[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:ABD99526.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2fj6A.bssp"
#ERROR : Can't open dsspfile "2o6kB.bssp"
#ERROR : Can't open dsspfile "2o6kA.bssp"

## Summary of PDB Search
:75
    7e-18  51%  2fj6A  [x.x.x] HYPOTHETICAL UPF0346 PROTEIN YOZE
    2e-08  41%  2o6kB  [x.x.x] UPF0346 PROTEIN MW1311
    2e-08  41%  2o6kA  [x.x.x] UPF0346 PROTEIN MW1311
:75

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxQSFYQFLMTERNPDSTDEIAQFANNAFYDQSFPKQADDYDSLSQYLELNGTYLPSMVIFDNAWTKY
2fj6A           ----KSFYHYLLKYRHPKPKDSISEFANQAYEDHSFPKTSTDYHEISSYLELNADYLHTMATFDEAWDQY
2o6kB           -----SFYQFVTVRGRHDDKGRLAE---EIFDDLAFPKHDDDFNILSDYIETHGDFLPS--VFDDLYEEY
2o6kA           -----SFYQFVTVRGRHDDKGRLAE---EIFDDLAFPKHDDDFNILSDYIETHGDFLPS--VFDDLYEEY


                         .         .         *         .         .         .         .:140
query           EEFMx
2fj6A           E----
2o6kB           TEWL-
2o6kA           TEWL-