[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:efp.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1uebA.bssp"
#ERROR : Can't open dsspfile "1ybyB.bssp"
#ERROR : Can't open dsspfile "1ybyA.bssp"
#ERROR : Can't open dsspfile "1uebB.bssp"
#ERROR : Can't open dsspfile "3huwV.bssp"
#ERROR : Can't open dsspfile "1iz6C.bssp"
#ERROR : Can't open dsspfile "1iz6A.bssp"
#ERROR : Can't open dsspfile "1eifA.bssp"
#ERROR : Can't open dsspfile "1bkbA.bssp"
#ERROR : Can't open dsspfile "2eifA.bssp"

## Summary of PDB Search
:185
    3e-47  47%  1uebA  [b.34.5 - b.40.4 - b.40.4] ELONGATION FACTOR P
    1e-46  54%  1ybyB  [x.x.x] TRANSLATION ELONGATION FACTOR P
    2e-43  53%  1ybyA  [x.x.x] TRANSLATION ELONGATION FACTOR P
    6e-43  47%  1uebB  [b.34.5 - b.40.4 - b.40.4] ELONGATION FACTOR P
    1e-41  46%  3huwV  [x.x.x] ELONGATION FACTOR P
    1e-07  32%  1iz6C  [b.34.5 - b.40.4] INITIATION FACTOR 5A
    1e-07  32%  1iz6A  [b.34.5 - b.40.4] INITIATION FACTOR 5A
    4e-06  34%  1eifA  [x.x.x] EUKARYOTIC TRANSLATION INITIATION FACTOR 5A
    5e-06  32%  1bkbA  [x.x.x] TRANSLATION INITIATION FACTOR 5A
    2e-05  33%  2eifA  [b.34.5 - b.40.4] PROTEIN (EUKARYOTIC TRANSLATION
:185

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MISVNEFKNGLTIEVDGELWRVVEFQHVKPGKGSAFVRSKLKNLRTGAVQEKTFRAGEKVNQAQIDRKKM
1uebA           MISVTDLRPGTKVKMDGGLWECVEYQHQKLGRGGAKVVAKFKNLETGATVERTFNSGEKLEDIYVETREL
1ybyB           -ISAGDFKNGVTFELDGQIFQVIEFQHVKPGKGAAFVRTKLKNIVTGATIEKTFNPTDK-PKAHIERKD-
1ybyA           -ISAGDFKNGVTFELDGQIFQVIEFQHVKPG--AAFVRTKLKNIVTGATIEKTFNPTDKP-KAHIERKD-
1uebB           MISVTDLRPGTKVKMDGGLWECVEYQHQKLGRGGAKVVAKFKNLETGATVERTFNSGEKLEDIYVETREL
3huwV           MISVTDLRPGTKVKMDGGLWECVEYQHQKLGRGGAKVVAKFKNLETGATVERTFNSGEKLEDIYVETREL
1iz6C           -VQVSKLKPGRYIIIDDEPCRIVNITVSSPGKGSAKARIEAVGIFDGKVRSIVKPTSAEVDVPIIDKKTA
1iz6A           -VQVSKLKPGRYIIIDDEPCRIVNITVSSPGKGSAKARIEAVGIFDGKVRSIVKPTSAEVDVPIIDKKTA
1eifA           -VNVGSLKVGQYVMIDGVPCEIVDISVSKPGKGA---KARVVGIGIFEKVKKEFVASSKVEVPIIDRRKG
1bkbA           -VEAGELKEGSYVVIDGEPCRVVEIEKSKTGKGSAKARIVAVGVFDGGKRTLSLPVDAQVEVPIIEKFTA
2eifA           -VNVGSLKVGQYVMIDGVPCEIVDISVSKPGKGGAKARVVGIGIFEKVKKEFVAPTSSKVEVPIIDRRKG


                         .         .         *         .         .         .         .:140
query           QYLYADGDNYVFMDTNTYEQLELPGSQIEEELKYMKENMVVSIIMFGTETLGVELPNTVDLEVKETEPGI
1uebA           QYLYPEGEEMVFMDLETYEQFAVPRSRV-VGAEFFKEGMTALGDMYEGQPIKVTPPTVVELKVVDTPPGV
1ybyB           QYLYNDGDLYYF-DTETFEQLPLGKDKIGDALKFVKENEIVKVLSHKGNVFGIEPPNFVELEVTDTEPGF
1ybyA           QYLYNDGDLYYF-DTETFEQLPLGKDKIGDALKFVKENEIVKVLSHKGNVFGIEPPNFVELEVTDT----
1uebB           QYLYPEGEEMVFMDLETYEQFAVPRSRV-VGAEFFKEGMTALGDMYEGQPIKVTPPTVVELKVVDTPPG-
3huwV           QYLYPEGEEMVFMDLETYEQFAVPRSRV-VGAEFFKEGMTALGDMYEGQPIKVTPPTVVELKVVDTPP--
1iz6C           QVIAITPDTVQIMDMETYETFEVPADEIRDQLK-------------------------------------
1iz6A           QVIAITPDTVQIMDMETYETFEVPADEIRDQLK-------------------------------------
1eifA           QVLAIMGDMVQIMDLQTYE---------------------------------------------------
1bkbA           QILSVSGD--VIQLDRDYKTIEVP-KYVEEEAK-------------------------------------
2eifA           QVLAIMGDMVQIMDLQTYE---------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KGDTSSGGSKPATMETGLVVQVPFFVSEGDVLTINTSDGTYISRA
1uebA           RGDTVSGGSKPATLETGAVVQVPLFVEPGEVIKVDTRTGEYVGRA
1ybyB           -------ATKPAIVETGASIKVPLFVNKGDIIRIDTRTGEY----
1ybyA           ---TATGATKPAIVETGASIKVPLFVNKGDIIRIDTRTGEY----
1uebB           -----SGGSKPATLETGAVVQVPLFVEPGEVIKVDTRTGEYVGRA
3huwV           ------GGSKPATLETGAVVQVPLFVEPGEVIKVDTRTGEYVGRA
1iz6C           ---------------------------------------------
1iz6A           ---------------------------------------------
1eifA           ---------------------------------------------
1bkbA           ---------------------------------------------
2eifA           ---------------------------------------------