[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:nusA

[Show Plain Result]

#ERROR : Can't open dsspfile "1hh2P.bssp"
#ERROR : Can't open dsspfile "1l2fA.bssp"
#ERROR : Can't open dsspfile "1k0rA.bssp"
#ERROR : Can't open dsspfile "2atwC.bssp"
#ERROR : Can't open dsspfile "2atwA.bssp"
#ERROR : Can't open dsspfile "2asbA.bssp"

## Summary of PDB Search
:375
    3e-87  49%  1hh2P  [d.202.1 - b.40.4 - d.52.3 - d.52.3] N UTILIZATION SUBSTANCE
    9e-85  49%  1l2fA  [d.202.1 - b.40.4 - d.52.3 - d.52.3] N UTILIZATION SUBSTANCE
    2e-68  46%  1k0rA  [d.202.1 - b.40.4 - d.52.3 - d.52.3] NUSA
    5e-57  49%  2atwC  [x.x.x] TRANSCRIPTION ELONGATION PROTEIN NUSA
    1e-56  50%  2atwA  [x.x.x] TRANSCRIPTION ELONGATION PROTEIN NUSA
    1e-56  50%  2asbA  [x.x.x] TRANSCRIPTION ELONGATION PROTEIN NUSA
:375

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxVEKGVKKEIVIEALEAALVSAYKRNYGQAQNVEVEFDKIAGNIHVYAVKEVVNEVYD
1hh2P           --------------EKGISKEEVIPILEKALVSAYRKNFGNSKNVEVVIDRNTGNIKVYQLLXXXXXXXD
1l2fA           --------------EKGISKEEVIPILEKALVSAYRKNFGNSKNVEVVIDRNTGNIKVYQLLXXXXXXXD
1k0rA           -------------VDRGISVNELLETIKSALLTAYRHTQGHQTDARIEIDRKTGVVRVIA----------
2atwC           ----------------------------------------------------------------------
2atwA           ----------------------------------------------------------------------
2asbA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SQLEISLKSALEINRAYEIGDTIREEVTPKDFGRIAAQTAKQVIMQRVRKEEREVIYNEYVQYEQEIVTG
1hh2P           PATQISLEEAKKIDPLAEVGSIVKKELNVKNFGRIAAQTAKQVLIQRIRELEKEKQFEKYSELKGTVTTA
1l2fA           PATQISLEEAKKIDPLAEVGSIVKKELNVKNFGRIAAQTAKQVLIQRIRELEKEKQFEKYSELKGTVTTA
1k0rA           -------------RETDEAGNLISEDDTPEGFGRIAATTARQVMLQRFRDAES--------TREGEIVAG
2atwC           ----------------------------------------------------------EFSTREGEIVAG
2atwA           ---------------------------------------------------------------EGEIVAG
2asbA           ---------------------------------------------------------------EGEIVAG


                         +         .         .         .         .         *         .:210
query           EVERRDNKFVYVNLGRIEAVLSRQDQIPGEEYKSHDKIKVYIYKVENTSKGPQVFVSRSHPDLLRRLFEQ
1hh2P           EVIRVMGEWADIRIGKLETRLPKKEWIPGEEIKAGDLVKVYIIDVVKTTKGPKILVSRRVPEFVIGLMKL
1l2fA           EVIRV-GEWADIRIGKLETRLPKKEWIPGEEIKAGDLVKVYIIDVVKTTKGPKILVSRRVPEFVIGL-KL
1k0rA           VIQRDSRALVVVRIGASEGVIPAAEQVPGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSL
2atwC           VIQRDSRALVVVRIGTSEGVIPAAEQVPGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSL
2atwA           VIQRDSRALVVVRIGTSEGVIPAAEQVPGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSL
2asbA           VIQRDSRALVVVRIGTSEGVIPAAEQVPGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSL


                         .         .         .         +         .         .         .:280
query           EIPEIFDGTVEIVSISREAGDRAKVAVRSNEDGVDPVGTCVGPRGERVQAIVNELKGENMDIVEWREDPA
1hh2P           EIPEVENGIVEIKAIAREPGVRTKVAVASNDPNVDPIGACIGEGGSRIAAILKELKGEKLDVLKWSDDPK
1l2fA           EIPEVENGIVEIKAIAREPGVRTKVAVASNDPNVDPIGACIGEGGSRIAAILKELKGEKLDVLKWSDDPK
1k0rA           EVPEIADGSVEIVAVAREAGHRSKIAVRSNVAGLNAKGACIGPMGQRVRNVMSELSGEKIDIIDYDDDPA
2atwC           EVPEIADGSVEIVAVAREAGHRSKIAVRSNVAGLNAKGACIGPMGQRVRNVMSELSGEKIDIIDYDDDPA
2atwA           EVPEIADGSVEIVAVAREAGHRSKIAVRSNVAGLNAKGACIGPMGQRVRNVMSELSGEKIDIIDYDDDPA
2asbA           EVPEIADGSVEIVAVAREAGHRSKIAVRSNVAGLNAKGACIGPMGQRVRNVMSELSGEKIDIIDYDDDPA


                         .         *         .         .         .         .         +:350
query           EYIANALNPAKVLDVRFDDENEHACTVVVPDDQLSLAIGKRGQNARLAARLTGYKIDIKSESxxxxxxxx
1hh2P           QLIANALAPATVIEVEILDKENKAARVLVPPTQLSLAIGKGGQNARLAAKLTGWKIDIK-----------
1l2fA           QLIANALAPATVIEVEILDKENKAARVLVPPTQLSLAIGKGGQNARLAAKLTGWKIDIK-----------
1k0rA           RFVANALSPAKVVSVSVIDQTARAARVVVPDFQLSLAIGKEGQNARLAARLTGWRIDIRGDA--------
2atwC           RFVANALSPAKVVSVSVIDQTARAARVVVPDFQLSLAIGKEGQNARLAARLTGWRIDIRGDA--------
2atwA           RFVANALSPAKVVSVSVIDQTARAARVVVPDFQLSLAIGKEGQNARLAARLTGWRIDIRGDA--------
2asbA           RFVANALSPAKVVSVSVIDQTARAARVVVPDFQLSLAIGKEGQNARLAARLTGWRIDIRGDA--------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxx
1hh2P           -------------------------
1l2fA           -------------------------
1k0rA           -------------------------
2atwC           -------------------------
2atwA           -------------------------
2asbA           -------------------------