[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:ABD99450.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bk2A.bssp"
#ERROR : Can't open dsspfile "3bk1A.bssp"
#ERROR : Can't open dsspfile "2dkfA.bssp"
#ERROR : Can't open dsspfile "2zdfA.bssp"
#ERROR : Can't open dsspfile "2zdeA.bssp"
#ERROR : Can't open dsspfile "2zddA.bssp"
#ERROR : Can't open dsspfile "2yvdA.bssp"
#ERROR : Can't open dsspfile "2zdwA.bssp"

## Summary of PDB Search
:565
    3e-58  34%  3bk2A  [x.x.x] METAL DEPENDENT HYDROLASE
    3e-58  34%  3bk1A  [x.x.x] METAL DEPENDENT HYDROLASE
    9e-07  30%  2dkfA  [x.x.x] METALLO-BETA-LACTAMASE SUPERFAMILY PROTEIN
    1e-06  26%  2zdfA  [x.x.x] METALLO-BETA-LACTAMASE SUPERFAMILY PROTEIN
    1e-06  26%  2zdeA  [x.x.x] METALLO-BETA-LACTAMASE SUPERFAMILY PROTEIN
    1e-06  26%  2zddA  [x.x.x] METALLO-BETA-LACTAMASE SUPERFAMILY PROTEIN
    1e-06  26%  2yvdA  [x.x.x] METALLO-BETA-LACTAMASE SUPERFAMILY PROTEIN
    2e-05  25%  2zdwA  [x.x.x] METALLO-BETA-LACTAMASE SUPERFAMILY PROTEIN
:565

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxIKIISLGGVRENAKNMYAVEVDDEIFILDCGLKYPENELLGIDFVIPDFSYLRENSRKIVGVFLTHG
3bk2A           ---VEIIPLGG-GEIGKNITVFRFRDEIFVLDGGLAFPE-EGPGVDLLIPRVDYLIEHRHKIKAWVLTHG
3bk1A           ---VEIIPLGG-GEIGKNITVFRFRDEIFVLDGGLAFPE-EGPGVDLLIPRVDYLIEHRHKIKAWVLTHG
2dkfA           ----RIVPFGAAREVTGSAHLLLAGGRRVLLDCGFQGKEEARNHAPFGF--------DPKEVDAVLLTHA
2zdfA           ---MRIVPFGAAREVTGSAHLLLAGGRRVLLDCGMFQGKEEARNH----APFGF---DPKEVDAVLLTHA
2zdeA           ---MRIVPFGAAREVTGSAHLLLAGGRRVLLDCGMFQGKEEARNH----APFGF---DPKEVDAVLLTHA
2zddA           ---MRIVPFGAAREVTGSAHLLLAGGRRVLLDCGMFQGKEEARNH----APFGF---DPKEVDAVLLTHA
2yvdA           ---MRIVPFGAAREVTGSAHLLLAGGRRVLLDCGMFQGKEEARNH----APFGF---DPKEVDAVLLTHA
2zdwA           ---MRIVPFGAAREVTGSAHLLLAGGRRVLLDCGMFQGKEE-------ARNHAPFGFDPKEVDAVLLTHA


                         .         .         *         .         .         .         .:140
query           HADAIGALPYFVSEFDVPVFGSELTIELAKIACENEEDARKFDDFHVIDESTEIDFENATISFFQTTHSI
3bk2A           HEDHIGGLPFFGKESPVPIYGARLTLGLLR--GKLEEFGLRPGAFNLKEISPDDRIQVGTLDLFRT-HSI
3bk1A           HEDHIGGLPFFGKESPVPIYGARLTLGLLR--GKLEEFGLRPGAFNLKEISPDDRIQVGTLDLFRT-HSI
2dkfA           HLDHVGRLPKLFREYRGPVYATRATVLLEIVL----EDALKVDEPFFGPEDVELRLGALSLAFGQAGH-L
2zdfA           HLDHVGRLPKLFREYRGPVYATRATVLLMEIVLEDEDVEEALGHLRPLEYGEWLRLGALSLAFGQAGH-L
2zdeA           HLDHVGRLPKLFREYRGPVYATRATVLLMEIVLEDEDVEEALGHLRPLEYGEWLRLGALSLAFGQAGH-L
2zddA           HLDHVGRLPKLFREYRGPVYATRATVLLMEIVLEDEDVEEALGHLRPLEYGEWLRLGALSLAFGQAGH-L
2yvdA           HLDHVGRLPKLFREYRGPVYATRATVLLMEIVLEDEDVEEALGHLRPLEYGEWLRLGALSLAFGQAGH-L
2zdwA           ALDHVGRLPKLFREYRGPVYATRATVLLMEIVLEDEDVEEALGHLRPLEYGEWLRLGALSLAFGQAGH-L


                         +         .         .         .         .         *         .:210
query           PESLGVVIKTENGNVVYTGDFKFDQSAEKGYRTDYARLTEIGREGVLALLSESANAENPRETVNERAIYD
3bk2A           PDNSGVVIRTPIGTIVHTGDFKLDPTPIDGKVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEE-IAK
3bk1A           PDNSGVVIRTPIGTIVHTGDFKLDPTPIDGKVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEE-IAK
2dkfA           PGSAFVVAQGEGRTLVYSGD--------------------------------------------------
2zdfA           PGSAFVVAQGEGRTLVYSGD--------------------------------------------------
2zdeA           PGSAFVVAQGEGRTLVYSGD--------------------------------------------------
2zddA           PGSAFVVAQGEGRTLVYSGD--------------------------------------------------
2yvdA           PGSAFVVAQGEGRTLVYSGD--------------------------------------------------
2zdwA           PGSAFVVAQGEGRTLVYSGD--------------------------------------------------


                         .         .         .         +         .         .         .:280
query           FISENFEYRKGRIIVACVASNILRVQQIFNAAAANNRKVALTGHDVEKVVKTAMRLNKLVLPEEDLLIPI
3bk2A           ELDRVIGRAPGRVFVTTFASHIHRIQSVIWAAEKYGRKVA-EGRSL-KFSRIALELGYLKV--KDRLYTL
3bk1A           ELDRVIGRAPGRVFVTTFASHIHRIQSVIWAAEKYGRKVA-EGRSL-KFSRIALELGYLKV--KDRLYTL
2dkfA           ----------------------------------------------------------------------
2zdfA           ----------------------------------------------------------------------
2zdeA           ----------------------------------------------------------------------
2zddA           ----------------------------------------------------------------------
2yvdA           ----------------------------------------------------------------------
2zdwA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KKINDYNDDEIVILETGRSGEPLKSLQKMAMGRHRFVNLHEGDLVFITTTPSHAMETKVARTRDMIYRSG
3bk2A           EEVKDLPDHQVLILATGSQGQP-SVLHRLAFEGHAKA-IKPGDTVILSSSPIPGNEEAVNRVINRLYALG
3bk1A           EEVKDLPDHQVLILATGSQGQP-SVLHRLAFEGHAKA-IKPGDTVILSSSPIPGNEEAVNRVINRLYALG
2dkfA           ----------------------------------------------------------------------
2zdfA           ----------------------------------------------------------------------
2zdeA           ----------------------------------------------------------------------
2zddA           ----------------------------------------------------------------------
2yvdA           ----------------------------------------------------------------------
2zdwA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           ADVKAIFDELNSSGHASKNDLQLMMNLVKPRYVIPVQGEYRMLSAHAELARELGIPSENIFLLKKGDVLE
3bk2A           AYVYPPTYKVHASGHASQEELKLILNLTTPRFFLPWHGEVR--HQNFKWLAESSRPPEKTLIGENGAVYR
3bk1A           AYVYPPTYKVHASGHASQEELKLILNLTTPRFFLPWHGEVR--HQNFKWLAESSRPPEKTLIGENGAVYR
2dkfA           ----------------------------------------------------------------------
2zdfA           ----------------------------------------------------------------------
2zdeA           ----------------------------------------------------------------------
2zddA           ----------------------------------------------------------------------
2yvdA           ----------------------------------------------------------------------
2zdwA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           YKKDEMTISSSVEVGNTMIDGTGVGDIGNIVLRDRKILSEDGIFIAVVTIDRKKRKIVDTPKITSRGFVY
3bk2A           LTRETFEKVGEVPHXXXXXXXXXXXXITEEILADRRHAEEG---LVVITALAGEDPVVE---VVSRGFV-
3bk1A           LTRETFEKVGEVPHXXXXXXXXXXXXITEEILADRRHAEEG---LVVITALAGEDPVVE---VVSRGFV-
2dkfA           ----------------------------------------------------------------------
2zdfA           ----------------------------------------------------------------------
2zdeA           ----------------------------------------------------------------------
2zddA           ----------------------------------------------------------------------
2yvdA           ----------------------------------------------------------------------
2zdwA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           IKTSKDLMVESRDIVAKIVQRDLDNKEFDWSQLKQDIRENLNNFLYEQTKRHPVILPVIMExxxxxxxxx
3bk2A           -KAGERLLGEVRRALEALKNGVREKKPLE--RIRDDIYYPVKKFLKKATGRDP-ILPVVIE---------
3bk1A           -KAGERLLGEVRRALEALKNGVREKKPLE--RIRDDIYYPVKKFLKKATGRDP-ILPVVIE---------
2dkfA           ----------------------------------------------------------------------
2zdfA           ----------------------------------------------------------------------
2zdeA           ----------------------------------------------------------------------
2zddA           ----------------------------------------------------------------------
2yvdA           ----------------------------------------------------------------------
2zdwA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxx
3bk2A           -----
3bk1A           -----
2dkfA           -----
2zdfA           -----
2zdeA           -----
2zddA           -----
2yvdA           -----
2zdwA           -----