LPNADRVNP
3il3A           LNSRKLDETDRSTVVLFGDGAGAVILEASEQEG--IISTHLHASADKNNALVLAQPER--------GIEK
3il9A           VLARTCDPTDRGTIIIFGDGAGAAVLAASEEPG--IISTHLHADGSYGELLT---------LPNADRVNP
1ub7A           ALSKIIDWNDRATXXXXXXXXXXXXXXXXXXXYG-FRSFVLGADGTGAKELYHACVAP--RLPDGTSMKN
1eblA           VLARTCDPTDRGTIIIFGDGAGAAVLAASEEPG--IISTHLHADGSYGELLT---------LPNADRVNP
1hnhA           VLARTCDPTDRGTIIIFGDGAGAAVLAASEEPG--IISTHLHADGSYGELLT---------LPNADRVNP
3gweA           TYSKYLHPLDKSVRTLFGDGASATAVIAEHGELERIGPFVFGTDGRGAPNLIAGLADSAREHEDASNVRT
3gwaA           TYSKYLHPLDKSVRTLFGDGASATAVIAEHGELERIGPFVFGTDGRGAPNLIAGLADSAREHEDASNVRT
1mzjB           RMTDVIDLADRSLSFLFGDGAGAAVVG----------PSDVPGIGPVVRGISLHMSSSWDQYVEDPSVGR
1mzjA           RMTDVIDLADRSLSFLFGDGAGAAVVG----------PSDVPGIGPVVRGISLHMSSSWDQYVEDPSVGR
1m1mB           KLSPTIDMYDRGNCFIFADGAAAVVV---GETPFQGIGPTVASDGEQADAIRQDI-DWITFAQNPSGPRP
1m1mA           KLSPTIDMYDRGNCFIFADGAAAVVV---GETPFQGIGPTVASDGEQADAIRQDI-DWITFAQNPSGPRP
1hzpA           KLSPTIDMYDRGNCFIFADGAAAVVV---GETPFQGIGPTVASDGEQADAIRQDI-DWITFAQNPSGPRP
2ahbA           KLSPTIDMYDAGNCFIFADGAAAVVV---GETPFQGIGPTVASDGEQADAIRQDI-DWITFAQNPSGPRP
2qnxB           KLSPTIDMYDRGNCFIFADGAAAVVV---GETPFQGIGPTVASDGEQADAIRQDI-DWITFAQNPSGPRP
1hnkA           VLA-------RTTIIIFGDGAGAAVLAASEEPG--IISTHLHADG-------------------------
2aj9A           KLSPTIDMYDAGNCFIFADGAAAVVV---GETPFQGIGPTVASDGEQADAIRQDI-DWITFAQNPSGPRP
2qnzA           KLSPTIDMYDRGNCFIFADGAAAVVV---GETPFQGIGPTVASDGEQADAIRQDI-DWITFAQNPSGPRP
2qnzB           KLSPTIDMYDRGNCFIFADGAAAVVV---GETPFQGIGPTVASDGEQADAIRQDI-DWITFAQNPSGPRP
2qnyA           KLSPTIDMYDRGNCFIFADGAAAVVV---GETPFQGIGPTVASDGEQADAIRQDI-DWITFAQNPSGPRP
2qo0B           KLSPTIDMYDRGNCFIFADGAAAVVV---GETPFQGIGPTVASDGEQADAIRQDI-DWITFAQNPSGPRP
2qnyB           KLSPTIDMYDRGNCFIFADGAAAVVV---GETPFQGIGPTVASDGEQADAIRQDI-DWITFAQNPSGPRP
2qo0A           KLSPTIDMYDRGNCFIFADGAAAVVV---GETPFQGIGPTVASDGEQADAIRQDI-DWITFAQNPSGPRP
1u6eA           KLSPTIDMYDRGNCFIFADGAAAVVVG---ETPFQGIGPTVASDGEQADAIRQDI-DWITFAQNPSGPRP
3h76A           VLSKRMDCSDRNLSILLGDXXXXXXXXXXESXXXXXXXXXXXXXXNYFDLLTAAPGSASPTFLDENVLRE
3h78B           VLSKRMDCSDRNLSILLGDXXXXXXXXXXESXXXXXXXXXXXXXXNYFDLLTAAPGSASPTFLDENVLRE
3h78A           VLSKRMDCSDRNLSILLGDXXXXXXXXXXESXXXXXXXXXXXXXXNYFDLLTAAPGSASPTFLDENVLRE
3h77B           VLSKRMDCSDRNLSILLGDXXXXXXXXXXESXXXXXXXXXXXXXXNYFDLLTAAPGSASPTFLDENVLRE
3h77A           VLSKRMDCSDRNLSILLGDXXXXXXXXXXESXXXXXXXXXXXXXXNYFDLLTAAPGSASPTFLDENVLRE
1u0vB           ----------------------------------------------------------------------
1u0vA           ----------------------------------------------------------------------
1i89A           ---------------LFGDGAAALIV------GSDPVPEIEKPIF-EMVWTAQTIAPDSEGAIDLHLREA
1jwxA           ----------------------------------------------------------------------
1i8bA           ----------------------------------------------------------------------
1i88A           ----------------------------------------------------------------------
1i86A           ----------------------------------------------------------------------
1cmlA           ----------------------------------------------------------------------
1chwA           ----------------------------------------------------------------------
1cgkA           ----------------------------------------------------------------------
1bq6A           ----------------------------------------------------------------------
1bi5A           ----------------------------------------------------------------------
1u0mA           ----------------------------------------------------------------------
1xesC           TTAVTFRGPSETHSLLFGDGASALIVGADPIPQVEKACFEI--------VWTAQTVVPNSEGAIGGKVRE
1d6iA           ----------------------------------------------------------------------
1d6hA           ----------------------------------------------------------------------
2p0uB           ----------------------------------------------------------------------
2p0uA           ----------------------------------------------------------------------
1xetD           ----------------------------------------------------------------------
1xetC           ----------------------------------------------------------------------
1xesD           ----------------------------------------------------------------------
1xesA           ----------------------------------------------------------------------
1u0uA           ----------------------------------------------------------------------
1qlvB           ITAILFHGPNENAQALFGDGAAALIVGAVERPIFEIVSTDQT------------ILPDTEKAMKLHLREG
1qlvA           ITAILFHGPNENAQALFGDGAAALIVGAVERPIFEIVSTDQT------------ILPDTEKAMKLHLREG
1ee0B           ITAILFHGPNENAQALFGDGAAALIVGAVERPIFEIVSTDQT------------ILPDTEKAMKLHLREG
1ee0A           ITAILFHGPNENAQALFGDGAAALIVGAVERPIFEIVSTDQT------------ILPDTEKAMKLHLREG
1z1eA           ----------------------------------------------------------------------
1wl4A           ----------------------------------------------------------------------
2d51B           ----------------------------------------------------------------------
2d51A           ----------------------------------------------------------------------
2d3mB           ----------------------------------------------------------------------
2d3mA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           YTTFKMDGRRVYTFATREVPQSILRAVQKANLSLEDIDYFILHQANSRIIRQVAKKLKQDEEKFPINIDS
3il5A           ASTLQMEGRSIFDFAIKDVSQNILSLVTD-----ETVDYLLLHQANVRIIDKIARKTKISREKFLTNMDK
3il5B           ASTLQMEGRSIFDFAIKDVSQNILSLVTD-----ETVDYLLLHQANVRIIDKIARKTKISREKFLTNMDK
3il4B           SKTLQMEGRSIFDFAIKDVSQNILSLVTD-----ETVDYLLLHQASVRIIDKIARKTKISREKFLTNMDK
3il4A           SKTLQMEGRSIFDFAIKDVSQNILSLVTD-----ETVDYLLLHQASVRIIDKIARKTKISREKFLTNMDK
3il6A           ASTLQMEGRSIFDFAIKDVSQNILSLVTD-----ETVDYLLLHQANVRIIDKIARKTKISREKFLTNMDK
2ebdB           CGYIRMKGRELFKVAVRSMEEVCREVLEKAGVKPEEVSLVIPHQANVRIINALAEKLNIPKEKVFVNIQK
2ebdA           CGYIRMKGRELFKVAVRSMEEVCREVLEKAGVKPEEVSLVIPHQANVRIINALAEKLNIPKEKVFVNIQK
1zowA           ---LKMNGREVFKFAVRIMGDASTRVVEKANLTSDDIDLFIPHQANIRIMESARERLGISKDKMSVSVNK
3il7A           ---LKMNGREVFKFAVRIMGDASTRVVEKANLTSDDIDLFIPHQANIRIMESARERLGISKDKMSVSVNK
1hndA           ENSLTMAGNEVFKVAVTELAHIVDETLAANNLDRSQLDWLVPHQANLRIISATAKKLGMSMDNVVVTLDR
3il3A           SGYIEMQGNETFKLAVRELSNVVEETXXXXXXXXXXXXXXVPHQANLRIITATAKKLEMDMSQVVVTLDK
3il9A           ENSIHMAGNEVFKVAVTELAHIVDETLAANNLDRSQLDWLVPHQANLRIISATAKKLGMSMDNVVVTLDR
1ub7A           --RLYMNGREVFKFAVRVMNTATLEAIEKAGLTPEDIRLFVPHQANLRIIDAARERLGLPWERVAVNVDR
1eblA           ENSIHLTGNEVFKVAVTELAHIVDETLAANNNDRSQLDWLVPHQANLRIISATAKKLGSD--NVVVTLDR
1hnhA           ENSIHLTGNEVFKVAVTELAHIVDETLAANNLDRSQLDWLVPHQANLRIISATAKKLGSDN--VVVTLDR
3gweA           DEHLYMNGAEVMAFSLAEVPRAADRLLALAGEPRENIDCFVLHQANRFMLDALRKKMKIPEHKFPVLMEH
3gwaA           DEHLYMNGAEVMAFSLAEVPRAADRLLALAGEPRENIDCFVLHQANRFMLDALRKKMKIPEHKFPVLMEH
1mzjB           -PALVMDGKRVFRWAVADVVPAAREALEVAGLTVGDLVAFVPHQANLRIIDVLVDRLGVPEHVVSRDAED
1mzjA           -PALVMDGKRVFRWAVADVVPAAREALEVAGLTVGDLVAFVPHQANLRIIDVLVDRLGVPEHVVSRDAED
1m1mB           FV--RLEGPAVFRWAAFKMGDVGRRAMDAAGVRPDQIDVFVPHQANSRINELLVKNLQLRPDAVVANIEH
1m1mA           FV--RLEGPAVFRWAAFKMGDVGRRAMDAAGVRPDQIDVFVPHQANSRINELLVKNLQLRPDAVVANIEH
1hzpA           FV--RLEGPAVFRWAAFKMGDVGRRAMDAAGVRPDQIDVFVPHQANSRINELLVKNLQLRPDAVVANIEH
2ahbA           FV--RLEGPAVFRWAAFKMGDVGRRAMDAAGVRPDQIDVFVPHQANSRINELLVKNLQLRPDAVVANIEH
2qnxB           FV--RLEGPAVFRWAAFKMGDVGRRAMDAAGVRPDQIDVFVPHQANSRINELLVKNLQLRPDAVVANIEH
1hnkA           ---------------STELAHIVDETLAANNLDRSQLDWLVPHQANLRIISATAKKLGMSMDNVVVTLDR
2aj9A           FV--RLEGPAVFRWAAFKMGDVGRRAMDAAGVRPDQIDVFVPHQANSRINELLVKNLQLRPDAVVANIEH
2qnzA           FV--RLEGPAVFRWAAFKMGDVGRRAMDAAGVRPDQIDVFVPHQANSRINELLVKNLQLRPDAVVANIEH
2qnzB           FV--RLEGPAVFRWAAFKMGDVGRRAMDAAGVRPDQIDVFVPHQANSRINELLVKNLQLRPDAVVANIEH
2qnyA           FV--RLEGPAVFRWAAFKMGDVGRRAMDAAGVRPDQIDVFVPHQFNSRINELLVKNLQLRPDAVVANIEH
2qo0B           FV--RLEGPAVFRWAAFKMGDVGRRAMDAAGVRPDQIDVFVPHQFNSRINELLVKNLQLRPDAVVANIEH
2qnyB           FV--RLEGPAVFRWAAFKMGDVGRRAMDAAGVRPDQIDVFVPHQFNSRINELLVKNLQLRPDAVVANIEH
2qo0A           FV--RLEGPAVFRWAAFKMGDVGRRAMDAAGVRPDQIDVFVPHQFNSRINELLVKNLQLRPDAVVANIEH
1u6eA           FV--RLEGPAVFRWAAFKMGDVGRRAMDAAGVRPDQIDVFVPHQANSRINELLVKNLQLRPDAVVANIEH
3h76A           GGEFLMRGRPMFEHASQTLVRIAGEMLAAHELTLDDIDHVICHQPNLRILDAVQEQLGIPQHKFAVTVDR
3h78B           GGEFLMRGRPMFEHASQTLVRIAGEMLAAHELTLDDIDHVICHQPNLRILDAVQEQLGIPQHKFAVTVDR
3h78A           GGEFLMRGRPMFEHASQTLVRIAGEMLAAHELTLDDIDHVICHQPNLRILDAVQEQLGIPQHKFAVTVDR
3h77B           GGEFLMRGRPMFEHASQTLVRIAGEMLAAHELTLDDIDHVICHQPNLRILDAVQEQLGIPQHKFAVTVDR
3h77A           GGEFLMRGRPMFEHASQTLVRIAGEMLAAHELTLDDIDHVICHQPNLRILDAVQEQLGIPQHKFAVTVDR
1u0vB           --TFHLKGA-VPDIVSKNITKALVEAFEPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMNATLSE
1u0vA           --TFHLKGA-VPDIVSKNITKALVEAFEPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMNATLSE
1i89A           GLTFHLL-KDVPGIVSKNITKALVEAFEPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMNATLSE
1jwxA           ---------------SKNITKALVEAFEPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMNATLSE
1i8bA           ---------------SKNITKALVEAFEPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMNATLSE
1i88A           ---------------SKNITKALVEAFEPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMNATLSE
1i86A           ---------------SKNITKALVEAFEPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMNATLSE
1cmlA           ---------------SKNITKALVEAFEPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMNATLSE
1chwA           ---------------SKNITKALVEAFEPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMNATLSE
1cgkA           ---------------SKNITKALVEAFEPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMNATLSE
1bq6A           ---------------SKNITKALVEAFEPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMNATLSE
1bi5A           ---------------SKNITKALVEAFEPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMNATLSE
1u0mA           -----------------------------------DLDFYIVHAGGPRILDDLSTFLEVDPHAFRFSLTE
1xesC           VLTFQLKGA-VPDLISANIENCMVEAFSQFKISDWNKLFWVVHPGGRAILDRVEAKLNLDPTKLPTRMSE
1d6iA           ---------------SKNITKALVEAFEPLGISDYNSIFWIAQPGGPAILDQVEQKLALKPEKMNATLSE
1d6hA           ---------------SKNITKALVEAFEPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMNATLSE
2p0uB           --------------------------------------FWAVHPGGPAILDQVEAKLELEKGKFQASRDD
2p0uA           --------------------------------------FWAVHPGGPAILDQVEAKLELEKGKFQASRDD
1xetD           --TFQLKGA-VPDLISANIENCMVEAFSQFKISDWNKLFWVVHPGGRAILDRVEAKLNLDPTKLPTRMSE
1xetC           --TFQLKGA-VPDLISANIENCMVEAFSQFKISDWNKLFWVVHPGGRAILDRVEAKLNLDPTKLPTRMSE
1xesD           --TFQLKGA-VPDLISANIENCMVEAFSQFKISDWNKLFWVVHPGGRAILDRVEAKLNLDPTKLPTRMSE
1xesA           --TFQLKGA-VPDLISANIENCMVEAFSQFKISDWNKLFWVVHPGGRAILDRVEAKLNLDPTKLPTRMSE
1u0uA           --TFQLKGA-VPDLISANIENCMVEAFSQFKISDWNKLFWVVHPGGRAILDRVEAKLNLDPTKLPTRMSE
1qlvB           GLTFQLH-RDVPLMVAKNIENAAEKALSPLGITDWNSVFWMVHPGGRAILDQVERKLNLKEDKLRASLSE
1qlvA           GLTFQLH-RDVPLMVAKNIENAAEKALSPLGITDWNSVFWMVHPGGRAILDQVERKLNLKEDKLRASLSE
1ee0B           GLTFQLH-RDVPLMVAKNIENAAEKALSPLGITDWNSVFWMVHPGGRAILDQVERKLNLKEDKLRASLSE
1ee0A           GLTFQLH-RDVPLMVAKNIENAAEKALSPLGITDWNSVFWMVHPGGRAILDQVERKLNLKEDKLRASLSE
1z1eA           ------------------ISQNINDALSKAFDPLGISDYWIAHPGGRAILDQVEEKVNLKPEKMKATRDN
1wl4A           ---------------------AIKQAVTKAGWSLEDVDIFEINEAFAAVSAAIVKELGLNPEK--VNIE-
2d51B           --------------------------------------FWIPHPGGRAILDQVEAKLKLRPEKFRAALWD
2d51A           --------------------------------------FWIPHPGGRAILDQVEAKLKLRPEKFRAALWD
2d3mB           --------------------------------------FWIPHPGGRAILDQVEAKLKLRPEKFRAALWD
2d3mA           --------------------------------------FWIPHPGGRAILDQVEAKLKLRPEKFRAALWD


                         .         *         .         .         .         .         +:350
query           FGNTSAASEPLLLDELIENGTVKRGMTLALSGFGGGLTVGTHIIKY
3il5A           YGNTSAASIPILLDEAVENGTLILG---------------------
3il5B           YGNTSAASIPILLDEAVENGTLILG---------------------
3il4B           YGNTSAASIPILLDEAVENGTLILG---------------------
3il4A           YGNTSAASIPILLDEAVENGTLILG---------------------
3il6A           YGNTSAASIPILLDEAVENGTLILG---------------------
2ebdB           YGNTSAASIPIALHEAIKEGKVKRGDLILMTAMGGGLTWGAVLLRY
2ebdA           YGNTSAASIPIALHEAIKEGKVKRGDLILMTAMGGGLTWGAVLLRY
1zowA           YGNTSAASIPLSIDQELKNGKLKDDDTIVLVGFGGGLTWGAMTIKW
3il7A           YGNTSAASIPLSIDQELKNGKLKDDDTIVLVGFGGGLTWGAMTIKW
1hndA           HGNTSAASVPCALDEAVRDGRIKPGQLVLLEAFGGGFTWGSALVRF
3il3A           YANNSAATVPVALDEAIRDGRIQRGQLLLLEAFGGGWTWGSALVRF
3il9A           HGNTSAASVPCALDEAVRDGRIKPGQLVLLEAFGGGFTWGSALVRF
1ub7A           YGNTSTASIPLALKEAVDAGRIREGDHVLLVSFGAGLTWAAAVLTW
1eblA           HGNTSAASVPCALDEAVRDGRIKPGQLVLLEAFGGGFTWGSALVRF
1hnhA           HGNTSAASVPCALDEAVRDGRIKPGQLVLLEAFGGGFTWGSALVRF
3gweA           CGNTVSSTLPLALETMRANGTLARGMRLMLLGFGVG----------
3gwaA           CGNTVSSTLPLALETMRANGTLARGMRLMLLGFGVG----------
1mzjB           TGNTSSASVALALDRLVRSGAVPGGGPALMIGFGAGLS--------
1mzjA           TGNTSSASVALALDRLVRSGAVPGGGPALMIGFGAGLS--------
1m1mB           TGNTSAASIPLAMAELLTTGAAKPGDLALLIGYGAGLSYAAQVVR-
1m1mA           TGNTSAASIPLAMAELLTTGAAKPGDLALLIGYGAGLSYAAQVVR-
1hzpA           TGNTSAASIPLAMAELLTTGAAKPGDLALLIGYGAGLSYAAQVVR-
2ahbA           TGNTSAASIPLAMAELLTTGAAKPGDLALLIGYGAGLSYAAQVVR-
2qnxB           TGNTSAASIPLAMAELLTTGAAKPGDLALLIGYGAGLSYAAQVVR-
1hnkA           HGNTSAASVPCALDEAVRDGRIKPGQLVLLEAF---FTWGSALVRF
2aj9A           TGNTSAASIPLAMAELLTTGAAKPGDLALLIGYGAGLSYAAQVVR-
2qnzA           TGNTSAASIPLAMAELLTTGAAKPGDLALLIGYGAGLSYAAQVVR-
2qnzB           TGNTSAASIPLAMAELLTTGAAKPGDLALLIGYGAGLSYAAQVVR-
2qnyA           TGNTSAASIPLAMAELLTTGAAKPGDLALLIGYGAGLSYAAQVVR-
2qo0B           TGNTSAASIPLAMAELLTTGAAKPGDLALLIGYGAGLSYAAQVVR-
2qnyB           TGNTSAASIPLAMAELLTTGAAKPGDLALLIGYGAGLSYAAQVVR-
2qo0A           TGNTSAASIPLAMAELLTTGAAKPGDLALLIGYGAGLSYAAQVVR-
1u6eA           TGNTSAASIPLAMAELLTTGAAKPGDLALLIGYGAGLSYAAQVVR-
3h76A           LGNMASASTPVTLAMFWPD--IQPGQRVLVLTYGSGATWGAALYR-
3h78B           LGNMASASTPVTLAMFWPD--IQPGQRVLVLTYGSGATWGAALYR-
3h78A           LGNMASASTPVTLAMFWPD--IQPGQRVLVLTYGSGATWGAALYR-
3h77B           LGNMASASTPVTLAMFWPD--IQPGQRVLVLTYGSGATWGAALYR-
3h77A           LGNMASASTPVTLAMFWPD--IQPGQRVLVLTYGSGATWGAALYR-
1u0vB           YGNMSSACVLFILDEMTQNGLKTTGEGLVLFGFGPGLTIETVVLR-
1u0vA           YGNMSSACVLFILDEMTQNGLKTTGEGLVLFGFGPGLTIETVVLR-
1i89A           YGNMSSACVLFILDEMTQNGLKTTGEGLVLFGFGPGLTIETVVLR-
1jwxA           YGNMSSACVLFILDEMTQNGLKTTGEGLVLFGFGPGLTIETVVLR-
1i8bA           YGNMSSACVLFILDEMTQNGLKTTGEGLVLFGFGPGLTIETVVLR-
1i88A           YGNMSSACVLFILDEMTQNGLKTTGEGLVLFGFGPGLTIETVVLR-
1i86A           YGNMSSACVLFILDEMTQNGLKTTGEGLVLFGFGPGLTIETVVLR-
1cmlA           YGNMSSACVLFILDEMTQNGLKTTGEGLVLFGFGPGLTIETVVLR-
1chwA           YGNMSSACVLFILDEMTQNGLKTTGEGLVLFGFGPGLTIETVVLR-
1cgkA           YGNMSSACVLFILDEMTQNGLKTTGEGLVLFGFGPGLTIETVVLR-
1bq6A           YGNMSSACVLFILDEMTQNGLKTTGEGLVLFGFGPGLTIETVVLR-
1bi5A           YGNMSSACVLFILDEMTQNGLKTTGEGLVLFGFGPGLTIETVVLR-
1u0mA           YGNIASAVVLDALRRLFDEGGVEEGARGLLAGFGPGIT--------
1xesC           YGNMSSACVHFILDQTLQNGCSTTGEGLVLFGFGPGLTIETVVLK-
1d6iA           YGNMSSACVLFILDEMTQNGLKTTGEGLVLFGFGPGLTIETVVLR-
1d6hA           YGAMSSACVLFILDEMTQNGLKTTGEGLVLFGFGPGLTIETVVLR-
2p0uB           YGNMSSASVLFVLDRVRERSLESNKSTFGLIGFGPGLTVETLLLR-
2p0uA           YGNMSSASVLFVLDRVRERSLESNKSTFGLIGFGPGLTVETLLLR-
1xetD           YGNMSSACVHFILDQTLQNGCSTTGEGLVLFGFGPGLTIETVVLK-
1xetC           YGNMSSACVHFILDQTLQNGCSTTGEGLVLFGFGPGLTIETVVLK-
1xesD           YGNMSSACVHFILDQTLQNGCSTTGEGLVLFGFGPGLTIETVVLK-
1xesA           YGNMSSACVHFILDQTLQNGCSTTGEGLVLFGFGPGLTIETVVLK-
1u0uA           YGNMSSACVHFILDQTLQNGCSTTGEGLVLFGFGPGLTIETVVLK-
1qlvB           YGNLISACVLFIIDEVRKRSMAEGKSTTVLFGFGPGMTVETVVLR-
1qlvA           YGNLISACVLFIIDEVRKRSMAEGKSTTVLFGFGPGMTVETVVLR-
1ee0B           YGNLISACVLFIIDEVRKRSMAEGKSTTVLFGFGPGMTVETVVLR-
1ee0A           YGNLISACVLFIIDEVRKRSMAEGKSTTVLFGFGPGMTVETVVLR-
1z1eA           YGNMSSACVFFIMDLMLEAGLKTTGEGLVLFGFGPGLTIETVVLR-
1wl4A           -GGAIALGHPL-----------------------------------
2d51B           YGNMVSASVGYILDEMRRKSAAKGLETYVLLGFGPGITVETILL--
2d51A           YGNMVSASVGYILDEMRRKSAAKGLETYVLLGFGPGITVETILL--
2d3mB           YGNMVSASVGYILDEMRRKSAAKGLETYVLLGFGPGITVETILL--
2d3mA           YGNMVSASVGYILDEMRRKSAAKGLETYVLLGFGPGITVETILL--