[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:ABD99438.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1s7oC.bssp"
#ERROR : Can't open dsspfile "1s7oB.bssp"
#ERROR : Can't open dsspfile "1s7oA.bssp"
#ERROR : Can't open dsspfile "1xsvA.bssp"

## Summary of PDB Search
:112
    5e-32  60%  1s7oC  [a.4.13] HYPOTHETICAL UPF0122 PROTEIN
    5e-32  60%  1s7oB  [a.4.13] HYPOTHETICAL UPF0122 PROTEIN
    1e-31  60%  1s7oA  [a.4.13] HYPOTHETICAL UPF0122 PROTEIN
    3e-23  51%  1xsvA  [a.4.13] HYPOTHETICAL UPF0122 PROTEIN SAV1236
:112

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxIEKTNRINALFDFYEPLLTPKQMTYIGLYYRDDYSLGEIAENYEVSRQAVYDNIRRTEKILEEYESKL
1s7oC           --IEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIADEFGVSRQAVYDNIKRTEKILETYEMKL
1s7oB           --IEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIADEFGVSRQAVYDNIKRTEKILETYEMKL
1s7oA           ---EKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIADEFGVSRQAVYDNIKRTEKILETYEMKL
1xsvA           ---------NYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIRRTGDLVEDYEKKL


                         .         .         *         .         .         .         .:140
query           HLYRNFQLQSEELDNLLKYVEENYAYDKELLTRINRLESLEx
1s7oC           HMYSDYVVRSEIFDDMIAH----YPHDEYLQEKISILTSID-
1s7oB           HMYSDYVVRSEIFDDMIAH----YPHDEYLQEKISILTSID-
1s7oA           HMYSDYVVRSEIFDDMIAH----YPHDEYLQEKISILTSID-
1xsvA           ELYQKFEQRREIYDE-----KQHLSNPEQIQRYIQQLEDLE-